HHsearch alignment of GI: peg_816 and MMDB domain: 2qlc_A_

>2qlc_A (A:) DNA repair protein RADC homolog; MCSG, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: DNA; 2.30A {Chlorobium tepidum tls}
Probab=100.00  E-value=6e-38  Score=244.46  Aligned_cols=97  Identities=37%  Similarity=0.587  Sum_probs=95.9

Q ss_pred             CCCCCCCCEEEEEEEEECCCCEEEECHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             95156887734899854046358932999999999731968999955689898814778999999999997649889979
Q 537021.9.peg.8    1 LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMTQNIITTLNPLNIIVHDH   80 (97)
Q Consensus         1 l~Ld~~~~li~~e~i~~Gt~~~~~v~~r~i~~~al~~~A~~vilaHNHPsG~~~PS~~Di~~T~~l~~a~~~l~i~llDH   80 (97)
                      +|||++|++++++.+++||++++.++||+||++||+.+|+++|++||||||+++||++|+++|++|+++|+.+||+|+||
T Consensus        30 l~Ld~~~~ii~~~~i~~Gt~~~~~v~~R~i~~~al~~~A~~vil~HNHPsG~~~PS~~D~~~T~~l~~a~~~l~I~llDH  109 (126)
T 2qlc_A           30 LFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADKQVTSILKKAGDLLQIELLDH  109 (126)
T ss_dssp             EEECTTCBEEEEEEEEESSCCGGGCCHHHHHHHHHHTTCSEEEEEEECSSSCCSCCHHHHHHHHHHHHHHHHHTCEEEEE
T ss_pred             EEECCCCCEEEEEEECCCCCCEEEECHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99879998878999715777457883999999999816975999987477889978667999999999997689889769


Q ss_pred             EEECCCCEEEHHHCCCC
Q ss_conf             99859959974525899
Q 537021.9.peg.8   81 IIIGKDAFVSFKGLRII   97 (97)
Q Consensus        81 iIv~~~~~~S~re~gll   97 (97)
                      +|||+++||||||+|+|
T Consensus       110 iIi~~~~~~S~~e~gll  126 (126)
T 2qlc_A          110 VIVGNNDWFSFRDHALL  126 (126)
T ss_dssp             EEECSSCEEETTTTTCC
T ss_pred             EEEECCEEEEHHHCCCC
T ss_conf             99929909986635789