Query 537021.9.peg.786_1 Match_columns 38 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 01:03:21 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_786.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam09668 Asp_protease Asparty 18.2 99 0.0025 14.7 3.0 20 2-21 21-40 (124) 2 TIGR01599 PYST-A Plasmodium yo 15.2 73 0.0019 15.3 1.1 14 8-21 191-204 (213) 3 pfam02330 MAM33 Mitochondrial 14.5 1.2E+02 0.0031 14.2 2.1 14 19-32 41-54 (203) 4 pfam10107 Endonuc_Holl Endonuc 13.3 77 0.002 15.2 0.7 19 3-21 114-133 (153) 5 pfam11518 DUF3221 Protein of u 12.3 1E+02 0.0027 14.6 1.2 12 22-33 71-82 (99) 6 TIGR02194 GlrX_NrdH Glutaredox 11.2 45 0.0011 16.4 -1.0 19 1-19 10-30 (72) 7 TIGR02918 TIGR02918 conserved 10.9 1.6E+02 0.0042 13.6 2.1 26 7-32 69-108 (511) 8 TIGR02623 G1P_cyt_trans glucos 10.5 1.1E+02 0.0029 14.4 0.8 14 22-35 55-68 (256) 9 COG3592 Uncharacterized conser 8.1 2.1E+02 0.0054 13.0 1.5 14 20-33 9-22 (74) 10 KOG0095 consensus 7.4 2.3E+02 0.0059 12.9 3.1 22 13-34 42-63 (213) No 1 >pfam09668 Asp_protease Aspartyl protease. This family of eukaryotic aspartyl proteases have a fold similar to retroviral proteases which implies they function proteolytically during regulated protein turnover. Probab=18.20 E-value=99 Score=14.69 Aligned_cols=20 Identities=20% Similarity=0.469 Sum_probs=15.5 Q ss_pred CEEEEEEEEEEEEEEEEEEE Q ss_conf 02799999786105875311 Q 537021.9.peg.7 2 QCKMVFLDVKVAGYQIKKKE 21 (38) Q Consensus 2 qckmvfldvkvagyqikkke 21 (38) +..|.|.++++.|..+|--- T Consensus 21 ~v~MLyi~~~iNG~~vkAfV 40 (124) T pfam09668 21 RVTMLYINCEVNGVPVKAFV 40 (124) T ss_pred EEEEEEEEEEECCEEEEEEE T ss_conf 67799999999999999999 No 2 >TIGR01599 PYST-A Plasmodium yoelii subtelomeric family PYST-A; InterPro: IPR006486 A single high-scoring gene was identified in the complete genome of P. falciparum as well as a single gene from P. chaboudi. There are no obvious homologs to these genes in any non-Plasmodium organism. These observations suggest an expansion of this family in yoelii from a common Plasmodium ancestor gene (present in a single copy in falciparum).. Probab=15.25 E-value=73 Score=15.34 Aligned_cols=14 Identities=43% Similarity=0.750 Sum_probs=11.4 Q ss_pred EEEEEEEEEEEEEE Q ss_conf 99786105875311 Q 537021.9.peg.7 8 LDVKVAGYQIKKKE 21 (38) Q Consensus 8 ldvkvagyqikkke 21 (38) +=|-.+||-|||++ T Consensus 191 mfvnLsGf~IKk~d 204 (213) T TIGR01599 191 MFVNLSGFIIKKKD 204 (213) T ss_pred EEEEECCEEEECCC T ss_conf 01100010687056 No 3 >pfam02330 MAM33 Mitochondrial glycoprotein. This mitochondrial matrix protein family contains members of the MAM33 family which bind to the globular 'heads' of C1Q. It is thought to be involved in mitochondrial oxidative phosphorylation and in nucleus-mitochondrion interactions. Probab=14.45 E-value=1.2e+02 Score=14.23 Aligned_cols=14 Identities=43% Similarity=0.686 Sum_probs=11.0 Q ss_pred EEECCCCEEEEEEE Q ss_conf 31137637899975 Q 537021.9.peg.7 19 KKECKGEKIKVFFA 32 (38) Q Consensus 19 kkeckgekikvffa 32 (38) .|+..||+|+|+|. T Consensus 41 tR~~g~E~I~V~F~ 54 (203) T pfam02330 41 TRKVGGEKIHVTFN 54 (203) T ss_pred EEECCCCEEEEEEE T ss_conf 99539937999997 No 4 >pfam10107 Endonuc_Holl Endonuclease related to archaeal Holliday junction resolvase. This domain is found in various predicted bacterial endonucleases which are distantly related to archaeal Holliday junction resolvases. Probab=13.28 E-value=77 Score=15.24 Aligned_cols=19 Identities=26% Similarity=0.569 Sum_probs=12.7 Q ss_pred EEEEEEEEEEEEE-EEEEEE Q ss_conf 2799999786105-875311 Q 537021.9.peg.7 3 CKMVFLDVKVAGY-QIKKKE 21 (38) Q Consensus 3 ckmvfldvkvagy-qikkke 21 (38) ++.+|+|||..+. |..+++ T Consensus 114 ~~IvfiEVKsGksa~Lt~~q 133 (153) T pfam10107 114 REIVFVEVKTGKSARLTERE 133 (153) T ss_pred CEEEEEEECCCCCCCCCHHH T ss_conf 44999996458642458778 No 5 >pfam11518 DUF3221 Protein of unknown function (DUF3221). This family of proteins with unknown function appears to be restricted to Bacillus. Some members in this family of proteins are annotated as YobA however this cannot be confirmed. YobA is a protein with unknown function. Probab=12.29 E-value=1e+02 Score=14.57 Aligned_cols=12 Identities=42% Similarity=0.786 Sum_probs=8.2 Q ss_pred CCCCEEEEEEEE Q ss_conf 376378999751 Q 537021.9.peg.7 22 CKGEKIKVFFAD 33 (38) Q Consensus 22 ckgekikvffad 33 (38) -.|.||||+|.. T Consensus 71 k~G~KIKVW~s~ 82 (99) T pfam11518 71 KVGQKIKVWYSQ 82 (99) T ss_pred HCCCEEEEEHHH T ss_conf 058779983132 No 6 >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterised by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase .; GO: 0006118 electron transport, 0045454 cell redox homeostasis. Probab=11.16 E-value=45 Score=16.40 Aligned_cols=19 Identities=26% Similarity=0.454 Sum_probs=12.1 Q ss_pred CCEEEE--EEEEEEEEEEEEE Q ss_conf 902799--9997861058753 Q 537021.9.peg.7 1 LQCKMV--FLDVKVAGYQIKK 19 (38) Q Consensus 1 lqckmv--fldvkvagyqikk 19 (38) .||||+ ||+-.-..||+.- T Consensus 10 vQCkmTKk~L~~~~i~Fe~in 30 (72) T TIGR02194 10 VQCKMTKKALEEHGIAFEEIN 30 (72) T ss_pred CCCCHHHHHHHHCCCCEEEEE T ss_conf 052157766763799615763 No 7 >TIGR02918 TIGR02918 conserved hypothetical protein TIGR02918; InterPro: IPR014267 Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus.. Probab=10.90 E-value=1.6e+02 Score=13.61 Aligned_cols=26 Identities=42% Similarity=0.890 Sum_probs=20.3 Q ss_pred EEEEEEE-------------EEEEEEEEC-CCCEEEEEEE Q ss_conf 9997861-------------058753113-7637899975 Q 537021.9.peg.7 7 FLDVKVA-------------GYQIKKKEC-KGEKIKVFFA 32 (38) Q Consensus 7 fldvkva-------------gyqikkkec-kgekikvffa 32 (38) |-|+|.| +..+.+.|- +|--+++||. T Consensus 69 FTDiKIAPTtYTvd~l~~~l~~~~~~~E~vnGK~~~~ff~ 108 (511) T TIGR02918 69 FTDIKIAPTTYTVDDLEKELGLEITRREKVNGKVVKLFFN 108 (511) T ss_pred CCCCEECCCCCCHHHHHHHHCCCCEEEEEECCCEEEEEEE T ss_conf 4653052454407898975188540351006608999998 No 8 >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; InterPro: IPR013446 Glucose-1-phosphate cytidylyltransferases, also known as CDP-glucose pyrophosphorylase, are the product of the rfbF gene and produce CDP-D-glucose.. Probab=10.47 E-value=1.1e+02 Score=14.42 Aligned_cols=14 Identities=43% Similarity=0.710 Sum_probs=11.1 Q ss_pred CCCCEEEEEEEEEE Q ss_conf 37637899975101 Q 537021.9.peg.7 22 CKGEKIKVFFADFT 35 (38) Q Consensus 22 ckgekikvffadft 35 (38) -||.-||-||+.+. T Consensus 55 YkGy~IKeyF~NY~ 68 (256) T TIGR02623 55 YKGYVIKEYFANYF 68 (256) T ss_pred CCCCEEEEECCCCE T ss_conf 43322010010632 No 9 >COG3592 Uncharacterized conserved protein [Function unknown] Probab=8.10 E-value=2.1e+02 Score=13.04 Aligned_cols=14 Identities=36% Similarity=0.926 Sum_probs=10.7 Q ss_pred EECCCCEEEEEEEE Q ss_conf 11376378999751 Q 537021.9.peg.7 20 KECKGEKIKVFFAD 33 (38) Q Consensus 20 keckgekikvffad 33 (38) +.-+||||.++|+. T Consensus 9 r~y~Gekidi~fn~ 22 (74) T COG3592 9 RKYRGEKIDIYFNT 22 (74) T ss_pred CEECCCEEEEEECC T ss_conf 13026357887231 No 10 >KOG0095 consensus Probab=7.45 E-value=2.3e+02 Score=12.87 Aligned_cols=22 Identities=41% Similarity=0.516 Sum_probs=17.6 Q ss_pred EEEEEEEEECCCCEEEEEEEEE Q ss_conf 1058753113763789997510 Q 537021.9.peg.7 13 AGYQIKKKECKGEKIKVFFADF 34 (38) Q Consensus 13 agyqikkkeckgekikvffadf 34 (38) .++-||.-|..|||||.-.-|- T Consensus 42 vdfmiktvev~gekiklqiwdt 63 (213) T KOG0095 42 VDFMIKTVEVNGEKIKLQIWDT 63 (213) T ss_pred EEEEEEEEEECCEEEEEEEEEC T ss_conf 3379999998780899998413 Done!