BLAST/PSIBLAST alignment of GI: peg_816 and GI: 90419162 at iteration 1
>gi|90419162|ref|ZP_01227072.1| DNA repair protein [Aurantimonas manganoxydans SI85-9A1] Length = 257
>gi|90336099|gb|EAS49840.1| DNA repair protein [Aurantimonas manganoxydans SI85-9A1] Length = 257
 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 161 LFLDKKNALIADEVQGTGTVDHTPVYTREVVKRGLELSATAIILVHNHPSGDPTPSRADI 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIGK+   S KGLR+I
Sbjct: 221 EMTRTIIDTAKPLGIAVHDHIIIGKNGHASLKGLRLI 257