HHsearch results for GI: peg_816 and protein with PDBid: 2kks_A

>2kks_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiative; NMR {Desulfitobacterium hafniense Y51}
Probab=92.50  E-value=0.12  Score=29.85  Aligned_cols=56  Identities=20%  Similarity=0.233  Sum_probs=38.9

Q ss_pred             CCCEEEECHHHHHH---HHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             46358932999999---9997319689999556898988147789999999999976498899799985
Q 537021.9.peg.8   19 TIDHVPVYIREIVQ---RCLELSATSIILVHNHPSGNPNPSDADINMTQNIITTLNPLNIIVHDHIIIG   84 (97)
Q Consensus        19 t~~~~~v~~r~i~~---~al~~~A~~vilaHNHPsG~~~PS~~Di~~T~~l~~a~~~l~i~llDHiIv~   84 (97)
                      +.+.-.++|++.++   .+-..+-.-+-+.|-||.+.+.||..|++.-       ..-+..   .+||+
T Consensus        51 ~~~~f~~dp~~~~~~~~~~~~~~~~ivG~~HSHP~~~a~PS~~D~~~~-------~~~~~~---~lIvs  109 (146)
T 2kks_A           51 SPEHFSMDPREQLTAVKDMRKNGWVMLGNFHSHPATPARPSAEDKRLA-------FDPSLS---YLIIS  109 (146)
T ss_dssp             CSSSCCCCHHHHHHHHHHHHHHTCEEEEEEEEESSSCSSCCHHHHTTC-------CSSSCE---EEEEE
T ss_pred             CCCEEEECHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHH-------HCCCCE---EEEEE
T ss_conf             985697088999999999985698799999579999999998999972-------758983---99999