HHsearch alignment of GI: peg_754 and MMDB domain: 3f2b_A_1-110

>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A*
Probab=92.09  E-value=0.14  Score=30.42  Aligned_cols=75  Identities=8%  Similarity=-0.031  Sum_probs=56.0

Q ss_pred             CCHHCCCCCCCEEEEEEEHHHHHHHHHHHHHHCCCCCEEEEEHH--HHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCE
Q ss_conf             71100286676148985013443332355531027875221058--9999987875249982899984100167776426
Q 537021.9.peg.7   11 NRKGKKKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQ--QQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSI   88 (184)
Q Consensus        11 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~le~~~~~LLe~gkpvii~VsAe~rle~eg~~L   88 (184)
                      +.+-+.+-.|+. ++|            +...|.||++.+..|.  ..+++-+ ..|.+|..|+|.-.-+-.-...+.++
T Consensus        28 ~~~~~~tK~G~~-~~~------------~~l~D~tg~ie~~~F~~~~~~~~~~-~~l~~g~~v~v~G~v~~~~~~~~~~l   93 (110)
T 3f2b_A           28 DAEVSELKSGRT-LLT------------MKITDYTNSILVKMFSRDKEDAELM-SGVKKGMWVKVRGSVQNDTFVRDLVI   93 (110)
T ss_dssp             EEEEEECTTSCE-EEE------------EEEECSSCEEEEEEECSSHHHHHHH-HTCCTTCEEEEEEEEEEETTTTEEEE
T ss_pred             EEEEEEECCCCE-EEE------------EEEEECCCCEEEEEECCCCCHHHHH-HHCCCCCEEEEEEEEECCCCCCCEEE
T ss_conf             778787058988-999------------9998278868999955874328898-50679968999998851577774278


Q ss_pred             EEEECCCHHHH
Q ss_conf             98650415899
Q 537021.9.peg.7   89 RLLWVESLEKK   99 (184)
Q Consensus        89 Ri~~vepLD~a   99 (184)
                      .+..+.||+++
T Consensus        94 ~v~~i~~i~~~  104 (110)
T 3f2b_A           94 IANDLNEIAAN  104 (110)
T ss_dssp             EEEEEEEECCC
T ss_pred             EEEEEEECCCC
T ss_conf             72123654775