HHsearch alignment for GI: peg_753 and conserved domain: PRK06637

>PRK06637 consensus.
Probab=100.00  E-value=0  Score=2495.23  Aligned_cols=1003  Identities=41%  Similarity=0.702  Sum_probs=943.6

Q ss_pred             CCCCHHHHHHCHHHHHHHCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCC
Q ss_conf             98813343314447644329989999999978998899811651774999999999769963899999985476643344
Q 537021.9.peg.7    8 SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTN   87 (1033)
Q Consensus         8 ~~~FvhLh~hS~ySlldg~~~~e~LV~~A~~~G~~AiAITD~~nl~Gav~F~~ackk~gIKPIiG~E~~v~~~~~~~~~~   87 (1033)
T Consensus         2 ~~~FvhLhvhS~ySlLdG~~~i~eLv~~A~~~g~~AlAlTD~~nl~Gav~F~~aa~~~GIKPIiG~el~~~~~~------   75 (1182)
T PRK06637          2 QPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALYAVKKGLQPIHGVILNIKYDI------   75 (1182)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEEEEECCC------
T ss_conf             99710104756472105075999999999985999899984876747999999999869994024899876588------


Q ss_pred             CCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCEEEECCCCCCHHHHHHHCCCHHHH
Q ss_conf             56566667753999956968999999999899732487787400789998634898899819767967888877997899
Q 537021.9.peg.7   88 QGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVA  167 (1033)
Q Consensus        88 ~~~~~~~~~~~lvlLAkN~~Gy~nL~kL~S~a~~~~~~~~~p~i~~~~L~e~~~egLIvlsg~~~g~i~~~l~~~~~~~a  167 (1033)
T Consensus        76 ------~~~~~lvLLAkn~~GY~nL~kL~S~a~~~~~~~~~p~i~~~~L~~-~~eGLI~lsg~~~g~v~~~ll~~~~~~a  148 (1182)
T PRK06637         76 ------DIFAQILLIAKDETGYKNLLKLSSLTFTKNDRKICDHINFEDLIE-YQEGLIALCCYTDGIVGKCLLARNEEQA  148 (1182)
T ss_pred             ------CCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH-HCCCCEEEECCCCCHHHHHHHCCCHHHH
T ss_conf             ------886438998079999999999999999845778888588999997-5799599836865678898856998999


Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCHHHH-HHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             999999987659868999943991158-9999999999981898998088300787889999876688469857653100
Q 537021.9.peg.7  168 EKRLLTFKKLFGDRLYVNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP  246 (1033)
Q Consensus       168 ~~~l~~l~~~Fgd~~ylEl~~~~~~e~-~~~~~l~~lA~~~~iPlVaTndv~Y~~~~D~~~h~iL~aI~~~~~l~~~~~~  246 (1033)
T Consensus       149 ~~~~~~l~~ifgd~~ylEl~~h~~~~~~~~~~~l~~lA~~~~iplVATndvhy~~~ed~~ahdvL~cI~~g~~~~~~~r~  228 (1182)
T PRK06637        149 MLFARKLQEILGDRFYFEIMRHDLPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYPDRK  228 (1182)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999871886899985489857899999999999980999898476434786068999999999679984652235


Q ss_pred             CCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             24534323434788751220358998788641110001332210234555756887768988999876541034201246
Q 537021.9.peg.7  247 RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAGLEVRLAQG  326 (1033)
Q Consensus       247 ~~~~~~yLks~eEM~~~f~~~peAi~NT~~IAe~c~~~l~~~~~~lP~f~~p~~~~~~~~~~~~Lr~l~~~Gl~~R~~~~  326 (1033)
T Consensus       229 ~~~~~~ylks~~EM~~lF~d~PeAl~NT~~IA~rC~~~~~~~~~~LP~f~~~~~-----~~~~~l~~~~~~Gl~~Rl~~~  303 (1182)
T PRK06637        229 TVSENCYFKSPHEMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKDI-----SETDLIRKDAKEGLLARLATK  303 (1182)
T ss_pred             CCCHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCC-----CHHHHHHHHHHHHHHHHHHHC
T ss_conf             678221049999999883666999999999997403313148886999999998-----878999999999999986530


Q ss_pred             CCC-------CCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHH
Q ss_conf             432-------4578389999988778989860630557888999998510476433444420466776554403756333
Q 537021.9.peg.7  327 AIA-------KGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLR  399 (1033)
Q Consensus       327 ~~~-------~~~~~~~y~~RLe~EL~vI~~~gf~~YFLiV~Div~~ak~~gI~vGpGRGSAagSLVaY~LgIT~VDPi~  399 (1033)
T Consensus       304 ~~~~~~~~~~~~~~~~~y~~RL~~EL~vI~~mgf~~YFLIV~D~I~~Ak~~gI~vGPGRGSaAGSlVaY~LgIT~VDPl~  383 (1182)
T PRK06637        304 FKSENISLENQEELKTEYFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIK  383 (1182)
T ss_pred             CCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCHHH
T ss_conf             45334661000002189999999999999877996241799999999997697116887623777999983687418134


Q ss_pred             CCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             23105676210014578753336568789999999830380215542207787788999999975279988988654310
Q 537021.9.peg.7  400 FSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI  479 (1033)
Q Consensus       400 ~~LlFERFLnp~R~~~PDIDiDf~~~~R~~vi~y~~~kyG~~~va~i~t~~t~~~k~aird~~r~~g~~~~~~~~~~~~i  479 (1033)
T Consensus       384 y~LLFERFLNpeR~smPDIDiDF~~~rReeVI~YV~~kYG~d~VAqI~Tfgt~~aksaiRDvgRvlg~p~~~~d~iaKli  463 (1182)
T PRK06637        384 FGLLFERFLNPERISMPDFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELV  463 (1182)
T ss_pred             CCCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCC
T ss_conf             17529986043567889998554500199999999998632657875321228989999999998499989999998448


Q ss_pred             CCCCCCCCCH-HHHHCCHHHHHHHH---------CCCCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHEECCCCC
Q ss_conf             1458982443-44522988788643---------0742026889872011221002447440335256666620012367
Q 537021.9.peg.7  480 PNDPAHPVSL-QAIADDSRFREARL---------ADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDV  549 (1033)
Q Consensus       480 ~~~~~~~~~~-~~~~~~~~~~~~~~---------~~~~~~~~~~~a~~leg~~r~~~~Ha~Gvvi~~~~l~~~~p~~~~~  549 (1033)
T Consensus       464 p~~~~~~~~l~~a~~~~pel~~~~~~~~l~~~~~~~~~~~~l~~~A~~LEGlpR~~s~HAaGvVIs~~pL~~~vPl~~~~  543 (1182)
T PRK06637        464 PFSAVNPVSLEQAMREVPELANAAKGNGLYNLEGEAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDA  543 (1182)
T ss_pred             CCCCCCCCCHHHHHHHCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCHHHCCCEEECC
T ss_conf             87678976899998768778877640120135531089999999999854885443456652684276502107654668


Q ss_pred             CCCCEEEEEECHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHCCCHHHH
Q ss_conf             68866885102133431123213565417899999999887402543433234435889987620141012211453478
Q 537021.9.peg.7  550 RSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMR  629 (1033)
Q Consensus       550 ~~~~~~~q~d~~~~e~~gl~K~D~Lgl~~L~~i~~~~~~i~~~~~~~d~~~ip~~D~~~~~l~~~g~t~GvFQ~es~~~~  629 (1033)
T Consensus       544 ~~~~~vtQ~d~~~~E~~GLlK~DfLGL~tLtvI~~a~~li~~~g~~idl~~ipldD~~ty~ll~~g~T~GVFQlES~gm~  623 (1182)
T PRK06637        544 NSDMLVVGYSMKYSEIAGLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMK  623 (1182)
T ss_pred             CCCCCEEECCCHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCHHCCHHHH
T ss_conf             89854331355888871870031032685599999999999619845612167677999999960777992020366999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHH
Q ss_conf             88877174048888766541141134200368885046578502696673341033553001256898878863268413
Q 537021.9.peg.7  630 QALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSE  709 (1033)
Q Consensus       630 ~~l~~~~p~~~~dl~~~~al~RPGp~~~~~~yi~rk~g~e~~~~~hp~l~~iL~~T~Gv~vyQEQvm~ia~~~ag~~~~e  709 (1033)
T Consensus       624 ~~L~~lkP~~feDlva~vAL~RPGPm~~i~~yi~rk~g~e~~~y~hp~L~~IL~~TyGVivYQEQVMqia~~~AGfslge  703 (1182)
T PRK06637        624 DALRRLKPDSIHDLIALGALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGA  703 (1182)
T ss_pred             HHHHHHCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCEEHHHHHHHHHHHHCCCHHH
T ss_conf             99997099869999888830167752322028998569989998779999985227854456798999999996799878


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             07889762012110167787899999862499999999999999975000133101478889999999999730266677
Q 537021.9.peg.7  710 ADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLA  789 (1033)
Q Consensus       710 ad~lRra~~kk~~~~~~~~~~~f~~g~~~~g~~~~~a~~i~~~i~~f~~Y~FnksHa~aya~~~y~~aylK~~yP~eF~a  789 (1033)
T Consensus       704 AD~LRRAmgKK~~~~m~~~r~~Fi~Ga~~~G~~~~~A~~if~~i~~FA~YGFnKSHaaAYAllaYqtAyLKahYP~eF~a  783 (1182)
T PRK06637        704 ADLLRRAMGKKIKKEMEEQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFLV  783 (1182)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHCCHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCHHHHHH
T ss_conf             99999997468634699999999732754599999999999999987345889862277799999999999728999999


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEC-------------------------------------C
Q ss_conf             751002354202589998888636850355233421003531-------------------------------------9
Q 537021.9.peg.7  790 ASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG-------------------------------------D  832 (1033)
Q Consensus       790 a~L~~~~~~~~~~~~~i~e~~~~gi~vl~PdIN~S~~~f~~~-------------------------------------~  832 (1033)
T Consensus       784 AlL~s~~~~~~k~~~~i~ear~~Gi~VlpPdIN~S~~~f~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  863 (1182)
T PRK06637        784 ACLNLELNNHDKINLFLQEAKDNGIKIIAPNINISEGYFSVKFSDTVIPHSVKPVIPRLDRGIQEISKDTTVVKPRYDIA  863 (1182)
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHCCCEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             98516878865799999999987895818840577775035125554432223334555422111122322234456888


Q ss_pred             CEEEEEHHHHCCCCHHHHHHHHHHH-HCCCCCCHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8698502685896989999999998-379999978999734824799899998886767234790389999989999999
Q 537021.9.peg.7  833 NRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKY  911 (1033)
Q Consensus       833 ~~Ir~Gl~~Ikgvg~~~~~~Ive~r-~~g~f~sl~df~~rv~~~~~nk~~le~Li~aGAfD~~~~~R~~ll~~i~~~~~~  911 (1033)
T Consensus       864 ~~Ir~GL~aIKgvg~~~~~~Iv~~R~~~Gpf~sl~Df~~Rv~~~~~nkr~lE~Li~aGAfD~~~~~R~~l~~~~~~~~~~  943 (1182)
T PRK06637        864 GAIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQLFLSIPKLLAY  943 (1182)
T ss_pred             CCEEEEHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             83886107544887999999999998287989999999743622399999999986899756670199999999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHCEEECCCCHHHHHHHHHHCCCCCHHHHHCC-
Q ss_conf             998865431277786666555565577666899998889998-578872621163855899999987489768898505-
Q 537021.9.peg.7  912 AQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE-NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVAT-  989 (1033)
Q Consensus       912 ~~~~~~~~~~~q~~LF~~~~~~~~~~~~~~~~~~~~~~e~l~-~E~e~LGf~lS~HPl~~~~~~l~~~~~~~~~~~~~~-  989 (1033)
T Consensus       944 ~~~~~~~~~~~q~~lf~~~~~----~~~~~~~~~~~~~~~l~~~E~e~lG~yls~HPl~~~~~~l~~~~~~~~~~l~~~~ 1019 (1182)
T PRK06637        944 STSYHEEQESNQFSLIKVSSL----SPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNTADLHNNL 1019 (1182)
T ss_pred             HHHHHHHHHCCCCCCCCCCCC----CCCCCCCCCCCCHHHHHHHHHHHEEEEECCCCHHHHHHHHHHCCCCCHHHHHHHC
T ss_conf             999887554379887677777----8776777665647688887675637800639638899999983896389987546


Q ss_pred             CCC-CEEEEEEEEEEEEEECCCCCCEEEEEEEECCCCEEEEEECC
Q ss_conf             589-88999999961121015888769999998497049999539
Q 537021.9.peg.7  990 IRG-NNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033 (1033)
Q Consensus       990 ~~g-~~v~iaG~V~~i~~~~TKkG~~mafltleD~~g~~e~~iFP 1033 (1033)
T Consensus      1020 ~~~~~~v~vaG~v~~~q~~~t~~G~-~~~~~leD~tG~~e~~vf~ 1063 (1182)
T PRK06637       1020 PDGTNRVNLAGVIQKKDSRMSARGR-FVTLVLSDPENIFELSIFS 1063 (1182)
T ss_pred             CCCCEEEEEEEEEEEEEEECCCCCC-EEEEEEEECCCCEEEEEEC
T ss_conf             6887079999999661443278886-8999999689868999958