BLAST/PSIBLAST alignment of GI: peg_754 and GI: 190891309 at iteration 1
>gi|190891309|ref|YP_001977851.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165
>gi|190696588|gb|ACE90673.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165
 Score = 57.4 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 64/115 (55%), Gaps = 9/115 (7%)

Query: 64   LLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYLQDRSPLREIHKY 123
            +L   K +++  + E++   +   +R+  ++SLE+KS++M  +LRVY++D  PL+ +  +
Sbjct: 1056 MLESGKSFLLTATGEERP--EGIGLRIQTIQSLEEKSLQMQKALRVYIRDSGPLKMVAGH 1113

Query: 124  FENRQTQNYDKQGKIGLIFLRSQGKIEIEITL-DHYPISPEIAFDLEHITGITKV 177
                   N    G +  I ++ +GK E+E+ L + Y I+PEIA  L    G+  V
Sbjct: 1114 L------NAKGDGLVSFIVIKEEGKREVEVALPEKYRITPEIAAALRAAPGVVDV 1162