HHsearch alignment for GI: peg_753 and conserved domain: PRK07374

>PRK07374 dnaE DNA polymerase III subunit alpha; Validated.
Probab=100.00  E-value=0  Score=2514.57  Aligned_cols=1012  Identities=39%  Similarity=0.659  Sum_probs=957.8

Q ss_pred             CCHHHHHHCHHHHHHHCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCC
Q ss_conf             81334331444764432998999999997899889981165177499999999976996389999998547664334456
Q 537021.9.peg.7   10 SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLDIDMQDNLKMTNQG   89 (1033)
Q Consensus        10 ~FvhLh~hS~ySlldg~~~~e~LV~~A~~~G~~AiAITD~~nl~Gav~F~~ackk~gIKPIiG~E~~v~~~~~~~~~~~~   89 (1033)
T Consensus         2 sFvhLh~hS~YSlLdg~~~i~~Lv~~A~~~G~~AlAlTD~~nl~Gav~F~~aa~~~gIKPIiG~e~~v~~~~~~d~----   77 (1171)
T PRK07374          2 AFVPLHNHSDYSLLDGASQLPKMVERAKELGMPAIALTDHGVMYGAIELLKLCKSAGIKPIIGNEMYVINGSIDDP----   77 (1171)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCC----
T ss_conf             7515353763711051639999999999859998998628868789999999997699833676899737976566----


Q ss_pred             CCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCC----CCCCCCCCCHHHHHHHCCCCEEEECCCCCCHHHHHHHCCCHH
Q ss_conf             5666677539999569689999999998997324----877874007899986348988998197679678888779978
Q 537021.9.peg.7   90 KTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLD----QGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQ  165 (1033)
Q Consensus        90 ~~~~~~~~~lvlLAkN~~Gy~nL~kL~S~a~~~~----~~~~~p~i~~~~L~e~~~egLIvlsg~~~g~i~~~l~~~~~~  165 (1033)
T Consensus        78 ~~~~~~~~hlvlLAkN~~GY~nL~kL~S~a~~~g~~g~g~~~~p~id~~~L~~-~~eGLI~lsg~~~Gei~~~ll~~~~~  156 (1171)
T PRK07374         78 QPKKEKRYHLVVLAKNATGYKNLVKLTTISHLNGMRGRGIFSRPCIDKELLKQ-YSEGLIVSTACLGGEIPQAILRGRPD  156 (1171)
T ss_pred             CCCCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHH-CCCCCEEECCCCCCHHHHHHHCCCHH
T ss_conf             55656775189955898999999999999997204578651577689999985-68991991477556488998679988


Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCHHHH-HHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999987659868999943991158-99999999999818989980883007878899998766884698576531
Q 537021.9.peg.7  166 VAEKRLLTFKKLFGDRLYVNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD  244 (1033)
Q Consensus       166 ~a~~~l~~l~~~Fgd~~ylEl~~~~~~e~-~~~~~l~~lA~~~~iPlVaTndv~Y~~~~D~~~h~iL~aI~~~~~l~~~~  244 (1033)
T Consensus       157 ~a~~~~~~~~~iFg~~fylEiq~~g~~~~~~~n~~l~~la~~~~iplVATndv~y~~~~D~~ahd~l~cI~~g~~l~d~~  236 (1171)
T PRK07374        157 VARDVAAWYKEVFGDDFYLEIQDHGSIEDRIVNVELVRIAKELGIKLIATNDAHYLSKNDVEAHDALLCVLTGKLISDEK  236 (1171)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             99999999998638868999824898478999999999999809798996886317842588999999997799378754


Q ss_pred             CCCCCCCCCCCCHHHHHHHCCH------HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             0024534323434788751220------3589987886411100013322102345557568877689889998765410
Q 537021.9.peg.7  245 RPRVTPDHYLKNRSEMVSIFSD------LPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNKAVAG  318 (1033)
Q Consensus       245 ~~~~~~~~yLks~eEM~~~f~~------~peAi~NT~~IAe~c~~~l~~~~~~lP~f~~p~~~~~~~~~~~~Lr~l~~~G  318 (1033)
T Consensus       237 r~~~~~~~ylks~eEM~~lF~d~~~~~~~peAl~NT~~IA~rc~~~~~~~~~~lP~fp~p~g----~t~~~~L~~l~~~G  312 (1171)
T PRK07374        237 RLRYTGTEYIKSEEEMLRLFRDHLDPEVIQEAIANTVEVAEKVEEYDILGTYRMPRFPIPEG----HTAVSYLTEVTEQG  312 (1171)
T ss_pred             CCCCCHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC----CCHHHHHHHHHHHH
T ss_conf             45589766188999999987630262248999999999998532310137866888888889----99899999999988


Q ss_pred             HHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCCHH
Q ss_conf             34201246432457838999998877898986063055788899999851047643344442046677655440375633
Q 537021.9.peg.7  319 LEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPL  398 (1033)
Q Consensus       319 l~~R~~~~~~~~~~~~~~y~~RLe~EL~vI~~~gf~~YFLiV~Div~~ak~~gI~vGpGRGSAagSLVaY~LgIT~VDPi  398 (1033)
T Consensus       313 l~~R~~~~~~--~~~~~~y~~RL~~EL~vI~~mGf~~YFLIV~D~i~~Ak~~gI~vGPGRGSaAGSLVaY~LgIT~VDPl  390 (1171)
T PRK07374        313 LRKRLKLASL--DEIDENYKERLSSELKIIEQMGFPTYFLVVWDYIRFAREQGIPVGPGRGSAAGSLVAYALGITNIDPV  390 (1171)
T ss_pred             HHHHHCCCCC--CCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCHH
T ss_conf             9998175786--43679999999999999997799253699999999999739713678771476799998348555812


Q ss_pred             HCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             32310567621001457875333656878999999983038021554220778778899999997527998898865431
Q 537021.9.peg.7  399 RFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL  478 (1033)
Q Consensus       399 ~~~LlFERFLnp~R~~~PDIDiDf~~~~R~~vi~y~~~kyG~~~va~i~t~~t~~~k~aird~~r~~g~~~~~~~~~~~~  478 (1033)
T Consensus       391 ~y~LLFERFLNpeR~smPDIDiDF~~~rR~eVI~Yv~~kYG~d~VAqI~Tf~t~~akaaiRDVgRvlg~p~~~~d~iaKl  470 (1171)
T PRK07374        391 KNGLLFERFLNPERKSMPDIDTDFCIERRGEVIDYVTRRYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYGEADKLAKL  470 (1171)
T ss_pred             HCCCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             13886876058777788886755440048999999998838755686421032224799999999868987789999960


Q ss_pred             CCCCCCCCCCHHH-HHC---CHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHEECCCCCCCCCE
Q ss_conf             0145898244344-522---988788643074202688987201122100244744033525666662001236768866
Q 537021.9.peg.7  479 IPNDPAHPVSLQA-IAD---DSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRSDLP  554 (1033)
Q Consensus       479 i~~~~~~~~~~~~-~~~---~~~~~~~~~~~~~~~~~~~~a~~leg~~r~~~~Ha~Gvvi~~~~l~~~~p~~~~~~~~~~  554 (1033)
T Consensus       471 ip~~~g~~~~l~~~~~~~~~~~~l~~~~~~d~~~~~~~~~A~~LEGlpR~~g~HAaGvVIs~~pL~~~vPl~~~~-~g~~  549 (1171)
T PRK07374        471 IPVVRGKPAKLAAMIGEESPSPEFREKYENDPRVKKWVDMAMRIEGTNKTFGVHAAGVVIASDPLDELVPLQRNN-DGQI  549 (1171)
T ss_pred             CCCCCCCCCCHHHHHHCCCCCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCEEECC-CCCE
T ss_conf             875579960099996405669899987733999999999999863873321235652573377743136513578-8984


Q ss_pred             EEEEECHHHHHHCCCHHHHHHHCCHHHHHHHHHHHHH-HCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHCCCHHHHHHHH
Q ss_conf             8851021334311232135654178999999998874-025434332344358899876201410122114534788887
Q 537021.9.peg.7  555 VTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALE  633 (1033)
Q Consensus       555 ~~q~d~~~~e~~gl~K~D~Lgl~~L~~i~~~~~~i~~-~~~~~d~~~ip~~D~~~~~l~~~g~t~GvFQ~es~~~~~~l~  633 (1033)
T Consensus       550 vtQ~dk~dvE~~GLlK~DfLGLr~LtiI~~a~~~I~~~~g~~idl~~IpldD~~t~~ll~~g~T~GVFQlES~gm~~~l~  629 (1171)
T PRK07374        550 ITQYFMEDIESLGLLKMDFLGLKNLTMIEKTVELVEQSTGERIDPDNLPLEDEKTFELLGRGDLEGIFQLESSGMRQIVR  629 (1171)
T ss_pred             EECCCHHHHHHCCCHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHH
T ss_conf             23035655887698366676368679999999999985499777133686619999998554878834136679999999


Q ss_pred             HHCCCHHHHHHHHHHHCCCHHHHHH--HHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             7174048888766541141134200--36888504657850269667334103355300125689887886326841307
Q 537021.9.peg.7  634 GMQPDCIEDIIALVSLYRPGPIDNI--VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD  711 (1033)
Q Consensus       634 ~~~p~~~~dl~~~~al~RPGp~~~~--~~yi~rk~g~e~~~~~hp~l~~iL~~T~Gv~vyQEQvm~ia~~~ag~~~~ead  711 (1033)
T Consensus       630 ~lkP~~feDiva~~AL~RPGP~~~gmi~~yi~Rk~g~e~i~y~hp~L~~IL~~TyGvivYQEQVMqia~~~aGfslgeAD  709 (1171)
T PRK07374        630 DLKPSSLEDISSILALYRPGPLDAGLIPKFINRKHGREAIDFAHPLLEPILTETYGIMVYQEQIMKIAQDLAGYSLGQAD  709 (1171)
T ss_pred             HCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCEEEEHHHHHHHHHHHHCCCHHHHH
T ss_conf             71999899999888424787554443389998517997888998999865424378787599999999986069978999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88976201211016778789999986249999999999999997500013310147888999999999973026667775
Q 537021.9.peg.7  712 VLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAAS  791 (1033)
Q Consensus       712 ~lRra~~kk~~~~~~~~~~~f~~g~~~~g~~~~~a~~i~~~i~~f~~Y~FnksHa~aya~~~y~~aylK~~yP~eF~aa~  791 (1033)
T Consensus       710 ~LRRAmgKKk~~~m~~~r~~Fi~Ga~~~G~~~~~A~~if~~i~~Fa~YgFnkSHaaAYa~~aYqtAyLK~hyP~eF~aal  789 (1171)
T PRK07374        710 LLRRAMGKKKVSEMQKHRGIFVEGASKRGVDEKVADELFDQMVLFAEYCFNKSHSTAYGAVTYQTAYLKAHYPVAYMAAL  789 (1171)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             99998754868899999999997898759999999999999996468787842268999999999999977899999998


Q ss_pred             HCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCEEEEEHHHHCCCCHHHHHHHHHHH-HCCCCCCHHHHHH
Q ss_conf             100235420258999888863685035523342100353198698502685896989999999998-3799999789997
Q 537021.9.peg.7  792 MTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCS  870 (1033)
Q Consensus       792 L~~~~~~~~~~~~~i~e~~~~gi~vl~PdIN~S~~~f~~~~~~Ir~Gl~~Ikgvg~~~~~~Ive~r-~~g~f~sl~df~~  870 (1033)
T Consensus       790 L~~~~~~~~k~~~~i~ea~~~gi~vlpPdIN~S~~~f~~~~~~I~~gl~~Ikgvg~~~~~~Iv~~R~~~Gpf~sl~Df~~  869 (1171)
T PRK07374        790 LTVNAGSSDKVQRYISNCNSMGIEVMPPDINASGIDFTPKGNRILFGLSAVKNLGDGAIRNLIASRDSDGPFKSLADLCD  869 (1171)
T ss_pred             HCCCCCCCHHHHHHHHHHHHCCCCEECCCEEEECCCEEECCCCEEHHHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             50588997479999999998799162883322178216759822146567437339999999999985859798999996


Q ss_pred             HCCCCCCCHHHHHHHHHCCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC--------CCCCCCC
Q ss_conf             34824799899998886767234790--3899999899999999988654312777866665555--------6557766
Q 537021.9.peg.7  871 RVDSKKLNRRVLESLVFAGALDCFGY--SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGT--------FSDKITL  940 (1033)
Q Consensus       871 rv~~~~~nk~~le~Li~aGAfD~~~~--~R~~ll~~i~~~~~~~~~~~~~~~~~q~~LF~~~~~~--------~~~~~~~  940 (1033)
T Consensus       870 Rv~~~~~nr~~le~Li~aGAfD~l~~~~~R~~l~~~~~~~~~~a~~~~~~~~~gq~~lf~~~~~~~~~~~~~~~~~~p~~  949 (1171)
T PRK07374        870 RLPSNVLNRRSLESLIHCGALDAFSPNANRAQLIADLDLVIDWASSRARDRASGQGNLFDLLAGASEEEASNDLSSAPKA  949 (1171)
T ss_pred             HCCCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHCHHHHHHHHHHHHHHHHCCCCCCHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             40631289899999997796011798888999986649999999997455433674400002455433333322237767


Q ss_pred             CCCCCCCHHHHHHHHHHHHCEEECCCCHHHHHHHHHHCCCCCHHHHHCCCCCCEEEEEEEEEEEEEECCCCCCEEEEEEE
Q ss_conf             68999988899985788726211638558999999874897688985055898899999996112101588876999999
Q 537021.9.peg.7  941 EKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020 (1033)
Q Consensus       941 ~~~~~~~~~e~l~~E~e~LGf~lS~HPl~~~~~~l~~~~~~~~~~~~~~~~g~~v~iaG~V~~i~~~~TKkG~~mafltl 1020 (1033)
T Consensus       950 ~~~~~~~~~e~l~~E~e~lG~yls~HPl~~~~~~~~~~~~~~~~~l~~~~~~~~v~v~g~v~~~~~~~Tk~G~~maf~tl 1029 (1171)
T PRK07374        950 APVPDYPPTEKLKLEKELLGFYLSDHPLKQLTEPAKLLAPISLSSLEEQKDKAKVSVIAMIPEMRQVTTRKGDRMAILQL 1029 (1171)
T ss_pred             CCCCCCCHHHHHHHHHHHHEECCCCCHHHHHHHHHHHHCCCCHHHHHHCCCCCEEEEEEEEEEEEECCCCCCCEEEEEEE
T ss_conf             88889987789999888863421417099999999972883799985077998899999997625267789996899999


Q ss_pred             ECCCCEEEEEECC
Q ss_conf             8497049999539
Q 537021.9.peg.7 1021 SEPAKEYEANFFP 1033 (1033)
Q Consensus      1021 eD~~g~~e~~iFP 1033 (1033)
T Consensus      1030 eD~tg~~evvvFp 1042 (1171)
T PRK07374       1030 EDLTGSCEAVVFP 1042 (1171)
T ss_pred             EECCCCEEEEECH
T ss_conf             9899868999978