BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.789_1 (143 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.789_1 Length = 143 Score = 277 bits (708), Expect = 6e-77, Method: Compositional matrix adjust. Identities = 143/143 (100%), Positives = 143/143 (100%) Query: 1 MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGT 60 MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGT Sbjct: 1 MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGT 60 Query: 61 GMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALS 120 GMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALS Sbjct: 61 GMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALS 120 Query: 121 LLATIFPSWKASRIDPVKVLRGE 143 LLATIFPSWKASRIDPVKVLRGE Sbjct: 121 LLATIFPSWKASRIDPVKVLRGE 143 >gi|254780300|ref|YP_003064713.1| aspartate carbamoyltransferase catalytic subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 316 Score = 24.3 bits (51), Expect = 1.0, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 13/20 (65%) Query: 28 RRDIAILRTMGARISSIMSI 47 R DI +L TMGARI I I Sbjct: 174 RSDIMLLNTMGARIRVIAPI 193 >gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Score = 23.1 bits (48), Expect = 2.2, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 16/20 (80%) Query: 16 IISSLVMLVQERRRDIAILR 35 +I+++V L Q RR+D+ +LR Sbjct: 508 VITTVVDLPQFRRKDLKLLR 527 >gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 20.8 bits (42), Expect = 9.9, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 78 RKFFL-HTLGVVIFDTEAYLLTELPSK 103 K+F+ HT +++FDT ++ +P K Sbjct: 154 EKYFVDHTTALLLFDTAGSIVGVIPYK 180 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.332 0.143 0.411 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,124 Number of Sequences: 1233 Number of extensions: 2826 Number of successful extensions: 10 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 5 length of query: 143 length of database: 328,796 effective HSP length: 66 effective length of query: 77 effective length of database: 247,418 effective search space: 19051186 effective search space used: 19051186 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 34 (17.7 bits)