HHsearch alignment for GI: peg_754 and conserved domain: PRK08957

>PRK08957 consensus.
Probab=99.16  E-value=2e-09  Score=79.50  Aligned_cols=146  Identities=16%  Similarity=0.209  Sum_probs=115.5

Q ss_pred             CCHHCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEE--EEECCCCCCCCCCCE
Q ss_conf             711002866761489850134433323555310278752210589999987875249982899--984100167776426
Q 537021.9.peg.7   11 NRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYII--VVSQEDKLSLQRDSI   88 (184)
Q Consensus        11 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~~~~LLe~gkpvii--~VsAe~rle~eg~~L   88 (184)
T Consensus      1001 ~~~~~~tkkg~~-maf------------~~leD~tg~~e~vvfp~~~~~~~-~~l~~~~~~~v~G~v~~~~~--~~~~~~ 1064 (1159)
T PRK08957       1001 AARVMVTKRGNR-IGI------------CTLDDRSGRLEVMLFTDALEKYQ-HLLEKDRILIVSGQVSFDDF--SGGLKM 1064 (1159)
T ss_pred             EEEECCCCCCCE-EEE------------EEEEECCCCEEEEECHHHHHHHH-HHHCCCCEEEEEEEEEEECC--CCCEEE
T ss_conf             977557899898-899------------99998998689999789999999-98626987999999986057--996269


Q ss_pred             EEEECCCHHHHHHHHCCCEEEEEEC----CCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEEEECC-CCCCCH-
Q ss_conf             9865041589997320110999738----0157899999611221037888713999974898547999668-970789-
Q 537021.9.peg.7   89 RLLWVESLEKKSMEMLDSLRVYLQD----RSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLD-HYPISP-  162 (184)
Q Consensus        89 Ri~~vepLD~aAa~~~kgLRIfVrD----~~pL~sI~s~Le~~~~~~~~G~G~V~Lvli~~~~~~EVEI~Lp-~f~VSP-  162 (184)
T Consensus      1065 ~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~l~~~l~~----~~~G~~~v~l~~~~~~--~~~~~~l~~~~~v~~~ 1138 (1159)
T PRK08957       1065 TAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP----HRSGTIPVHLYYQRAD--ARARLRLGATWRVTPS 1138 (1159)
T ss_pred             EEEECCCHHHHHHHCCCCEEEEEEHHHCCHHHHHHHHHHHHH----CCCCCCEEEEEEECCC--CEEEEECCCCCEECCC
T ss_conf             998657689998703870799960331698999999999984----4899950899996698--2699987998436588


Q ss_pred             -HHHHHHHHCCCHHEHH
Q ss_conf             -8999874064621110
Q 537021.9.peg.7  163 -EIAFDLEHITGITKVV  178 (184)
Q Consensus       163 -qIagALKsIpGVl~Ve  178 (184)
T Consensus      1139 ~~~~~~l~~l~G~~nV~ 1155 (1159)
T PRK08957       1139 DRLLNDLRTLLGSEQVE 1155 (1159)
T ss_pred             HHHHHHHHHHHCCCCEE
T ss_conf             99999999961987189