BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.816_1
         (97 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|15640247|ref|NP_229874.1| DNA repair protein RadC [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|147674401|ref|YP_001218476.1| DNA repair protein RadC [Vibrio cholerae O395]
 gi|153820026|ref|ZP_01972693.1| DNA repair protein RadC [Vibrio cholerae NCTC 8457]
 gi|227080437|ref|YP_002808988.1| DNA repair protein RadC [Vibrio cholerae M66-2]
 gi|229506982|ref|ZP_04396490.1| DNA repair protein RadC [Vibrio cholerae BX 330286]
 gi|229509352|ref|ZP_04398835.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229516299|ref|ZP_04405747.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229606490|ref|YP_002877138.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|254851346|ref|ZP_05240696.1| DNA repair protein RadC [Vibrio cholerae MO10]
 gi|255744029|ref|ZP_05417983.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|298500859|ref|ZP_07010661.1| DNA repair protein RadC [Vibrio cholerae MAK 757]
 gi|13431812|sp|Q9KVC9|Y217_VIBCH RecName: Full=UPF0758 protein VC_0217
 gi|172047481|sp|A5F402|Y3797_VIBC3 RecName: Full=UPF0758 protein VC0395_A2597/VC395_0249
 gi|254789668|sp|C3LQH9|Y205_VIBCM RecName: Full=UPF0758 protein VCM66_0205
 gi|9654624|gb|AAF93393.1| DNA repair protein RadC [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|126509430|gb|EAZ72024.1| DNA repair protein RadC [Vibrio cholerae NCTC 8457]
 gi|146316284|gb|ABQ20823.1| DNA repair protein RadC [Vibrio cholerae O395]
 gi|227008325|gb|ACP04537.1| DNA repair protein RadC [Vibrio cholerae M66-2]
 gi|227012064|gb|ACP08274.1| DNA repair protein RadC [Vibrio cholerae O395]
 gi|229346725|gb|EEO11695.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229353667|gb|EEO18604.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229356087|gb|EEO21006.1| DNA repair protein RadC [Vibrio cholerae BX 330286]
 gi|229369145|gb|ACQ59568.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|254847051|gb|EET25465.1| DNA repair protein RadC [Vibrio cholerae MO10]
 gi|255738294|gb|EET93685.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|297540363|gb|EFH76422.1| DNA repair protein RadC [Vibrio cholerae MAK 757]
          Length = 224

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH ++G    VSF     I
Sbjct: 188 RITDRLRDALGLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|254436013|ref|ZP_05049520.1| DNA repair protein RadC [Nitrosococcus oceani AFC27]
 gi|207089124|gb|EDZ66396.1| DNA repair protein RadC [Nitrosococcus oceani AFC27]
          Length = 230

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E   RGTID   V+ RE+++R L  +A ++IL HNHPSG   PS AD 
Sbjct: 134 LFLDNRHRVLAFEELFRGTIDGASVHPREVLKRALAHNAAAVILAHNHPSGVAEPSRADE 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DHII+G    +SF    ++
Sbjct: 194 CITQRLKEALALVDIRVLDHIIVGDGETLSFAERGLL 230


>gi|37678469|ref|NP_933078.1| DNA repair protein RadC [Vibrio vulnificus YJ016]
 gi|320157667|ref|YP_004190046.1| DNA repair protein RadC [Vibrio vulnificus MO6-24/O]
 gi|326423775|ref|NP_759802.2| DNA repair protein RadC [Vibrio vulnificus CMCP6]
 gi|32129962|sp|Q8DDY0|Y825_VIBVU RecName: Full=UPF0758 protein VV1_0825
 gi|54036231|sp|Q7MPS7|Y285_VIBVY RecName: Full=UPF0758 protein VV0285
 gi|37197209|dbj|BAC93049.1| DNA repair protein [Vibrio vulnificus YJ016]
 gi|319932979|gb|ADV87843.1| DNA repair protein RadC [Vibrio vulnificus MO6-24/O]
 gi|319999137|gb|AAO09329.2| DNA repair protein RadC [Vibrio vulnificus CMCP6]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I DEV   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRALHYNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH ++G    VSF     I
Sbjct: 188 RITRRLSDALGLVDIRVLDHFVVGDGEVVSFAERGWI 224


>gi|77163771|ref|YP_342296.1| DNA repair protein RadC [Nitrosococcus oceani ATCC 19707]
 gi|123595151|sp|Q3JEI0|Y236_NITOC RecName: Full=UPF0758 protein Noc_0236
 gi|76882085|gb|ABA56766.1| DNA replication and repair protein RadC [Nitrosococcus oceani ATCC
           19707]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E   RGTID   V+ RE+++R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNRHRVLAFEELFRGTIDGASVHPREVLKRALAHNAAAVILAHNHPSGVAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DHII+G    +SF    ++
Sbjct: 188 CITQRLKEALALVDIRVLDHIIVGDGETLSFAERGLL 224


>gi|258620577|ref|ZP_05715614.1| DNA repair protein RadC [Vibrio mimicus VM573]
 gi|258625887|ref|ZP_05720762.1| DNA repair protein RadC [Vibrio mimicus VM603]
 gi|258581851|gb|EEW06725.1| DNA repair protein RadC [Vibrio mimicus VM603]
 gi|258587092|gb|EEW11804.1| DNA repair protein RadC [Vibrio mimicus VM573]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ + I V DH ++G    VSF     I
Sbjct: 188 RITDRLRDALSLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|262163757|ref|ZP_06031497.1| DNA repair protein RadC [Vibrio mimicus VM223]
 gi|262027737|gb|EEY46402.1| DNA repair protein RadC [Vibrio mimicus VM223]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ + I V DH ++G    VSF     I
Sbjct: 188 RITDRLRDALSLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|229524831|ref|ZP_04414236.1| DNA repair protein RadC [Vibrio cholerae bv. albensis VL426]
 gi|229338412|gb|EEO03429.1| DNA repair protein RadC [Vibrio cholerae bv. albensis VL426]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH ++G    VSF     I
Sbjct: 188 RITGRLRDALGLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|153800833|ref|ZP_01955419.1| DNA repair protein RadC [Vibrio cholerae MZO-3]
 gi|153825955|ref|ZP_01978622.1| DNA repair protein RadC [Vibrio cholerae MZO-2]
 gi|153831399|ref|ZP_01984066.1| DNA repair protein RadC [Vibrio cholerae 623-39]
 gi|229521064|ref|ZP_04410485.1| DNA repair protein RadC [Vibrio cholerae TM 11079-80]
 gi|229527280|ref|ZP_04416673.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|262404954|ref|ZP_06081506.1| DNA repair protein RadC [Vibrio sp. RC586]
 gi|297581670|ref|ZP_06943592.1| DNA repair protein RadC [Vibrio cholerae RC385]
 gi|124123664|gb|EAY42407.1| DNA repair protein RadC [Vibrio cholerae MZO-3]
 gi|148873120|gb|EDL71255.1| DNA repair protein RadC [Vibrio cholerae 623-39]
 gi|149740363|gb|EDM54499.1| DNA repair protein RadC [Vibrio cholerae MZO-2]
 gi|229335288|gb|EEO00772.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|229341949|gb|EEO06950.1| DNA repair protein RadC [Vibrio cholerae TM 11079-80]
 gi|262348793|gb|EEY97934.1| DNA repair protein RadC [Vibrio sp. RC586]
 gi|297534077|gb|EFH72916.1| DNA repair protein RadC [Vibrio cholerae RC385]
 gi|327483097|gb|AEA77504.1| DNA repair protein RadC [Vibrio cholerae LMA3894-4]
          Length = 224

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH ++G    VSF     I
Sbjct: 188 RITDRLRDALGLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|190572468|ref|YP_001970313.1| DNA repair protein RadC [Stenotrophomonas maltophilia K279a]
 gi|229485565|sp|B2FJW1|Y399_STRMK RecName: Full=UPF0758 protein Smlt0399
 gi|190010390|emb|CAQ43998.1| putative DNA repair protein RadC [Stenotrophomonas maltophilia
           K279a]
          Length = 234

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GTI+  PVY RE+V+R L  +A ++IL HNHPSG+P PS AD 
Sbjct: 129 LFLDNRHRLIACEELFHGTINAAPVYPREVVRRALLHNAAAVILSHNHPSGDPEPSSADT 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ + DH ++G+   VSF    ++
Sbjct: 189 RITDELQQALAMVDVRLLDHFVVGEGRPVSFAERGLL 225


>gi|194364059|ref|YP_002026669.1| DNA repair protein RadC [Stenotrophomonas maltophilia R551-3]
 gi|238693502|sp|B4STE3|Y281_STRM5 RecName: Full=UPF0758 protein Smal_0281
 gi|194346863|gb|ACF49986.1| DNA repair protein RadC [Stenotrophomonas maltophilia R551-3]
          Length = 234

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GTI+  PVY RE+V+R L  +A ++IL HNHPSG+P PS AD 
Sbjct: 129 LFLDNRHRLIACEELFHGTINAAPVYPREVVRRALLHNAAAVILSHNHPSGDPEPSSADT 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ + DH ++G+   VSF    ++
Sbjct: 189 RITDELQQALAMVDVRLLDHFVVGEGRPVSFAERGLL 225


>gi|260770727|ref|ZP_05879657.1| DNA repair protein RadC [Vibrio furnissii CIP 102972]
 gi|260614308|gb|EEX39497.1| DNA repair protein RadC [Vibrio furnissii CIP 102972]
 gi|315178477|gb|ADT85391.1| DNA repair protein RadC [Vibrio furnissii NCTC 11218]
          Length = 224

 Score =  144 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DEV   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS +D 
Sbjct: 128 LFLDNQHRVIRDEVLFEGTIDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSTSDR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH ++G    VSF     I
Sbjct: 188 RITRRLTDALALVDIRVLDHFVVGDGEVVSFAERGWI 224


>gi|261210491|ref|ZP_05924785.1| DNA repair protein RadC [Vibrio sp. RC341]
 gi|260840549|gb|EEX67115.1| DNA repair protein RadC [Vibrio sp. RC341]
          Length = 224

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH +IG    VSF     I
Sbjct: 188 RITDRLRDALGLVEIRVLDHFVIGDGEVVSFAERGWI 224


>gi|254522249|ref|ZP_05134304.1| DNA repair protein [Stenotrophomonas sp. SKA14]
 gi|219719840|gb|EED38365.1| DNA repair protein [Stenotrophomonas sp. SKA14]
          Length = 246

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GTI+  PVY RE+V+R L  +A ++IL HNHPSG+P PS AD 
Sbjct: 141 LFLDNRHRLIACEELFHGTINAAPVYPREVVRRALLHNAAAVILSHNHPSGDPEPSGADT 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ + DH ++G+   VSF    ++
Sbjct: 201 RITDELQQALALVDVRLLDHFVVGEGRPVSFAERGLL 237


>gi|262172690|ref|ZP_06040368.1| DNA repair protein RadC [Vibrio mimicus MB-451]
 gi|261893766|gb|EEY39752.1| DNA repair protein RadC [Vibrio mimicus MB-451]
          Length = 224

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHNNAAAVILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ + I V DH ++G    VSF     I
Sbjct: 188 RITDRLRDALSLVEIRVLDHFVVGDGEVVSFAERGWI 224


>gi|260774468|ref|ZP_05883382.1| DNA repair protein RadC [Vibrio metschnikovii CIP 69.14]
 gi|260610595|gb|EEX35800.1| DNA repair protein RadC [Vibrio metschnikovii CIP 69.14]
          Length = 224

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  EV   GTID   VY RE+V+R L+L+A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIQGEVLFEGTIDAASVYPREVVKRALQLNAAALILAHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH +IG    VSF     I
Sbjct: 188 RITQRLVDALQLVDIRVLDHFVIGDGEVVSFAERGWI 224


>gi|163803269|ref|ZP_02197148.1| DNA repair protein RadC [Vibrio sp. AND4]
 gi|159172906|gb|EDP57744.1| DNA repair protein RadC [Vibrio sp. AND4]
          Length = 224

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLIDALALVDIRILDHFVIGDGESVSFAERGWI 224


>gi|269959366|ref|ZP_06173749.1| DNA repair protein RadC [Vibrio harveyi 1DA3]
 gi|269835803|gb|EEZ89879.1| DNA repair protein RadC [Vibrio harveyi 1DA3]
          Length = 224

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLIDALALVDIRILDHFVIGDGESVSFAERGWI 224


>gi|260902399|ref|ZP_05910794.1| DNA repair protein RadC [Vibrio parahaemolyticus AQ4037]
 gi|308110861|gb|EFO48401.1| DNA repair protein RadC [Vibrio parahaemolyticus AQ4037]
          Length = 224

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLIDALALVDIRILDHFVIGDGESVSFAERGWI 224


>gi|156972975|ref|YP_001443882.1| DNA repair protein RadC [Vibrio harveyi ATCC BAA-1116]
 gi|166218799|sp|A7MSP7|Y653_VIBHB RecName: Full=UPF0758 protein VIBHAR_00653
 gi|156524569|gb|ABU69655.1| hypothetical protein VIBHAR_00653 [Vibrio harveyi ATCC BAA-1116]
          Length = 224

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLIDALGLVDIRILDHFVIGDGESVSFAERGWI 224


>gi|218708245|ref|YP_002415866.1| DNA repair protein RadC [Vibrio splendidus LGP32]
 gi|254789669|sp|B7VHK2|Y182_VIBSL RecName: Full=UPF0758 protein VS_0182
 gi|218321264|emb|CAV17214.1| DNA repair protein radC homolog [Vibrio splendidus LGP32]
          Length = 224

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I DEV   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQNRVIKDEVMFEGTIDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I + DH ++G    +SF     I
Sbjct: 188 RITRRLTDALALVDIRILDHFVVGDGEVISFAERGWI 224


>gi|28896958|ref|NP_796563.1| DNA repair protein RadC [Vibrio parahaemolyticus RIMD 2210633]
 gi|260877858|ref|ZP_05890213.1| DNA repair protein RadC [Vibrio parahaemolyticus AN-5034]
 gi|260898016|ref|ZP_05906512.1| DNA repair protein RadC [Vibrio parahaemolyticus Peru-466]
 gi|31076907|sp|Q87T86|Y184_VIBPA RecName: Full=UPF0758 protein VP0184
 gi|28805166|dbj|BAC58447.1| DNA repair protein RadC [Vibrio parahaemolyticus RIMD 2210633]
 gi|308089340|gb|EFO39035.1| DNA repair protein RadC [Vibrio parahaemolyticus Peru-466]
 gi|308089972|gb|EFO39667.1| DNA repair protein RadC [Vibrio parahaemolyticus AN-5034]
 gi|328471754|gb|EGF42631.1| hypothetical protein VP10329_01325 [Vibrio parahaemolyticus 10329]
          Length = 224

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLIDALALVDIRILDHFVIGDGESVSFAERGWI 224


>gi|262168070|ref|ZP_06035769.1| DNA repair protein RadC [Vibrio cholerae RC27]
 gi|262023603|gb|EEY42305.1| DNA repair protein RadC [Vibrio cholerae RC27]
          Length = 151

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 55  LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 114

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH ++G    VSF     I
Sbjct: 115 RITDRLRDALGLVEIRVLDHFVVGDGEVVSFAERGWI 151


>gi|260779661|ref|ZP_05888551.1| DNA repair protein RadC [Vibrio coralliilyticus ATCC BAA-450]
 gi|260604470|gb|EEX30774.1| DNA repair protein RadC [Vibrio coralliilyticus ATCC BAA-450]
          Length = 220

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DEV   GTID   +Y RE+V+R LE +A ++IL HNHPSG   PS AD 
Sbjct: 124 LFLDNQHRVIKDEVMFEGTIDAASIYPREVVKRALEHNAAALILAHNHPSGVAEPSQADR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I   L  ++I + DH ++G    +SF     I
Sbjct: 184 RITQRISDALALVDIRILDHFVVGDGDVISFAERGWI 220


>gi|262392595|ref|YP_003284449.1| DNA repair protein RadC [Vibrio sp. Ex25]
 gi|262336189|gb|ACY49984.1| DNA repair protein RadC [Vibrio sp. Ex25]
          Length = 224

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I + DH +IG    VSF     I
Sbjct: 188 RITRRLTDALALVDIRILDHFVIGDGESVSFAERGWI 224


>gi|88813088|ref|ZP_01128330.1| DNA repair protein RadC [Nitrococcus mobilis Nb-231]
 gi|88789721|gb|EAR20846.1| DNA repair protein RadC [Nitrococcus mobilis Nb-231]
          Length = 224

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGTID   VY RE+V+R LE +A ++I+ HNHPSG   PS AD 
Sbjct: 128 LFLDNRNRLIAFEELFRGTIDAASVYPREVVRRALERNAAALIVAHNHPSGVSEPSRADA 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I + DH ++G    VS     ++
Sbjct: 188 MLTQRLREALALVDIRLLDHFVVGDSEVVSLAERGLM 224


>gi|269965912|ref|ZP_06180005.1| DNA repair protein RadC [Vibrio alginolyticus 40B]
 gi|269829465|gb|EEZ83706.1| DNA repair protein RadC [Vibrio alginolyticus 40B]
          Length = 214

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GT+D   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 118 LFLDNQHRVIKDEILFEGTLDAASVYPREVVKRALHHNAAALILAHNHPSGVAEPSQADR 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I + DH +IG    VSF     +
Sbjct: 178 RITRRLTDALALVDIRILDHFVIGDGESVSFAERGWM 214


>gi|153009239|ref|YP_001370454.1| DNA repair protein RadC [Ochrobactrum anthropi ATCC 49188]
 gi|229470322|sp|A6X071|Y1909_OCHA4 RecName: Full=UPF0758 protein Oant_1909
 gi|151561127|gb|ABS14625.1| DNA repair protein RadC [Ochrobactrum anthropi ATCC 49188]
          Length = 249

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+I+GK    SF+GL +I
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIVGKHGHASFRGLGLI 249


>gi|292493862|ref|YP_003529301.1| DNA repair protein RadC [Nitrosococcus halophilus Nc4]
 gi|291582457|gb|ADE16914.1| DNA repair protein RadC [Nitrosococcus halophilus Nc4]
          Length = 224

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E   RGTID   V+ RE+++R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNRHRVLAFEELFRGTIDGASVHPREVIKRALAHNAAAVILAHNHPSGVAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +  TL  ++I V DHII+G    +SF    ++
Sbjct: 188 LITQRLKETLALVDIRVLDHIIVGDGETLSFAERGLL 224


>gi|152977701|ref|YP_001343330.1| DNA repair protein RadC [Actinobacillus succinogenes 130Z]
 gi|171472902|sp|A6VK98|Y013_ACTSZ RecName: Full=UPF0758 protein Asuc_0013
 gi|150839424|gb|ABR73395.1| DNA repair protein RadC [Actinobacillus succinogenes 130Z]
          Length = 220

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E   RGTI+   VY REI++  L  +A ++IL HNHPSG+  PS +D 
Sbjct: 124 LFLDNQHRLIKKEDMFRGTINAASVYPREIIKTALYCNAAALILAHNHPSGSAEPSASDK 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I      + I V DH +IGK  + SF     +
Sbjct: 184 QMTKRIQAAAELMEIRVLDHFVIGKGCYFSFAEQDWL 220


>gi|119385035|ref|YP_916091.1| DNA repair protein RadC [Paracoccus denitrificans PD1222]
 gi|171704472|sp|A1B4F1|Y2304_PARDP RecName: Full=UPF0758 protein Pden_2304
 gi|119374802|gb|ABL70395.1| DNA repair protein RadC [Paracoccus denitrificans PD1222]
          Length = 263

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LIADE Q+RGT+DHVPVY REI++R LELSA+++ILVHNHPSG+P PS ADI
Sbjct: 167 LYLDRKNVLIADEEQARGTVDHVPVYPREIMRRALELSASALILVHNHPSGDPTPSQADI 226

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I+     + I VHDH+IIG+   +SF+   ++
Sbjct: 227 GMTNRIVAAAEVMGIAVHDHLIIGRSRELSFRSEGLL 263


>gi|307825840|ref|ZP_07656056.1| DNA repair protein RadC [Methylobacter tundripaludum SV96]
 gi|307733148|gb|EFO04009.1| DNA repair protein RadC [Methylobacter tundripaludum SV96]
          Length = 224

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +   RGTID   VY RE+ ++ L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVIQLDELFRGTIDGASVYPREVAKQALRHNAAAVIFAHNHPSGISEPSQADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L   +I V DH IIG     SF    ++
Sbjct: 188 HITEKLKQALALFDIRVLDHFIIGDGQPYSFAEHGLL 224


>gi|311696212|gb|ADP99085.1| DNA repair protein RadC-like protein [marine bacterium HP15]
          Length = 224

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I      RGTID   VY RE+V++ LE +A ++I  HNHPSG   PS ADI
Sbjct: 128 LFLDNRHRVIQYRELFRGTIDGAAVYPREVVRQALEDNAAAVIFAHNHPSGVAEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DH+++G    VS     ++
Sbjct: 188 SLTRRLKEALGLVDIRVLDHMVVGHGEVVSLAERGLL 224


>gi|209966646|ref|YP_002299561.1| DNA repair protein RadC, putative [Rhodospirillum centenum SW]
 gi|209960112|gb|ACJ00749.1| DNA repair protein RadC, putative [Rhodospirillum centenum SW]
          Length = 259

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGT+DH PVY RE+V+R LEL+AT++ILVHNHPSG+P PS ADI
Sbjct: 163 LFLDRKNTLIADEVQQRGTVDHTPVYPREVVKRALELNATALILVHNHPSGDPTPSRADI 222

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II     L ++VHDH+IIGK   VSFK + ++
Sbjct: 223 EMTKQIIQAATALGVVVHDHVIIGKGRHVSFKSIGLM 259


>gi|296535628|ref|ZP_06897807.1| DNA repair protein RadC [Roseomonas cervicalis ATCC 49957]
 gi|296264052|gb|EFH10498.1| DNA repair protein RadC [Roseomonas cervicalis ATCC 49957]
          Length = 297

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 69/97 (71%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIADE Q+RGT++H PVY RE+++R LEL AT++ILVHNHPSG+P PS ADI
Sbjct: 201 LFLDSKNRLIADEAQARGTVNHTPVYPREVLRRALELHATALILVHNHPSGDPTPSSADI 260

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I       ++++HDH+IIG     SF+   ++
Sbjct: 261 EMTGEIRRAAQVFSVVLHDHLIIGNGRHFSFRREHLL 297


>gi|239832168|ref|ZP_04680497.1| DNA repair protein RadC [Ochrobactrum intermedium LMG 3301]
 gi|239824435|gb|EEQ96003.1| DNA repair protein RadC [Ochrobactrum intermedium LMG 3301]
          Length = 249

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N +IADEVQ  GT+D+ PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKMIADEVQQTGTVDYTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+I+GK    SF+GL +I
Sbjct: 213 DMTRQLVNAAKALNITVHDHVIVGKHGHASFRGLGLI 249


>gi|113460290|ref|YP_718349.1| DNA repair protein RadC [Haemophilus somnus 129PT]
 gi|170719078|ref|YP_001783364.1| DNA repair protein RadC [Haemophilus somnus 2336]
 gi|123031084|sp|Q0I0X9|Y144_HAES1 RecName: Full=UPF0758 protein HS_0144
 gi|189029396|sp|B0UUW7|Y009_HAES2 RecName: Full=UPF0758 protein HSM_0009
 gi|112822333|gb|ABI24422.1| DNA repair protein [Haemophilus somnus 129PT]
 gi|168827207|gb|ACA32578.1| DNA repair protein RadC [Haemophilus somnus 2336]
          Length = 222

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS AD 
Sbjct: 126 LFLDNQHRLIKKEEMFLGTINQANVYPREIIKTALFCNAAALILAHNHPSGVSTPSMADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+NI      + I V DH IIGK  + SF     I
Sbjct: 186 KMTENIKQLSELMEIRVLDHFIIGKGNYFSFAEQGWI 222


>gi|192360376|ref|YP_001983975.1| DNA repair protein RadC [Cellvibrio japonicus Ueda107]
 gi|238692434|sp|B3PG68|Y3522_CELJU RecName: Full=UPF0758 protein CJA_3522
 gi|190686541|gb|ACE84219.1| DNA repair protein RadC [Cellvibrio japonicus Ueda107]
          Length = 224

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   +GTID   VY RE+V++ L  +A ++I  HNHPSG   PS ADI
Sbjct: 128 LFLDNQNRLIAYEELFQGTIDGANVYPREVVKQALAHNAAAVIFAHNHPSGLAEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH+++G    VS      +
Sbjct: 188 RITRRLQEALGLVDIRVLDHLVVGDGELVSLAERGWL 224


>gi|260599935|ref|YP_003212506.1| DNA repair protein radC [Cronobacter turicensis z3032]
 gi|260219112|emb|CBA34467.1| DNA repair protein radC homolog [Cronobacter turicensis z3032]
          Length = 220

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I       GT+ HV V+ REIV+  + L+A +IIL HNHPSG+  PS AD 
Sbjct: 124 IFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAVRLNAAAIILAHNHPSGHAEPSRADK 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+     ++I V DH++IG+  +VSF     I
Sbjct: 184 MVTERIVKCCQLVDIRVLDHLVIGRGEYVSFAERGWI 220


>gi|85710819|ref|ZP_01041880.1| RadC [Idiomarina baltica OS145]
 gi|85695223|gb|EAQ33160.1| RadC [Idiomarina baltica OS145]
          Length = 260

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + L+  E    GTI+  PVY RE+++  ++ +A ++IL HNHPSG   PS AD 
Sbjct: 164 LLLDSQHRLLRYEELFYGTINAAPVYPREVLKLVMQHNAAAVILAHNHPSGVAEPSQADK 223

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH +IG    VSF    +I
Sbjct: 224 RVTERLQKALALVDVALLDHFVIGSGDPVSFAERGLI 260


>gi|253575692|ref|ZP_04853028.1| DNA repair protein RadC [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251845030|gb|EES73042.1| DNA repair protein RadC [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 231

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +IA E  S G+++   V+ RE+ +  ++ S+ S++  HNHPSG+P PS  DI
Sbjct: 135 LFLNTKNHIIAQETLSIGSLNASIVHPREVFRAAIKCSSASVVCAHNHPSGDPTPSPEDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +      + I V DHI+IG   FVS K   ++
Sbjct: 195 RMTRRLCEAGEIIGIDVLDHIVIGDGKFVSLKERGLM 231


>gi|121999079|ref|YP_001003866.1| DNA repair protein RadC [Halorhodospira halophila SL1]
 gi|166218781|sp|A1WZF2|Y2301_HALHL RecName: Full=UPF0758 protein Hhal_2301
 gi|121590484|gb|ABM63064.1| DNA replication and repair protein RadC [Halorhodospira halophila
           SL1]
          Length = 224

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   RGTI+   VY RE+V+R L  +A ++I+ HNHPSG   PS AD 
Sbjct: 128 LFLDNRHRVIGFEELFRGTINGASVYPRELVRRALAHNAAAVIVAHNHPSGITEPSAADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ + DH ++G    VS     ++
Sbjct: 188 ALTHRLREALGLVDVRLLDHFVVGDGEPVSLAERGVL 224


>gi|323495229|ref|ZP_08100311.1| hypothetical protein VIBR0546_16286 [Vibrio brasiliensis LMG 20546]
 gi|323310489|gb|EGA63671.1| hypothetical protein VIBR0546_16286 [Vibrio brasiliensis LMG 20546]
          Length = 222

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GTID   VY RE+V+R LE +A ++IL HNHPSG   PS +D 
Sbjct: 126 LFLDNQHRVICGEPLFQGTIDAASVYPREVVKRALEHNAAALILAHNHPSGIAEPSQSDR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II  L+ ++I V DH ++G    VSF     I
Sbjct: 186 RITRRIIDALDLVDIRVLDHFVVGDGEIVSFAERGWI 222


>gi|297581219|ref|ZP_06943143.1| DNA repair protein [Vibrio cholerae RC385]
 gi|297534535|gb|EFH73372.1| DNA repair protein [Vibrio cholerae RC385]
          Length = 169

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 74  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 133

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 134 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 169


>gi|300815950|ref|ZP_07096174.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
 gi|300531879|gb|EFK52941.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
          Length = 163

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIADE    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIADETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|288942684|ref|YP_003444924.1| DNA repair protein RadC [Allochromatium vinosum DSM 180]
 gi|288898056|gb|ADC63892.1| DNA repair protein RadC [Allochromatium vinosum DSM 180]
          Length = 224

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   RGTID   V+ RE+V+R ++ +A ++I  HNHPSG   PS AD+
Sbjct: 128 LFLDNRHRVIVYEELFRGTIDGASVHPREVVRRVIQTNAAAVIFAHNHPSGVAEPSQADL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G     SF    ++
Sbjct: 188 RITQRLKEALALIDVRVLDHIIVGDGDGTSFAERGLL 224


>gi|82703257|ref|YP_412823.1| DNA repair protein RadC [Nitrosospira multiformis ATCC 25196]
 gi|123544109|sp|Q2Y740|Y2138_NITMU RecName: Full=UPF0758 protein Nmul_A2138
 gi|82411322|gb|ABB75431.1| DNA replication and repair protein RadC [Nitrosospira multiformis
           ATCC 25196]
          Length = 224

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +IA E   +GT+    VY RE+V+R L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 IFLDARNRVIATEELFQGTLTQTSVYPREVVKRALHHNAAAVIFAHNHPSGAAEPSHADA 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++   L  +++ V DH I+G+ A +SF    +I
Sbjct: 188 VLTQSLKQALLLVDVRVLDHFIVGRGATLSFAEQGLI 224


>gi|16130559|ref|NP_417131.1| CP4-57 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|89109442|ref|AP_003222.1| predicted DNA repair protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|170082243|ref|YP_001731563.1| CP4-57 prophage; DNA repair protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901798|ref|YP_002927594.1| CP4-57 prophage; putative DNA repair protein [Escherichia coli
           BW2952]
 gi|1723637|sp|P52140|YFJY_ECOLI RecName: Full=UPF0758 protein yfjY
 gi|1033138|gb|AAA79812.1| ORF_o160 [Escherichia coli str. K-12 substr. MG1655]
 gi|1788997|gb|AAC75692.1| CP4-57 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|1800034|dbj|BAA16512.1| predicted DNA repair protein [Escherichia coli str. K12 substr.
           W3110]
 gi|169890078|gb|ACB03785.1| CP4-57 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|238860625|gb|ACR62623.1| CP4-57 prophage; predicted DNA repair protein [Escherichia coli
           BW2952]
 gi|260448288|gb|ACX38710.1| DNA repair protein RadC [Escherichia coli DH1]
 gi|315137260|dbj|BAJ44419.1| CP4-57 prophage; putative DNA repair protein [Escherichia coli DH1]
          Length = 160

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 64  LYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 124 TITQRLVQALQLVDIRVPDHLIVGGRQIYSFAEHGLL 160


>gi|238750801|ref|ZP_04612299.1| DNA repair protein radC [Yersinia rohdei ATCC 43380]
 gi|238710945|gb|EEQ03165.1| DNA repair protein radC [Yersinia rohdei ATCC 43380]
          Length = 235

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 139 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 198

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  ++   + L+I V DH+++G+   VSF     +
Sbjct: 199 LMTTQVVKACSLLDIRVLDHLVVGRGECVSFAERGWL 235


>gi|83643895|ref|YP_432330.1| DNA repair protein [Hahella chejuensis KCTC 2396]
 gi|123534642|sp|Q2SN69|Y1020_HAHCH RecName: Full=UPF0758 protein HCH_01020
 gi|83631938|gb|ABC27905.1| DNA repair protein [Hahella chejuensis KCTC 2396]
          Length = 224

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA E   RGTID   V+ RE+V+R L+ +A +II  HNHPSG   PS +D 
Sbjct: 128 LFLDNQHRVIAYEELFRGTIDSASVHPREVVRRVLKHNAAAIIFAHNHPSGVAEPSLSDK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH+I+G    VS      I
Sbjct: 188 EITETLRKALRLVDVRVLDHMIVGDGEVVSLAERGWI 224


>gi|238785016|ref|ZP_04629013.1| DNA repair protein RadC [Yersinia bercovieri ATCC 43970]
 gi|238714057|gb|EEQ06072.1| DNA repair protein RadC [Yersinia bercovieri ATCC 43970]
          Length = 162

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   +GT++   V+ RE+V+  L  ++ +++L HNHPSG+  PS AD 
Sbjct: 64  LFLDNQNRLIAYETLFKGTVNSTEVHPREVVKAALRHNSAAVLLAHNHPSGHAEPSQADR 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  L+ +++ V DH+++G    VSF     +
Sbjct: 124 QITDRLVNVLDLVDVRVLDHLVVGGLDIVSFAERGWL 160


>gi|219872082|ref|YP_002476457.1| DNA repair protein RadC [Haemophilus parasuis SH0165]
 gi|219692286|gb|ACL33509.1| DNA repair protein RadC [Haemophilus parasuis SH0165]
          Length = 197

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 59/94 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI  E    GTI+   V+ REI++  L+ +A +I++ HNHPSGN NPS+AD 
Sbjct: 85  IFLDNQNRLIKTEKMFYGTINQASVHPREIIKEALKCNAAAILVAHNHPSGNCNPSEADR 144

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I    + ++I   DHII+GK  + SF+  
Sbjct: 145 FLTRKIEMACDLVDIRFVDHIIVGKGDYFSFEEE 178


>gi|88705880|ref|ZP_01103589.1| radC-like protein yeeS [Congregibacter litoralis KT71]
 gi|88699951|gb|EAQ97061.1| radC-like protein yeeS [Congregibacter litoralis KT71]
          Length = 169

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++I  HNHPSGNP PS AD 
Sbjct: 73  LFLDSQHRLIEYTEMFRGTIDSASVYPREVVKEALRLNAAAVIFSHNHPSGNPEPSRADE 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++   DH+I+      SF    +I
Sbjct: 133 AITKRLKEALALVDVRTLDHVIVAGSDTTSFAERGLI 169


>gi|126664654|ref|ZP_01735638.1| DNA repair protein RadC [Marinobacter sp. ELB17]
 gi|126630980|gb|EBA01594.1| DNA repair protein RadC [Marinobacter sp. ELB17]
          Length = 184

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I      RGTID   VY RE+V++ LE +A ++I  HNHPSG   PS ADI
Sbjct: 88  LFLDNRHRIIHYRELFRGTIDGAAVYPREVVRQALEDNAAAVIFAHNHPSGVAEPSQADI 147

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH+++G    +S     ++
Sbjct: 148 ALTKRLKDALALVDIRVLDHMVVGHGEVISLAERGLM 184


>gi|194335153|ref|YP_002019719.1| DNA repair protein RadC [Prosthecochloris aestuarii DSM 271]
 gi|194312971|gb|ACF47365.1| DNA repair protein RadC [Prosthecochloris aestuarii DSM 271]
          Length = 165

 Score =  137 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N +I  E+ SRGT++   V+ RE+ +     +A SI+L HNHPSGN  PS AD 
Sbjct: 69  LYLDTKNKIIGLEMISRGTLNASLVHPREVFKGAFLANANSIMLAHNHPSGNTEPSSADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L++ V DHII+G   + SF+   +I
Sbjct: 129 LVTSRLVKAGKLLDLQVLDHIIVGDKGYYSFRESGLI 165


>gi|114328318|ref|YP_745475.1| DNA repair protein radC [Granulibacter bethesdensis CGDNIH1]
 gi|114316492|gb|ABI62552.1| DNA repair protein radC [Granulibacter bethesdensis CGDNIH1]
          Length = 271

 Score =  137 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIADE+ + GT++H PVY RE+V+R LEL AT++I+VHNHPSG+P PS  DI
Sbjct: 175 LFLDNRNQLIADEILAHGTVNHAPVYPREVVKRALELHATALIVVHNHPSGDPTPSAEDI 234

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +      L++ +HDH+IIG+  + SF+   ++
Sbjct: 235 RMTRELREAGRLLSLDLHDHVIIGRHGWSSFRKQGLL 271


>gi|121727688|ref|ZP_01680783.1| DNA repair protein RadC, putative [Vibrio cholerae V52]
 gi|298498145|ref|ZP_07007952.1| DNA repair protein [Vibrio cholerae MAK 757]
 gi|121629985|gb|EAX62393.1| DNA repair protein RadC, putative [Vibrio cholerae V52]
 gi|297542478|gb|EFH78528.1| DNA repair protein [Vibrio cholerae MAK 757]
          Length = 169

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 74  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 133

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 134 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 169


>gi|114321811|ref|YP_743494.1| DNA repair protein RadC [Alkalilimnicola ehrlichii MLHE-1]
 gi|122310756|sp|Q0A583|Y2664_ALHEH RecName: Full=UPF0758 protein Mlg_2664
 gi|114228205|gb|ABI58004.1| DNA replication and repair protein RadC [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 224

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E   +GTID   VY RE+VQR L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNRHRVVRYEELFQGTIDAASVYPREVVQRALAHNAAAVILAHNHPSGVAEPSVADQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH ++G    VSF    ++
Sbjct: 188 ALTRRLQEALGLVDIRVLDHFVVGDGRPVSFAERGLM 224


>gi|262402819|ref|ZP_06079380.1| DNA repair protein RadC [Vibrio sp. RC586]
 gi|262351601|gb|EEZ00734.1| DNA repair protein RadC [Vibrio sp. RC586]
          Length = 158

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|242237618|ref|YP_002985799.1| DNA repair protein RadC [Dickeya dadantii Ech703]
 gi|242129675|gb|ACS83977.1| DNA repair protein RadC [Dickeya dadantii Ech703]
          Length = 221

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  +    GTI+ V V+ RE+V+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 125 MFLDNQHHVIRYQEMFAGTINSVEVHPREVVREALKSNAAALILAHNHPSGRAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++I+     L I V DH++IG+  +VSF     I
Sbjct: 185 RITEHIVNACRLLEIRVLDHLVIGRGEYVSFAERGWI 221


>gi|229529171|ref|ZP_04418561.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|229530051|ref|ZP_04419441.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|254285246|ref|ZP_04960211.1| DNA repair protein RadC, putative [Vibrio cholerae AM-19226]
 gi|258620000|ref|ZP_05715040.1| RadC-like protein [Vibrio mimicus VM573]
 gi|150424518|gb|EDN16454.1| DNA repair protein RadC, putative [Vibrio cholerae AM-19226]
 gi|229332945|gb|EEN98431.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|229333825|gb|EEN99311.1| DNA repair protein RadC [Vibrio cholerae 12129(1)]
 gi|258587733|gb|EEW12442.1| RadC-like protein [Vibrio mimicus VM573]
          Length = 158

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|295695338|ref|YP_003588576.1| DNA repair protein RadC [Bacillus tusciae DSM 2912]
 gi|295410940|gb|ADG05432.1| DNA repair protein RadC [Bacillus tusciae DSM 2912]
          Length = 228

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++ +EV S GT++   V+ RE+ +  ++ +A +++ VHNHPSG+P PS  DI
Sbjct: 132 LHLDTKHRVLGEEVVSVGTLNASLVHPREVFRTAIKRNAAAVVCVHNHPSGDPTPSPEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I+ +   L I + DH++IG+  +VS +   +I
Sbjct: 192 DVTKRIVESGRILGIDLVDHVVIGRGTYVSMRERGLI 228


>gi|146337832|ref|YP_001202880.1| DNA repair protein RadC [Bradyrhizobium sp. ORS278]
 gi|146190638|emb|CAL74640.1| DNA repair protein RadC homolog [Bradyrhizobium sp. ORS278]
          Length = 237

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+++R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 141 LFLDKRNQLIADEVQQTGTVDHTPVYPREVIKRALELSATAIILVHNHPSGDPTPSQADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+    PL I VHDHII+G++   S K   ++
Sbjct: 201 RMTKTIVEIAKPLGITVHDHIIVGRNGHTSLKSNGLM 237


>gi|167855900|ref|ZP_02478650.1| DNA repair protein RadC [Haemophilus parasuis 29755]
 gi|167852988|gb|EDS24252.1| DNA repair protein RadC [Haemophilus parasuis 29755]
          Length = 238

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 59/94 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI  E    GTI+   V+ REI++  L+ +A +I++ HNHPSGN NPS+AD 
Sbjct: 126 IFLDNQNRLIKTEKMFYGTINQASVHPREIIKEALKCNAAAILVAHNHPSGNCNPSEADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I    + ++I   DHII+GK  + SF+  
Sbjct: 186 FLTRKIEMACDLVDIRFVDHIIVGKGDYFSFEEE 219


>gi|251798399|ref|YP_003013130.1| DNA repair protein RadC [Paenibacillus sp. JDR-2]
 gi|247546025|gb|ACT03044.1| DNA repair protein RadC [Paenibacillus sp. JDR-2]
          Length = 228

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +IA E  S GT++   V+ RE+ +  ++  + SII VHNHPSG+P PS  DI
Sbjct: 132 LFLNTKNHIIARETLSVGTLNASLVHPREVFRAAVKAGSASIICVHNHPSGDPMPSPEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH++IG   F+S K    +
Sbjct: 192 TLTKRLVEAGELMGIEVLDHLVIGDGRFISLKEHGYM 228


>gi|223041556|ref|ZP_03611757.1| DNA repair protein RadC-like protein [Actinobacillus minor 202]
 gi|223017651|gb|EEF16061.1| DNA repair protein RadC-like protein [Actinobacillus minor 202]
          Length = 221

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 60/96 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E    GTI+   V+ RE+++  L+ +A +II+ HNHPSG   PS+AD 
Sbjct: 123 LFLDNQNRLIRTEKMFFGTINQASVHPREVIKAALKCNAAAIIIAHNHPSGECTPSEADR 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I    + ++I   DHII+GK  + SF+  ++
Sbjct: 183 HLTRRIEMACSLVDIRFVDHIIVGKGDYFSFEEEKL 218


>gi|254490370|ref|ZP_05103559.1| DNA repair protein RadC [Methylophaga thiooxidans DMS010]
 gi|224464503|gb|EEF80763.1| DNA repair protein RadC [Methylophaga thiooxydans DMS010]
          Length = 224

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA E   RGTID   VY RE+V++ L+ +A ++I  HNHPSG   PS ADI
Sbjct: 128 LFLDNQHRMIAFEELFRGTIDGASVYPREVVKQALQHNAAAVIFAHNHPSGVAEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ + + L  ++I V DHII+G D  +S   L  I
Sbjct: 188 HITRRLKSALELVDIRVLDHIIVGDDEPISMAQLGQI 224


>gi|156936195|ref|YP_001440111.1| hypothetical protein ESA_04094 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534449|gb|ABU79275.1| hypothetical protein ESA_04094 [Cronobacter sakazakii ATCC BAA-894]
          Length = 255

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I       GT+ HV V+ REIV+  + L+A  IIL HNHPSG   PS AD 
Sbjct: 159 IFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAVRLNAAGIILAHNHPSGRAEPSRADK 218

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+ +   ++I V DH++IG+  +VSF     I
Sbjct: 219 MVTERIVKSCQLVDIRVLDHLVIGRGEYVSFAERGWI 255


>gi|120556469|ref|YP_960820.1| DNA repair protein RadC [Marinobacter aquaeolei VT8]
 gi|166218785|sp|A1U6L4|Y3564_MARAV RecName: Full=UPF0758 protein Maqu_3564
 gi|120326318|gb|ABM20633.1| DNA replication and repair protein RadC [Marinobacter aquaeolei
           VT8]
          Length = 224

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I      RGTID   VY RE+V++ LE +A ++I  HNHPSG   PS ADI
Sbjct: 128 LFLDNRHRVIQYRELFRGTIDGAAVYPREVVRQALEDNAAAVIFAHNHPSGVAEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DH++IG    +S     ++
Sbjct: 188 SLTRRLKEALGLVDIRVLDHMVIGHGEVISLAERGLM 224


>gi|330431915|gb|AEC16974.1| DNA repair protein RadC [Gallibacterium anatis UMN179]
          Length = 221

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + LI  E   +GTI+   V+ REI++  L+ +A +IIL HNHPSG   PS  DI
Sbjct: 122 LFLNNQHYLIEKETLFQGTINSTQVHPREIIKSALKYNAAAIILAHNHPSGITTPSKEDI 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      +++ V DH+IIGK+   SF    +I
Sbjct: 182 AVTEQIQQACKLIDVRVLDHLIIGKNQVFSFCEKGLI 218


>gi|153214270|ref|ZP_01949287.1| DNA repair protein RadC, putative [Vibrio cholerae 1587]
 gi|124115418|gb|EAY34238.1| DNA repair protein RadC, putative [Vibrio cholerae 1587]
          Length = 158

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|240948237|ref|ZP_04752623.1| DNA repair protein RadC [Actinobacillus minor NM305]
 gi|240297276|gb|EER47817.1| DNA repair protein RadC [Actinobacillus minor NM305]
          Length = 221

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E    GTI+   V+ RE+++  L+ +A +II+ HNHPSG   PS+AD 
Sbjct: 123 LFLDNQNRLIRTEKMFFGTINQASVHPREVIKAALKCNAAAIIIAHNHPSGECTPSEADR 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I      ++I   DHII+GK  + SF+  ++
Sbjct: 183 HLTRRIEMACGLVDIRFVDHIIVGKGDYFSFEEEKL 218


>gi|307546416|ref|YP_003898895.1| DNA repair protein RadC [Halomonas elongata DSM 2581]
 gi|307218440|emb|CBV43710.1| DNA repair protein RadC [Halomonas elongata DSM 2581]
          Length = 224

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   RGT+D   VY RE+ +R LEL A ++I  HNHPSG   PSDAD 
Sbjct: 128 LFLDSQHRVIRYESLFRGTLDSASVYPREVARRALELGAGALIFAHNHPSGVAEPSDADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L    + V DH ++G    VSF    ++
Sbjct: 188 RITERLRQALELFEVRVLDHFVVGDGEVVSFAERGLL 224


>gi|327480970|gb|AEA84280.1| RadC family DNA repair protein [Pseudomonas stutzeri DSM 4166]
          Length = 168

 Score =  137 bits (346), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++I  HNHPSGNP PS AD 
Sbjct: 72  LFLDAKHRLIQYVEMFRGTIDSASVYPREVVKEALRLNAAAVIFAHNHPSGNPEPSQADK 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++   DH+I+     VSF    ++
Sbjct: 132 VLTQRLKEALALVDVRSLDHVIVAGQRTVSFAERGLL 168


>gi|167832541|gb|ACA01849.1| DNA repair protein RadC [Vibrio cholerae]
          Length = 169

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 74  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 133

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 134 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 169


>gi|261494189|ref|ZP_05990691.1| DNA repair protein RadC [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495585|ref|ZP_05992031.1| DNA repair protein RadC [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308692|gb|EEY09949.1| DNA repair protein RadC [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310170|gb|EEY11371.1| DNA repair protein RadC [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 245

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 61/96 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E    GTI+   V+ REI++R L+ +A +II+ HNHPSG+  PS++D 
Sbjct: 136 LFLDNQNRLIYKEKMFFGTINQTAVHPREIIKRALKYNAAAIIVAHNHPSGSCLPSESDR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I      ++I   DHII+GK  + SF+  ++
Sbjct: 196 SLTKKIEMACELVDIRFVDHIIVGKGDYFSFEEEKL 231


>gi|15641789|ref|NP_231421.1| DNA repair protein RadC, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121585864|ref|ZP_01675658.1| DNA repair protein RadC, putative [Vibrio cholerae 2740-80]
 gi|147674352|ref|YP_001217326.1| putative DNA repair protein RadC [Vibrio cholerae O395]
 gi|153817804|ref|ZP_01970471.1| DNA repair protein RadC, putative [Vibrio cholerae NCTC 8457]
 gi|153821150|ref|ZP_01973817.1| DNA repair protein RadC, putative [Vibrio cholerae B33]
 gi|153828539|ref|ZP_01981206.1| putative DNA repair protein RadC [Vibrio cholerae 623-39]
 gi|227081931|ref|YP_002810482.1| putative DNA repair protein RadC [Vibrio cholerae M66-2]
 gi|229508112|ref|ZP_04397617.1| DNA repair protein RadC [Vibrio cholerae BX 330286]
 gi|229511649|ref|ZP_04401128.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229518788|ref|ZP_04408231.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229607673|ref|YP_002878321.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|255744800|ref|ZP_05418750.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|262161917|ref|ZP_06030935.1| DNA repair protein RadC [Vibrio cholerae INDRE 91/1]
 gi|262169785|ref|ZP_06037476.1| DNA repair protein RadC [Vibrio cholerae RC27]
 gi|13432022|sp|Q9KR57|Y1786_VIBCH RecName: Full=UPF0758 protein VC_1786
 gi|9656311|gb|AAF94935.1| DNA repair protein RadC, putative [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121550002|gb|EAX60020.1| DNA repair protein RadC, putative [Vibrio cholerae 2740-80]
 gi|126511624|gb|EAZ74218.1| DNA repair protein RadC, putative [Vibrio cholerae NCTC 8457]
 gi|126521346|gb|EAZ78569.1| DNA repair protein RadC, putative [Vibrio cholerae B33]
 gi|146316235|gb|ABQ20774.1| putative DNA repair protein RadC [Vibrio cholerae O395]
 gi|148875934|gb|EDL74069.1| putative DNA repair protein RadC [Vibrio cholerae 623-39]
 gi|227009819|gb|ACP06031.1| putative DNA repair protein RadC [Vibrio cholerae M66-2]
 gi|227013686|gb|ACP09896.1| putative DNA repair protein RadC [Vibrio cholerae O395]
 gi|229343477|gb|EEO08452.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229351614|gb|EEO16555.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229355617|gb|EEO20538.1| DNA repair protein RadC [Vibrio cholerae BX 330286]
 gi|229370328|gb|ACQ60751.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|255737271|gb|EET92666.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|262022019|gb|EEY40729.1| DNA repair protein RadC [Vibrio cholerae RC27]
 gi|262028649|gb|EEY47304.1| DNA repair protein RadC [Vibrio cholerae INDRE 91/1]
          Length = 158

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|253690461|ref|YP_003019651.1| DNA repair protein RadC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259551881|sp|C6DIC1|Y4100_PECCP RecName: Full=UPF0758 protein PC1_4100
 gi|251757039|gb|ACT15115.1| DNA repair protein RadC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 221

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI+ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 125 LFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANAAALILAHNHPSGKAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+     + I V DH++IG   +VSF     I
Sbjct: 185 AITEQIVKACLLMEIRVLDHLVIGHGEYVSFAERGWI 221


>gi|267995990|gb|ACY90875.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
          Length = 279

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 183 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 242

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 243 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 279


>gi|193071485|ref|ZP_03052397.1| DNA repair protein, RadC family [Escherichia coli E110019]
 gi|331668227|ref|ZP_08369078.1| putative DNA repair protein [Escherichia coli TA271]
 gi|192955207|gb|EDV85698.1| DNA repair protein, RadC family [Escherichia coli E110019]
 gi|331064545|gb|EGI36453.1| putative DNA repair protein [Escherichia coli TA271]
          Length = 158

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|281179100|dbj|BAI55430.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 163

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|254427947|ref|ZP_05041654.1| DNA repair protein RadC [Alcanivorax sp. DG881]
 gi|196194116|gb|EDX89075.1| DNA repair protein RadC [Alcanivorax sp. DG881]
          Length = 224

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GTID   VY RE+V+R +E +A ++IL HNHPSG   PS +D 
Sbjct: 128 LFLDNKHRLIAFEKLFQGTIDAAAVYPREVVRRAMEHNAAAVILAHNHPSGVAEPSQSDH 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  + + V DH++IG   +VS      +
Sbjct: 188 AITRRLVEALGLVEVRVLDHLVIGDGGWVSLASRGAL 224


>gi|331677904|ref|ZP_08378579.1| putative DNA repair protein [Escherichia coli H591]
 gi|195183284|dbj|BAG66823.1| conserved predicted protein [Escherichia coli O111:H-]
 gi|323936899|gb|EGB33182.1| DNA repair protein RadC [Escherichia coli E1520]
 gi|323938740|gb|EGB34987.1| DNA repair protein RadC [Escherichia coli E1520]
 gi|331074364|gb|EGI45684.1| putative DNA repair protein [Escherichia coli H591]
          Length = 163

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|187939929|gb|ACD39066.1| RadC family DNA repair protein [Pseudomonas aeruginosa]
          Length = 169

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFLDTQHRLIEYSELFRGTIDSASVYPRELVKEALRLNAAAVIVSHNHPSGNPEPSGADK 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++   DHII+   + +SF    +I
Sbjct: 133 VLTQRLREALALVDVRTLDHIIVAGGSTISFAERGLI 169


>gi|157149255|ref|YP_001456574.1| DNA repair protein RadC [Citrobacter koseri ATCC BAA-895]
 gi|166218775|sp|A8ARM5|Y5095_CITK8 RecName: Full=UPF0758 protein CKO_05095
 gi|157086460|gb|ABV16138.1| hypothetical protein CKO_05095 [Citrobacter koseri ATCC BAA-895]
          Length = 220

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 124 IFLDARHRVIKHSRLFSGTLNHVEVHPREIIREAIKLNASAVILAHNHPSGCAEPSKADK 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     ++I V DH++IG+  +VSF     I
Sbjct: 184 LITERVVKCCQFMDIRVLDHLVIGRGEYVSFAERGWI 220


>gi|161616810|ref|YP_001590774.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161366174|gb|ABX69942.1| hypothetical protein SPAB_04629 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 279

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++ +A+++IL HNHPSG   PS AD 
Sbjct: 183 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKFNASAVILAHNHPSGCAEPSKADK 242

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 243 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 279


>gi|149376403|ref|ZP_01894165.1| DNA repair protein RadC [Marinobacter algicola DG893]
 gi|149359244|gb|EDM47706.1| DNA repair protein RadC [Marinobacter algicola DG893]
          Length = 224

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +   RGTID   VY RE+V++ LE +A ++I  HNHPSG   PS +DI
Sbjct: 128 LFLDNRHRVIRYQELFRGTIDGAAVYPREVVRQALEFNAAAVIFAHNHPSGVAEPSQSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DH+++G    +S     ++
Sbjct: 188 SLTRRLKEALGLVDIRVLDHMVVGHGEVISLAERGLM 224


>gi|188025457|ref|ZP_02958709.2| hypothetical protein PROSTU_00459 [Providencia stuartii ATCC 25827]
 gi|188023530|gb|EDU61570.1| hypothetical protein PROSTU_00459 [Providencia stuartii ATCC 25827]
          Length = 222

 Score =  137 bits (345), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + +I+ E   RGTI+ V V+ REI++  ++++A++IIL HNHPSGNP PSDAD 
Sbjct: 126 LFLNNQHQIISYEELFRGTINRVEVHPREIIRFAMKMNASAIILAHNHPSGNPEPSDADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      + I + DH ++G    VSF     +
Sbjct: 186 QVTFRIKEACTLMGIKLLDHFVVGHKNCVSFLERGWL 222


>gi|126732884|ref|ZP_01748675.1| DNA repair protein RadC [Sagittula stellata E-37]
 gi|126706660|gb|EBA05734.1| DNA repair protein RadC [Sagittula stellata E-37]
          Length = 252

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 156 LYLDRKNVLIADERQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSAADI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I      + I+VHDH++IGK   +SF+   ++
Sbjct: 216 DMTVQIQAAAEVMGIVVHDHLVIGKSRELSFRSEGLL 252


>gi|261823583|ref|YP_003261689.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
 gi|261607596|gb|ACX90082.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
          Length = 221

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI+ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 125 LFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANAAALILAHNHPSGKAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+     + I V DH++IG   +VSF     I
Sbjct: 185 AITEQIVKACLLMEIRVLDHLVIGHGEYVSFAERGWI 221


>gi|153214714|ref|ZP_01949559.1| DNA repair protein RadC [Vibrio cholerae 1587]
 gi|124115150|gb|EAY33970.1| DNA repair protein RadC [Vibrio cholerae 1587]
          Length = 109

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I DE+   GTID   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 13  LFLDNQHRVIRDEILFEGTIDAASVYPREVVKRALHHNAAAVILAHNHPSGVAEPSQADR 72

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + I V DH ++G    VSF     I
Sbjct: 73  RITDRLRDALGLVEIRVLDHFVVGDGEVVSFAERGWI 109


>gi|229515195|ref|ZP_04404655.1| DNA repair protein RadC [Vibrio cholerae TMA 21]
 gi|229347900|gb|EEO12859.1| DNA repair protein RadC [Vibrio cholerae TMA 21]
          Length = 158

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFTHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|225852775|ref|YP_002733008.1| DNA repair protein RadC [Brucella melitensis ATCC 23457]
 gi|256263739|ref|ZP_05466271.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|254764429|sp|C0RJP6|Y1330_BRUMB RecName: Full=UPF0758 protein BMEA_A1330
 gi|225641140|gb|ACO01054.1| DNA repair protein RadC [Brucella melitensis ATCC 23457]
 gi|263093798|gb|EEZ17803.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409305|gb|ADZ66370.1| DNA repair protein RadC [Brucella melitensis M28]
 gi|326539014|gb|ADZ87229.1| DNA repair protein RadC [Brucella melitensis M5-90]
          Length = 249

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+IIGK    S + LR+I
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIIGKHGHASLRSLRLI 249


>gi|187733812|ref|YP_001879774.1| DNA repair protein, RadC family [Shigella boydii CDC 3083-94]
 gi|187430804|gb|ACD10078.1| DNA repair protein, RadC family [Shigella boydii CDC 3083-94]
          Length = 158

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|126738441|ref|ZP_01754146.1| DNA repair protein RadC [Roseobacter sp. SK209-2-6]
 gi|126720240|gb|EBA16946.1| DNA repair protein RadC [Roseobacter sp. SK209-2-6]
          Length = 258

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADE Q+ GT+DHVPVY RE+V+R LE +A ++ILVHNHPSG+P+PS +DI
Sbjct: 162 LFLDRKNRLIADEEQAEGTVDHVPVYPREVVKRALEHNACALILVHNHPSGDPSPSQSDI 221

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I   L+PL I +HDH+IIG  A +SF+   ++
Sbjct: 222 EMTDRIHRALHPLGIALHDHLIIGSSAELSFRSEGLL 258


>gi|17987001|ref|NP_539635.1| DNA repair protein RadC [Brucella melitensis bv. 1 str. 16M]
 gi|23502159|ref|NP_698286.1| DNA repair protein RadC [Brucella suis 1330]
 gi|62290189|ref|YP_221982.1| DNA repair protein RadC [Brucella abortus bv. 1 str. 9-941]
 gi|82700110|ref|YP_414684.1| DNA repair protein RadC [Brucella melitensis biovar Abortus 2308]
 gi|161619234|ref|YP_001593121.1| DNA repair protein RadC [Brucella canis ATCC 23365]
 gi|189024423|ref|YP_001935191.1| DNA repair protein RadC [Brucella abortus S19]
 gi|225627749|ref|ZP_03785786.1| DNA repair protein RadC [Brucella ceti str. Cudo]
 gi|237815696|ref|ZP_04594693.1| DNA repair protein RadC [Brucella abortus str. 2308 A]
 gi|254689493|ref|ZP_05152747.1| DNA repair protein RadC [Brucella abortus bv. 6 str. 870]
 gi|254693980|ref|ZP_05155808.1| DNA repair protein RadC [Brucella abortus bv. 3 str. Tulya]
 gi|254697631|ref|ZP_05159459.1| DNA repair protein RadC [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702017|ref|ZP_05163845.1| DNA repair protein RadC [Brucella suis bv. 5 str. 513]
 gi|254704558|ref|ZP_05166386.1| DNA repair protein RadC [Brucella suis bv. 3 str. 686]
 gi|254710344|ref|ZP_05172155.1| DNA repair protein RadC [Brucella pinnipedialis B2/94]
 gi|254714340|ref|ZP_05176151.1| DNA repair protein RadC [Brucella ceti M644/93/1]
 gi|254717239|ref|ZP_05179050.1| DNA repair protein RadC [Brucella ceti M13/05/1]
 gi|254730521|ref|ZP_05189099.1| DNA repair protein RadC [Brucella abortus bv. 4 str. 292]
 gi|256031838|ref|ZP_05445452.1| DNA repair protein RadC [Brucella pinnipedialis M292/94/1]
 gi|256044923|ref|ZP_05447826.1| DNA repair protein RadC [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061358|ref|ZP_05451502.1| DNA repair protein RadC [Brucella neotomae 5K33]
 gi|256113838|ref|ZP_05454631.1| DNA repair protein RadC [Brucella melitensis bv. 3 str. Ether]
 gi|256257741|ref|ZP_05463277.1| DNA repair protein RadC [Brucella abortus bv. 9 str. C68]
 gi|256369702|ref|YP_003107212.1| DNA repair protein RadC [Brucella microti CCM 4915]
 gi|260168972|ref|ZP_05755783.1| DNA repair protein RadC [Brucella sp. F5/99]
 gi|260546732|ref|ZP_05822471.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565477|ref|ZP_05835961.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260566199|ref|ZP_05836669.1| DNA repair protein RadC [Brucella suis bv. 4 str. 40]
 gi|260755015|ref|ZP_05867363.1| DNA repair protein RadC [Brucella abortus bv. 6 str. 870]
 gi|260758231|ref|ZP_05870579.1| DNA repair protein RadC [Brucella abortus bv. 4 str. 292]
 gi|260762058|ref|ZP_05874401.1| DNA repair protein RadC [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884026|ref|ZP_05895640.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214271|ref|ZP_05928552.1| DNA repair protein RadC [Brucella abortus bv. 3 str. Tulya]
 gi|261219056|ref|ZP_05933337.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317907|ref|ZP_05957104.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322116|ref|ZP_05961313.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261325359|ref|ZP_05964556.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261752583|ref|ZP_05996292.1| DNA repair protein RadC [Brucella suis bv. 5 str. 513]
 gi|261755242|ref|ZP_05998951.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758465|ref|ZP_06002174.1| DNA repair protein RadC [Brucella sp. F5/99]
 gi|265988936|ref|ZP_06101493.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991349|ref|ZP_06103906.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995186|ref|ZP_06107743.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|294852618|ref|ZP_06793291.1| DNA repair protein radC [Brucella sp. NVSL 07-0026]
 gi|297248579|ref|ZP_06932297.1| DNA repair protein radC [Brucella abortus bv. 5 str. B3196]
 gi|306840253|ref|ZP_07473027.1| DNA repair protein RadC [Brucella sp. BO2]
 gi|306844186|ref|ZP_07476779.1| DNA repair protein RadC [Brucella sp. BO1]
 gi|54039000|sp|P65956|Y1283_BRUSU RecName: Full=UPF0758 protein BR1283
 gi|54041782|sp|P65955|Y718_BRUME RecName: Full=UPF0758 protein BMEI0718
 gi|73913733|sp|Q57CL3|Y1284_BRUAB RecName: Full=UPF0758 protein BruAb1_1284
 gi|123547434|sp|Q2YRF9|Y1301_BRUA2 RecName: Full=UPF0758 protein BAB1_1301
 gi|238687216|sp|A9M5U5|Y1306_BRUC2 RecName: Full=UPF0758 protein BCAN_A1306
 gi|238689385|sp|B2S6C0|Y1214_BRUA1 RecName: Full=UPF0758 protein BAbS19_I12140
 gi|17982652|gb|AAL51899.1| DNA repair protein radc homolog [Brucella melitensis bv. 1 str.
           16M]
 gi|23348123|gb|AAN30201.1| DNA repair protein RadC [Brucella suis 1330]
 gi|62196321|gb|AAX74621.1| RadC, DNA repair protein RadC [Brucella abortus bv. 1 str. 9-941]
 gi|82616211|emb|CAJ11257.1| DNA repair protein RadC [Brucella melitensis biovar Abortus 2308]
 gi|161336045|gb|ABX62350.1| DNA repair protein RadC [Brucella canis ATCC 23365]
 gi|189019995|gb|ACD72717.1| DNA repair protein RadC [Brucella abortus S19]
 gi|225617754|gb|EEH14799.1| DNA repair protein RadC [Brucella ceti str. Cudo]
 gi|237788994|gb|EEP63205.1| DNA repair protein RadC [Brucella abortus str. 2308 A]
 gi|255999864|gb|ACU48263.1| DNA repair protein RadC [Brucella microti CCM 4915]
 gi|260095782|gb|EEW79659.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151545|gb|EEW86639.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155717|gb|EEW90797.1| DNA repair protein RadC [Brucella suis bv. 4 str. 40]
 gi|260668549|gb|EEX55489.1| DNA repair protein RadC [Brucella abortus bv. 4 str. 292]
 gi|260672490|gb|EEX59311.1| DNA repair protein RadC [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675123|gb|EEX61944.1| DNA repair protein RadC [Brucella abortus bv. 6 str. 870]
 gi|260873554|gb|EEX80623.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915878|gb|EEX82739.1| DNA repair protein RadC [Brucella abortus bv. 3 str. Tulya]
 gi|260924145|gb|EEX90713.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294806|gb|EEX98302.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297130|gb|EEY00627.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301339|gb|EEY04836.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261738449|gb|EEY26445.1| DNA repair protein RadC [Brucella sp. F5/99]
 gi|261742336|gb|EEY30262.1| DNA repair protein RadC [Brucella suis bv. 5 str. 513]
 gi|261744995|gb|EEY32921.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262766299|gb|EEZ12088.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002133|gb|EEZ14708.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264661133|gb|EEZ31394.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294821207|gb|EFG38206.1| DNA repair protein radC [Brucella sp. NVSL 07-0026]
 gi|297175748|gb|EFH35095.1| DNA repair protein radC [Brucella abortus bv. 5 str. B3196]
 gi|306275461|gb|EFM57198.1| DNA repair protein RadC [Brucella sp. BO1]
 gi|306289780|gb|EFM60962.1| DNA repair protein RadC [Brucella sp. BO2]
          Length = 249

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+IIGK    S + LR+I
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIIGKHGHASLRSLRLI 249


>gi|163843546|ref|YP_001627950.1| DNA repair protein RadC [Brucella suis ATCC 23445]
 gi|163674269|gb|ABY38380.1| DNA repair protein RadC [Brucella suis ATCC 23445]
          Length = 249

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+IIGK    S + LR+I
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIIGKHGHASLRSLRLI 249


>gi|283856582|ref|YP_003377816.1| DNA repair protein RadC [Zymomonas mobilis subsp. mobilis ZM4]
 gi|283775591|gb|ADB28982.1| DNA repair protein RadC [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 169

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GTID  PVY RE+V+  L L+A ++IL HNHPSGNP PS AD 
Sbjct: 73  LFLDTRHRLIEYREMFHGTIDSAPVYPREVVKEALRLNAAAVILSHNHPSGNPEPSQADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+      SF    +I
Sbjct: 133 VLTQRLKKALGLVDMRVLDHVIVAGSTTESFAERGLI 169


>gi|254719330|ref|ZP_05181141.1| DNA repair protein RadC [Brucella sp. 83/13]
 gi|265984331|ref|ZP_06097066.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839105|ref|ZP_07471922.1| DNA repair protein RadC [Brucella sp. NF 2653]
 gi|264662923|gb|EEZ33184.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405652|gb|EFM61914.1| DNA repair protein RadC [Brucella sp. NF 2653]
          Length = 249

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     LNI VHDH+IIGK    S + LR+I
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIIGKHGHASLRSLRLI 249


>gi|238783986|ref|ZP_04628002.1| DNA repair protein radC [Yersinia bercovieri ATCC 43970]
 gi|238715094|gb|EEQ07090.1| DNA repair protein radC [Yersinia bercovieri ATCC 43970]
          Length = 249

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 153 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKANAAALILAHNHPSGRAEPSQADR 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MTQ +I   + L+I V DH+++G+   VSF     +
Sbjct: 213 LMTQQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 249


>gi|218692705|ref|YP_002400917.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|218430269|emb|CAR11137.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
          Length = 163

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|154253040|ref|YP_001413864.1| DNA repair protein RadC [Parvibaculum lavamentivorans DS-1]
 gi|154156990|gb|ABS64207.1| DNA repair protein RadC [Parvibaculum lavamentivorans DS-1]
          Length = 230

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADEVQ +GT+DH PVY RE+V+R LEL+A+++ILVHNHPSG+P PS AD+
Sbjct: 134 LFLDRKNVLIADEVQQKGTVDHTPVYPREVVKRALELNASALILVHNHPSGDPTPSTADV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+ T  PL I VHDH+++GK    SF+ L +I
Sbjct: 194 EMTRQIVNTAKPLGIEVHDHLVVGKGRHASFRTLGLI 230


>gi|170683005|ref|YP_001745192.1| RadC family DNA repair protein [Escherichia coli SMS-3-5]
 gi|170520723|gb|ACB18901.1| DNA repair protein, RadC family [Escherichia coli SMS-3-5]
          Length = 158

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|271498728|ref|YP_003331753.1| DNA repair protein RadC [Dickeya dadantii Ech586]
 gi|270342283|gb|ACZ75048.1| DNA repair protein RadC [Dickeya dadantii Ech586]
          Length = 221

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  +    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 125 MFLDNQHRVICHQEMFAGTISRVEVHPREIVREALKVNAAALILAHNHPSGRAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I+     + I V DH++IG+  +VSF     +
Sbjct: 185 SITEKIVQACQLMEIRVLDHLVIGRGEYVSFAERGWL 221


>gi|188495664|ref|ZP_03002934.1| DNA repair protein, RadC family [Escherichia coli 53638]
 gi|193062199|ref|ZP_03043295.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|193062945|ref|ZP_03044038.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|256023420|ref|ZP_05437285.1| DNA repair protein [Escherichia sp. 4_1_40B]
 gi|260844612|ref|YP_003222390.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
 gi|260856468|ref|YP_003230359.1| putative DNA repair protein [Escherichia coli O26:H11 str. 11368]
 gi|260868651|ref|YP_003235053.1| putative DNA repair protein [Escherichia coli O111:H- str. 11128]
 gi|300824768|ref|ZP_07104873.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|312973758|ref|ZP_07787930.1| DNA repair RadC family protein [Escherichia coli 1827-70]
 gi|188490863|gb|EDU65966.1| DNA repair protein, RadC family [Escherichia coli 53638]
 gi|192931588|gb|EDV84189.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|192932419|gb|EDV85017.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|226237408|dbj|BAH46930.1| predicted DNA repair protein [Escherichia coli O55:H7]
 gi|257755117|dbj|BAI26619.1| putative DNA repair protein [Escherichia coli O26:H11 str. 11368]
 gi|257759759|dbj|BAI31256.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
 gi|257765007|dbj|BAI36502.1| putative DNA repair protein [Escherichia coli O111:H- str. 11128]
 gi|300522755|gb|EFK43824.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|310332353|gb|EFP99588.1| DNA repair RadC family protein [Escherichia coli 1827-70]
 gi|323156365|gb|EFZ42522.1| DNA repair RadC family protein [Escherichia coli EPECa14]
 gi|323177162|gb|EFZ62752.1| DNA repair protein RadC family protein [Escherichia coli 1180]
 gi|330911842|gb|EGH40352.1| putative DNA repair protein [Escherichia coli AA86]
 gi|332092379|gb|EGI97452.1| DNA repair protein RadC family protein [Shigella boydii 5216-82]
          Length = 158

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|229520275|ref|ZP_04409701.1| DNA repair protein RadC [Vibrio cholerae TM 11079-80]
 gi|229342641|gb|EEO07633.1| DNA repair protein RadC [Vibrio cholerae TM 11079-80]
          Length = 158

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +   RGT+D   VY RE+++  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 63  LFLDNQHRLIEFKELFRGTVDAASVYPREVLKEALNVNAAAVIFAHNHPSGDPEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ ++I V DH+++GK + VSF     +
Sbjct: 123 RITQRLKDALSLVDIRVLDHVVVGKSS-VSFAERGWL 158


>gi|254850972|ref|ZP_05240322.1| DNA repair protein [Vibrio cholerae MO10]
 gi|21885298|gb|AAL59704.1| putative DNA repair radC [Vibrio cholerae]
 gi|254846677|gb|EET25091.1| DNA repair protein [Vibrio cholerae MO10]
 gi|259156323|gb|ACV96269.1| DNA repair protein RadC [Vibrio cholerae Ind4]
 gi|259156536|gb|ACV96480.1| DNA repair protein RadC [Vibrio cholerae Mex1]
          Length = 165

 Score =  136 bits (344), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LEL+A ++ILVHNHPSG+P PS+AD 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALELNAAAVILVHNHPSGDPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVASEGCVSLAERGYL 165


>gi|26249506|ref|NP_755546.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|301017434|ref|ZP_07182164.1| putative DNA repair protein RadC [Escherichia coli MS 69-1]
 gi|26109914|gb|AAN82119.1|AE016766_207 Putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|291291731|gb|ADD91702.1| YeeS [Escherichia coli]
 gi|300400214|gb|EFJ83752.1| putative DNA repair protein RadC [Escherichia coli MS 69-1]
 gi|323960166|gb|EGB55809.1| DNA repair protein RadC [Escherichia coli H489]
 gi|332102586|gb|EGJ05932.1| YeeS protein [Shigella sp. D9]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|197286286|ref|YP_002152158.1| plasmid-related DNA repair protein [Proteus mirabilis HI4320]
 gi|194683773|emb|CAR44822.1| putative plasmid-related DNA repair protein [Proteus mirabilis
           HI4320]
          Length = 165

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LE +A ++ILVHNHPSG+P PS+AD 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALEFNAAAVILVHNHPSGDPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVASEGCVSLAERGYL 165


>gi|254470509|ref|ZP_05083913.1| DNA repair protein RadC [Pseudovibrio sp. JE062]
 gi|211960820|gb|EEA96016.1| DNA repair protein RadC [Pseudovibrio sp. JE062]
          Length = 275

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+ +R LELSA +IILVHNHPSG+P PS  DI
Sbjct: 179 LFLDKKNRLIADEVQQTGTVDHTPVYPREVTKRALELSACAIILVHNHPSGDPTPSRQDI 238

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I +TL PL I++HDHIII     VSF+GL++I
Sbjct: 239 EMTTKIASTLEPLGIVLHDHIIIAGSGHVSFRGLQLI 275


>gi|57434429|emb|CAI43846.1| YeeS protein [Escherichia coli]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|315633557|ref|ZP_07888847.1| DNA repair protein RadC [Aggregatibacter segnis ATCC 33393]
 gi|315477599|gb|EFU68341.1| DNA repair protein RadC [Aggregatibacter segnis ATCC 33393]
          Length = 232

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY RE+++  L  +A +IIL HNHPSG   PS +D 
Sbjct: 136 LFLDNQHRLIKQERLFLGTINKAMVYPREVIKEALACNAAAIILAHNHPSGVAEPSFSDR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH +IGK  + SF    ++
Sbjct: 196 QITETIKQAAELVEIRVLDHFVIGKGNYFSFAEQNLL 232


>gi|284924227|emb|CBG37327.1| putative plasmid-related protein [Escherichia coli 042]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|304399017|ref|ZP_07380886.1| DNA repair protein RadC [Pantoea sp. aB]
 gi|304353477|gb|EFM17855.1| DNA repair protein RadC [Pantoea sp. aB]
          Length = 218

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  +    G+I+ V V+ REIV+  L+L+A ++IL HNHPSG   PS AD 
Sbjct: 122 LFLDNQHRVLRAQNMFSGSINSVEVHPREIVREALKLNAAALILAHNHPSGMAEPSRADR 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +       +I + DH++IG   +VSF     +
Sbjct: 182 EVTHKVSEACQLFDIRLLDHLVIGHGEYVSFAERGWL 218


>gi|307556532|gb|ADN49307.1| DNA repair protein [Escherichia coli ABU 83972]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|323971802|gb|EGB67027.1| DNA repair protein RadC [Escherichia coli TA007]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|293416392|ref|ZP_06659031.1| radC-like protein yeeS [Escherichia coli B185]
 gi|291431748|gb|EFF04731.1| radC-like protein yeeS [Escherichia coli B185]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|300818066|ref|ZP_07098279.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
 gi|301330444|ref|ZP_07223068.1| putative DNA repair protein RadC [Escherichia coli MS 78-1]
 gi|47155002|emb|CAE85201.1| YeeS protein [Escherichia coli]
 gi|300529476|gb|EFK50538.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
 gi|300843599|gb|EFK71359.1| putative DNA repair protein RadC [Escherichia coli MS 78-1]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|15808746|gb|AAL08475.1| unknown [Shigella flexneri 2a]
 gi|281600433|gb|ADA73417.1| putative DNA repair protein [Shigella flexneri 2002017]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|238898968|ref|YP_002924650.1| associated with replication fork, possible DNA repair protein
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466728|gb|ACQ68502.1| associated with replication fork, possible DNA repair protein
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 222

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I+ E    GTID V V+ RE++++ L ++A +IIL HNHPSG P PS AD 
Sbjct: 126 LFLNNKNRVISYEELFSGTIDTVEVHPREVLRKALTVNAAAIILAHNHPSGEPEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  II     L+I V DHI+IG    VSF     I
Sbjct: 186 LITTQIIEASALLDIRVLDHIVIGHGKCVSFAERGWI 222


>gi|237730257|ref|ZP_04560738.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226905796|gb|EEH91714.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LIA E    GTI+   VY RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 62  LYLDNQNQLIAHETLFSGTINRTEVYPREVVKRALYFNAAAVILAHNHPSGETTPSQADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DH+I+G     SF    ++
Sbjct: 122 ALTQRLTQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL 158


>gi|251793907|ref|YP_003008639.1| DNA repair protein RadC [Aggregatibacter aphrophilus NJ8700]
 gi|247535306|gb|ACS98552.1| DNA repair protein RadC [Aggregatibacter aphrophilus NJ8700]
          Length = 219

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 123 LFLDTQHRLIKQENLFLGTINQAMVYPREIIKEALACNAAALILAHNHPSGVAEPSFSDR 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+TQ I      + I V DH +IG+  + SF    ++
Sbjct: 183 NITQKIKQAAELMEIRVLDHFVIGRGCYFSFAEQNLL 219


>gi|171769881|sp|A7MQ95|Y4094_ENTS8 RecName: Full=UPF0758 protein ESA_04094
          Length = 230

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I       GT+ HV V+ REIV+  + L+A  IIL HNHPSG   PS AD 
Sbjct: 134 IFLDSQNRIIRQNTLFTGTLSHVEVHPREIVREAVRLNAAGIILAHNHPSGRAEPSRADK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+ +   ++I V DH++IG+  +VSF     I
Sbjct: 194 MVTERIVKSCQLVDIRVLDHLVIGRGEYVSFAERGWI 230


>gi|15832057|ref|NP_310830.1| DNA repair protein [Escherichia coli O157:H7 str. Sakai]
 gi|168751564|ref|ZP_02776586.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758439|ref|ZP_02783446.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764086|ref|ZP_02789093.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770321|ref|ZP_02795328.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777112|ref|ZP_02802119.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783999|ref|ZP_02809006.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790206|ref|ZP_02815213.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|168801968|ref|ZP_02826975.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC508]
 gi|193062959|ref|ZP_03044051.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|195939516|ref|ZP_03084898.1| putative DNA repair protein [Escherichia coli O157:H7 str. EC4024]
 gi|208810673|ref|ZP_03252549.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816945|ref|ZP_03258065.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819226|ref|ZP_03259546.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397679|ref|YP_002271174.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4115]
 gi|217329638|ref|ZP_03445717.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793710|ref|YP_003078547.1| DNA repair protein [Escherichia coli O157:H7 str. TW14359]
 gi|291283239|ref|YP_003500057.1| DNA repair protein, RadC family [Escherichia coli O55:H7 str.
           CB9615]
 gi|291284324|ref|YP_003501142.1| DNA repair protein, RadC family [Escherichia coli O55:H7 str.
           CB9615]
 gi|13362271|dbj|BAB36226.1| putative DNA repair protein [Escherichia coli O157:H7 str. Sakai]
 gi|187767605|gb|EDU31449.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014397|gb|EDU52519.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4113]
 gi|188998741|gb|EDU67727.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354753|gb|EDU73172.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360779|gb|EDU79198.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365845|gb|EDU84261.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370302|gb|EDU88718.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|189375952|gb|EDU94368.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC508]
 gi|192931218|gb|EDV83820.1| DNA repair protein, RadC family [Escherichia coli E22]
 gi|208725189|gb|EDZ74896.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731288|gb|EDZ79977.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739349|gb|EDZ87031.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159079|gb|ACI36512.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4115]
 gi|217317406|gb|EEC25835.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           TW14588]
 gi|254593110|gb|ACT72471.1| DNA repair protein [Escherichia coli O157:H7 str. TW14359]
 gi|290763112|gb|ADD57073.1| DNA repair protein, RadC family [Escherichia coli O55:H7 str.
           CB9615]
 gi|290764197|gb|ADD58158.1| DNA repair protein, RadC family [Escherichia coli O55:H7 str.
           CB9615]
 gi|320188176|gb|EFW62840.1| putative DNA repair protein [Escherichia coli O157:H7 str. EC1212]
 gi|326338356|gb|EGD62184.1| putative DNA repair protein [Escherichia coli O157:H7 str. 1044]
 gi|326347123|gb|EGD70856.1| putative DNA repair protein [Escherichia coli O157:H7 str. 1125]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|17547339|ref|NP_520741.1| hypothetical protein RSc2620 [Ralstonia solanacearum GMI1000]
 gi|17429642|emb|CAD16327.1| probable dna repair radc-like protein [Ralstonia solanacearum
           GMI1000]
          Length = 169

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  + LI      RGTID   VY RE+V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFMDTQHRLIEYAEMFRGTIDGASVYPRELVKEALRLNAAAVIVSHNHPSGNPEPSGADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+      SF    +I
Sbjct: 133 ALTQRLKEALGLVDVRVLDHVIVAGTDTTSFAERGLI 169


>gi|21228893|ref|NP_634815.1| DNA repair protein RadC [Methanosarcina mazei Go1]
 gi|25009023|sp|Q8PTC5|Y2791_METMA RecName: Full=UPF0758 protein MM_2791
 gi|20907423|gb|AAM32487.1| DNA repair protein [Methanosarcina mazei Go1]
          Length = 229

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N ++ +EV S G+++   V+ RE+ +  L  S+ S+I+VHNHPSG+P+PS  DI
Sbjct: 132 LYLDTKNQILKEEVVSIGSLNASIVHPREVFKSALMESSASVIMVHNHPSGDPSPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I + DHIIIG   +VS K    +
Sbjct: 192 MVTEKLVEGGKLLGIDILDHIIIGDGRYVSLKDEGFV 228


>gi|284922959|emb|CBG36051.1| putative DNA repair protein [Escherichia coli 042]
 gi|284924496|emb|CBG37630.1| putative RadC-like DNA repair protein [Escherichia coli 042]
 gi|323939702|gb|EGB35906.1| DNA repair protein RadC [Escherichia coli E482]
 gi|323961766|gb|EGB57367.1| DNA repair protein RadC [Escherichia coli H489]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|309703383|emb|CBJ02722.1| putative RadC DNA repair protein [Escherichia coli ETEC H10407]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|218702486|ref|YP_002410115.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
 gi|218372472|emb|CAR20348.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 163


>gi|323960883|gb|EGB56503.1| DNA repair protein RadC [Escherichia coli H489]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|238754770|ref|ZP_04616122.1| DNA repair protein radC [Yersinia ruckeri ATCC 29473]
 gi|238707078|gb|EEP99443.1| DNA repair protein radC [Yersinia ruckeri ATCC 29473]
          Length = 222

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTITSVEVHPREIVREALKINAVALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++   + L+I V DH+++G+   VSF     I
Sbjct: 186 LITAQVVKACSLLDIRVLDHLVVGRGECVSFAERGWI 222


>gi|315256374|gb|EFU36342.1| putative DNA repair protein RadC [Escherichia coli MS 85-1]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|300903084|ref|ZP_07121021.1| putative DNA repair protein RadC [Escherichia coli MS 84-1]
 gi|300404861|gb|EFJ88399.1| putative DNA repair protein RadC [Escherichia coli MS 84-1]
          Length = 163

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|153802336|ref|ZP_01956922.1| DNA repair protein [Vibrio cholerae MZO-3]
 gi|124122109|gb|EAY40852.1| DNA repair protein [Vibrio cholerae MZO-3]
 gi|172051601|emb|CAQ34996.1| hypothetical protein [Photobacterium damselae subsp. piscicida]
 gi|259156591|gb|ACV96534.1| DNA repair protein RadC [Vibrio fluvialis Ind1]
          Length = 165

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LEL+A ++ILVHNHPSG+P PS+AD 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALELNAAAVILVHNHPSGDPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVASEGCVSLAERGYL 165


>gi|323175748|gb|EFZ61342.1| DNA repair protein RadC family protein [Escherichia coli 1180]
          Length = 158

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|152979886|ref|YP_001354241.1| DNA repair protein RadC [Janthinobacterium sp. Marseille]
 gi|166218783|sp|A6T144|Y2551_JANMA RecName: Full=UPF0758 protein mma_2551
 gi|151279963|gb|ABR88373.1| DNA repair protein [Janthinobacterium sp. Marseille]
          Length = 224

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+ H  VY REIV+  L  +A S+IL HNHPSG+  PS AD 
Sbjct: 128 LFLDVKNRLIACEELFRGTLTHTSVYPREIVKEALTHNAASVILAHNHPSGSSEPSAADH 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   L  +++ V DH ++G     SF     +
Sbjct: 188 SLTQALKQALALIDVRVLDHFVVGGKNVYSFAEHGHL 224


>gi|194449680|ref|YP_002048317.1| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194407984|gb|ACF68203.1| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|157154969|ref|YP_001464407.1| RadC family DNA repair protein [Escherichia coli E24377A]
 gi|157076999|gb|ABV16707.1| DNA repair protein, RadC family [Escherichia coli E24377A]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|57545665|gb|AAW51756.1| Aec73 [Escherichia coli]
          Length = 163

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 163


>gi|331650180|ref|ZP_08351253.1| DNA repair protein RadC [Escherichia coli M605]
 gi|331041125|gb|EGI13282.1| DNA repair protein RadC [Escherichia coli M605]
          Length = 163

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 163


>gi|251791518|ref|YP_003006239.1| DNA repair protein RadC [Dickeya zeae Ech1591]
 gi|247540139|gb|ACT08760.1| DNA repair protein RadC [Dickeya zeae Ech1591]
          Length = 221

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  +    GTI  V V+ REIV+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 125 MFLDNQHRVIRHQEMFAGTISSVEVHPREIVREALRANAAALILAHNHPSGRAEPSKADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I+     L+I V DH++IG+  +VSF     I
Sbjct: 185 SITGKIVQACQLLDIRVLDHLVIGRGEYVSFAERGWI 221


>gi|301304122|ref|ZP_07210238.1| putative DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|300840535|gb|EFK68295.1| putative DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|315252292|gb|EFU32260.1| putative DNA repair protein RadC [Escherichia coli MS 85-1]
          Length = 163

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|300825335|ref|ZP_07105415.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|300522198|gb|EFK43267.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+V+R L  +A +++L HNHPSG   P  AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVVKRALYHNAAAVVLAHNHPSGEVTPGKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSRVFSFAEHGLL 158


>gi|110643998|ref|YP_671728.1| putative radC-like protein [Escherichia coli 536]
 gi|170682543|ref|YP_001744295.1| RadC family DNA repair protein [Escherichia coli SMS-3-5]
 gi|256019130|ref|ZP_05432995.1| putative radC-like protein [Shigella sp. D9]
 gi|306816730|ref|ZP_07450859.1| putative radC-like protein [Escherichia coli NC101]
 gi|309797259|ref|ZP_07691654.1| putative DNA repair protein RadC [Escherichia coli MS 145-7]
 gi|24528057|emb|CAD33787.1| Z1217 protein [Escherichia coli]
 gi|110345590|gb|ABG71827.1| putative radC-like protein [Escherichia coli 536]
 gi|170520261|gb|ACB18439.1| DNA repair protein, RadC family [Escherichia coli SMS-3-5]
 gi|305849947|gb|EFM50407.1| putative radC-like protein [Escherichia coli NC101]
 gi|307555022|gb|ADN47797.1| DNA repair protein [Escherichia coli ABU 83972]
 gi|308119134|gb|EFO56396.1| putative DNA repair protein RadC [Escherichia coli MS 145-7]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|195183362|dbj|BAG66899.1| predicted protein [Escherichia coli O111:H-]
          Length = 163

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYYNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|110833075|ref|YP_691934.1| DNA repair protein RadC-like protein [Alcanivorax borkumensis SK2]
 gi|123050781|sp|Q0VT58|Y214_ALCBS RecName: Full=UPF0758 protein ABO_0214
 gi|110646186|emb|CAL15662.1| DNA repair protein RadC homolog [Alcanivorax borkumensis SK2]
          Length = 224

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 58/95 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GTID   VY RE+V+R +E +A ++IL HNHPSG   PS +D 
Sbjct: 128 LFLDNKHRLIAFEKLFQGTIDAAAVYPREVVRRAMEHNAAAVILAHNHPSGVAEPSQSDH 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ ++  L  + + V DH++IG   +VS     
Sbjct: 188 AITRRLVEALGLVEVRVLDHLVIGDGGWVSLASRG 222


>gi|18265919|gb|AAL67392.1|AF447814_60 putative intergenic-region protein [Escherichia coli]
          Length = 260

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 164 LYLNNQNKLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 223

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 224 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 260


>gi|16128232|ref|NP_414781.1| CP4-6 prophage; predicted DNA repair protein [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89107120|ref|AP_000900.1| predicted DNA repair protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|170079872|ref|YP_001729192.1| CP4-6 prophage; DNA repair protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|238899635|ref|YP_002925431.1| CP4-6 prophage; putative DNA repair protein [Escherichia coli
           BW2952]
 gi|3025218|sp|Q47685|YKFG_ECOLI RecName: Full=UPF0758 protein ykfG
 gi|1552815|gb|AAB08667.1| similar to E. coli ORF_o160, also similar to radC [Escherichia
           coli]
 gi|2367100|gb|AAC73350.1| CP4-6 prophage; predicted DNA repair protein [Escherichia coli str.
           K-12 substr. MG1655]
 gi|4902982|dbj|BAA77916.1| predicted DNA repair protein [Escherichia coli str. K12 substr.
           W3110]
 gi|169887707|gb|ACB01414.1| CP4-6 prophage; predicted DNA repair protein [Escherichia coli str.
           K-12 substr. DH10B]
 gi|238860643|gb|ACR62641.1| CP4-6 prophage; predicted DNA repair protein [Escherichia coli
           BW2952]
 gi|260450557|gb|ACX40979.1| DNA repair protein RadC [Escherichia coli DH1]
 gi|315134932|dbj|BAJ42091.1| CP4-6 prophage; putative DNA repair protein [Escherichia coli DH1]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LIA E    GTI+   V+ RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 62  LYLDNQNQLIAHETLFTGTINRTEVHPREVVKRALHFNAAAVILAHNHPSGETTPSQADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 TLTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL 158


>gi|254361402|ref|ZP_04977543.1| DNA repair protein RadC [Mannheimia haemolytica PHL213]
 gi|153092908|gb|EDN73939.1| DNA repair protein RadC [Mannheimia haemolytica PHL213]
          Length = 241

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 62/96 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E    GTI+   V+ REI++R L+ +A +II+ HNHPSG+  PS++D 
Sbjct: 132 LFLDNQNRLIYKEKMFFGTINQTAVHPREIIKRALKYNAAAIIVAHNHPSGSCLPSESDR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I      ++I   DHII+GK+ + SF+  ++
Sbjct: 192 SLTKKIEMACELVDIRFVDHIIVGKEKYFSFEEEKL 227


>gi|331647648|ref|ZP_08348740.1| putative DNA repair protein [Escherichia coli M605]
 gi|331043372|gb|EGI15510.1| putative DNA repair protein [Escherichia coli M605]
          Length = 163

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQAFSFAEHGLL 163


>gi|331679016|ref|ZP_08379688.1| putative DNA repair protein [Escherichia coli H591]
 gi|331073081|gb|EGI44404.1| putative DNA repair protein [Escherichia coli H591]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|53729025|ref|ZP_00134298.2| COG2003: DNA repair proteins [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209424|ref|YP_001054649.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae L20]
 gi|165977413|ref|YP_001653006.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190151327|ref|YP_001969852.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303250352|ref|ZP_07336551.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303251745|ref|ZP_07337916.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307246909|ref|ZP_07528974.1| hypothetical protein appser1_20990 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249045|ref|ZP_07531053.1| hypothetical protein appser2_20080 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251244|ref|ZP_07533165.1| hypothetical protein appser4_20050 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253661|ref|ZP_07535528.1| hypothetical protein appser6_21530 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255891|ref|ZP_07537692.1| hypothetical protein appser9_21120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260344|ref|ZP_07542051.1| hypothetical protein appser11_21250 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262474|ref|ZP_07544119.1| hypothetical protein appser12_20140 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307264682|ref|ZP_07546262.1| hypothetical protein appser13_20670 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|166218771|sp|A3N3Q8|Y1970_ACTP2 RecName: Full=UPF0758 protein APL_1970
 gi|238687531|sp|B0BTZ5|Y2017_ACTPJ RecName: Full=UPF0758 protein APJL_2017
 gi|238692412|sp|B3H340|Y2058_ACTP7 RecName: Full=UPF0758 protein APP7_2058
 gi|126098216|gb|ABN75044.1| DNA repair protein RadC-like protein [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165877514|gb|ABY70562.1| DNA repair protein [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|189916458|gb|ACE62710.1| DNA repair protein RadC-like protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302649175|gb|EFL79360.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302650822|gb|EFL80979.1| DNA repair protein RadC [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306852194|gb|EFM84434.1| hypothetical protein appser1_20990 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854503|gb|EFM86698.1| hypothetical protein appser2_20080 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306856760|gb|EFM88895.1| hypothetical protein appser4_20050 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858897|gb|EFM90943.1| hypothetical protein appser6_21530 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861159|gb|EFM93152.1| hypothetical protein appser9_21120 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865595|gb|EFM97476.1| hypothetical protein appser11_21250 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867851|gb|EFM99682.1| hypothetical protein appser12_20140 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306869994|gb|EFN01758.1| hypothetical protein appser13_20670 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 220

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 57/94 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI  E    GTI+   VY REI++  L+ +A +II+ HNHPSGN  PS++D 
Sbjct: 124 MFLDNQNRLIKKEKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGNCTPSESDR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ +    + + I   DHI++GK  + SF+  
Sbjct: 184 ALTKKLEMACDLVGIRFVDHIVVGKGDYFSFEEE 217


>gi|15800738|ref|NP_286752.1| RadC family DNA repair protein [Escherichia coli O157:H7 EDL933]
 gi|15830657|ref|NP_309430.1| DNA repair protein [Escherichia coli O157:H7 str. Sakai]
 gi|168747209|ref|ZP_02772231.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754500|ref|ZP_02779507.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760639|ref|ZP_02785646.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767678|ref|ZP_02792685.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773864|ref|ZP_02798871.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781194|ref|ZP_02806201.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789211|ref|ZP_02814218.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|168789954|ref|ZP_02814961.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|168799298|ref|ZP_02824305.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC508]
 gi|195935412|ref|ZP_03080794.1| putative DNA repair protein [Escherichia coli O157:H7 str. EC4024]
 gi|208806612|ref|ZP_03248949.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208815111|ref|ZP_03256290.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822765|ref|ZP_03263084.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398241|ref|YP_002269871.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4115]
 gi|215486235|ref|YP_002328666.1| hypothetical protein E2348C_1116 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217328314|ref|ZP_03444396.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           TW14588]
 gi|254792408|ref|YP_003077245.1| putative DNA repair protein, RADC family [Escherichia coli O157:H7
           str. TW14359]
 gi|260854510|ref|YP_003228401.1| hypothetical protein ECO26_1359 [Escherichia coli O26:H11 str.
           11368]
 gi|260867389|ref|YP_003233791.1| hypothetical protein ECO111_1303 [Escherichia coli O111:H- str.
           11128]
 gi|12514034|gb|AAG55362.1|AE005277_3 putative DNA repair protein, RADC family [Escherichia coli O157:H7
           str. EDL933]
 gi|13360863|dbj|BAB34826.1| putative DNA repair protein [Escherichia coli O157:H7 str. Sakai]
 gi|187770349|gb|EDU34193.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018129|gb|EDU56251.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001340|gb|EDU70326.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358273|gb|EDU76692.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363292|gb|EDU81711.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368665|gb|EDU87081.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370470|gb|EDU88886.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|189371180|gb|EDU89596.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC869]
 gi|189378248|gb|EDU96664.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC508]
 gi|208726413|gb|EDZ76014.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731759|gb|EDZ80447.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738250|gb|EDZ85933.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159641|gb|ACI37074.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           EC4115]
 gi|215264307|emb|CAS08664.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217318741|gb|EEC27167.1| DNA repair protein, RadC family [Escherichia coli O157:H7 str.
           TW14588]
 gi|254591808|gb|ACT71169.1| putative DNA repair protein, RADC family [Escherichia coli O157:H7
           str. TW14359]
 gi|257753159|dbj|BAI24661.1| hypothetical protein ECO26_1359 [Escherichia coli O26:H11 str.
           11368]
 gi|257763745|dbj|BAI35240.1| hypothetical protein ECO111_1303 [Escherichia coli O111:H- str.
           11128]
 gi|320189702|gb|EFW64358.1| Putative radC-like protein yeeS [Escherichia coli O157:H7 str.
           EC1212]
 gi|323156828|gb|EFZ42962.1| DNA repair RadC family protein [Escherichia coli EPECa14]
 gi|326339244|gb|EGD63058.1| Putative radC-like protein yeeS [Escherichia coli O157:H7 str.
           1125]
 gi|326344796|gb|EGD68544.1| Putative radC-like protein yeeS [Escherichia coli O157:H7 str.
           1044]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|320184366|gb|EFW59178.1| putative DNA repair protein [Shigella flexneri CDC 796-83]
          Length = 158

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|261248877|emb|CBG26731.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
          Length = 221

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|204928480|ref|ZP_03219679.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204321913|gb|EDZ07111.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 221

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|307133081|ref|YP_003885097.1| protein associated with replication fork, putative DNA repair
           protein [Dickeya dadantii 3937]
 gi|306530610|gb|ADN00541.1| protein associated with replication fork, possible DNA repair
           protein [Dickeya dadantii 3937]
          Length = 232

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  +    GTI  V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 136 MFLDNQHRVIRHQEMFAGTISSVEVHPREIVREALKANAAALILAHNHPSGRAEPSQADR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I      L+I V DH++IG+  +VSF     I
Sbjct: 196 SITGKIAQACQLLDIRVLDHLVIGRGEYVSFAERGWI 232


>gi|57434486|emb|CAI43901.1| YeeS protein [Escherichia coli]
          Length = 163

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 163


>gi|300816625|ref|ZP_07096846.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
 gi|300530855|gb|EFK51917.1| putative DNA repair protein RadC [Escherichia coli MS 107-1]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|194432463|ref|ZP_03064750.1| DNA repair protein, RadC family [Shigella dysenteriae 1012]
 gi|194419350|gb|EDX35432.1| DNA repair protein, RadC family [Shigella dysenteriae 1012]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|149181794|ref|ZP_01860285.1| DNA repair protein RadC [Bacillus sp. SG-1]
 gi|148850535|gb|EDL64694.1| DNA repair protein RadC [Bacillus sp. SG-1]
          Length = 229

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     SA SII +HNHPSG+P PS  DI
Sbjct: 133 LYLNTKNQVLHKQTIFIGSLNASIVHPREVFKEAFRRSAASIICIHNHPSGDPTPSREDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH+IIG+  +VS K    +
Sbjct: 193 EVTKRLVECGKIIGIEVLDHLIIGEKKYVSLKEKGYL 229


>gi|260845668|ref|YP_003223446.1| putative radC-like protein YeeS [Escherichia coli O103:H2 str.
           12009]
 gi|257760815|dbj|BAI32312.1| putative radC-like protein YeeS [Escherichia coli O103:H2 str.
           12009]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGRQVFSFAEHGLL 158


>gi|110643167|ref|YP_670897.1| putative radC-like protein YeeS [Escherichia coli 536]
 gi|191171912|ref|ZP_03033458.1| DNA repair protein, RadC family [Escherichia coli F11]
 gi|194436803|ref|ZP_03068903.1| DNA repair protein, RadC family [Escherichia coli 101-1]
 gi|260855983|ref|YP_003229874.1| putative DNA repair protein [Escherichia coli O26:H11 str. 11368]
 gi|110344759|gb|ABG70996.1| putative radC-like protein YeeS [Escherichia coli 536]
 gi|190907947|gb|EDV67540.1| DNA repair protein, RadC family [Escherichia coli F11]
 gi|194424285|gb|EDX40272.1| DNA repair protein, RadC family [Escherichia coli 101-1]
 gi|257754632|dbj|BAI26134.1| predicted DNA repair protein [Escherichia coli O26:H11 str. 11368]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|260846935|ref|YP_003224713.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
 gi|257762082|dbj|BAI33579.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGRQVFSFAEHGLL 158


>gi|170765890|ref|ZP_02900701.1| DNA repair protein, RadC family [Escherichia albertii TW07627]
 gi|260858467|ref|YP_003232358.1| putative DNA repair protein [Escherichia coli O26:H11 str. 11368]
 gi|331668235|ref|ZP_08369085.1| putative DNA repair protein [Escherichia coli TA271]
 gi|170125036|gb|EDS93967.1| DNA repair protein, RadC family [Escherichia albertii TW07627]
 gi|257757116|dbj|BAI28618.1| putative DNA repair protein [Escherichia coli O26:H11 str. 11368]
 gi|309702306|emb|CBJ01626.1| putative RadC-like DNA repair protein [Escherichia coli ETEC
           H10407]
 gi|323172584|gb|EFZ58218.1| DNA repair protein RadC family protein [Escherichia coli LT-68]
 gi|331064536|gb|EGI36445.1| putative DNA repair protein [Escherichia coli TA271]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|293393619|ref|ZP_06637929.1| DNA repair protein RadC [Serratia odorifera DSM 4582]
 gi|291423954|gb|EFE97173.1| DNA repair protein RadC [Serratia odorifera DSM 4582]
          Length = 228

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI  V V+ REIV+  L+ +A +IIL HNHPSG   PS AD 
Sbjct: 132 LFLDNQHRVIRHQEMFTGTISSVVVHPREIVREALKANAAAIILAHNHPSGKAEPSHADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I V DH++IG+   VSF     +
Sbjct: 192 LITEQVANACQLLEIRVLDHLVIGRGECVSFAERGWL 228


>gi|170680679|ref|YP_001746718.1| RadC family DNA repair protein [Escherichia coli SMS-3-5]
 gi|170518397|gb|ACB16575.1| DNA repair protein, RadC family [Escherichia coli SMS-3-5]
          Length = 158

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|20095187|gb|AAM08053.1| hypothetical protein [Providencia rettgeri]
          Length = 165

 Score =  135 bits (342), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LEL+A ++ILVHNHPSG+P PS+AD 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALELNAAAVILVHNHPSGDPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVAYEGCVSLAERGYL 165


>gi|323971984|gb|EGB67205.1| DNA repair protein RadC [Escherichia coli TA007]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+V+R L  +A +++L HNHPSG   P  AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVVKRALYHNAAAVVLAHNHPSGEVTPGKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIIGGSRVFSFAEHGLL 158


>gi|153822298|ref|ZP_01974965.1| DNA repair protein [Vibrio cholerae B33]
 gi|229509083|ref|ZP_04398570.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229608755|ref|YP_002879403.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|255743769|ref|ZP_05417727.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|126520194|gb|EAZ77417.1| DNA repair protein [Vibrio cholerae B33]
 gi|229353840|gb|EEO18775.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229371410|gb|ACQ61833.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|255738630|gb|EET94017.1| DNA repair protein RadC [Vibrio cholera CIRS 101]
 gi|259156144|gb|ACV96092.1| DNA repair protein RadC [Providencia alcalifaciens Ban1]
 gi|259156276|gb|ACV96223.1| DNA repair protein RadC [Vibrio cholerae Ban5]
 gi|259156401|gb|ACV96346.1| DNA repair protein RadC [Vibrio cholerae Ind5]
          Length = 165

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LEL+A ++ILVHNHPSG+P PS+AD 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALELNAAAVILVHNHPSGDPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVASEGCVSLAERGYL 165


>gi|296533048|ref|ZP_06895694.1| DNA repair protein RadC [Roseomonas cervicalis ATCC 49957]
 gi|296266634|gb|EFH12613.1| DNA repair protein RadC [Roseomonas cervicalis ATCC 49957]
          Length = 252

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIADE Q+RGT++H PVY RE+V+RCLEL AT++ILVHNHPSG+P PS ADI
Sbjct: 156 LFLDSRNRLIADEAQARGTVNHTPVYPREVVKRCLELQATALILVHNHPSGDPTPSAADI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L I +HDH+I+G    +SF+   ++
Sbjct: 216 EMTAEIRAAAATLGIALHDHLIVGNGRHLSFRATGLL 252


>gi|218692535|ref|YP_002400747.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|283788471|ref|YP_003368336.1| putative DNA repair protein [Citrobacter rodentium ICC168]
 gi|218430099|emb|CAR11092.2| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|282951925|emb|CBG91646.1| putative DNA repair protein [Citrobacter rodentium ICC168]
          Length = 163

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|254038104|ref|ZP_04872162.1| YeeS protein [Escherichia sp. 1_1_43]
 gi|226839728|gb|EEH71749.1| YeeS protein [Escherichia sp. 1_1_43]
          Length = 163

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD+
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADL 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|307258076|ref|ZP_07539828.1| hypothetical protein appser10_20560 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863439|gb|EFM95370.1| hypothetical protein appser10_20560 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 223

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 57/94 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI  E    GTI+   VY REI++  L+ +A +II+ HNHPSGN  PS++D 
Sbjct: 124 MFLDNQNRLIKKEKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGNCTPSESDR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ +    + + I   DHI++GK  + SF+  
Sbjct: 184 ALTKKLEMACDLVGIRFVDHIVVGKGDYFSFEEE 217


>gi|295095223|emb|CBK84313.1| DNA replication and repair protein RadC [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A  +IL HNHPSG   PS AD 
Sbjct: 125 IFLDNKNRVLKHTRLFSGTLSHVEVHPREIVREAIKVNAAGVILAHNHPSGCAEPSRADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II     ++I V DH+IIG+  ++SF     I
Sbjct: 185 AITERIIKCCQFMDIRVLDHLIIGRGEYISFAERGWI 221


>gi|227115112|ref|ZP_03828768.1| DNA repair protein RadC [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI+ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 125 LFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANAAALILAHNHPSGKAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+     + I V DH++IG   +VSF     I
Sbjct: 185 AITEQIVKACLLMEIRVLDHLVIGHGEYVSFAERGWI 221


>gi|194426516|ref|ZP_03059070.1| DNA repair protein, RadC family [Escherichia coli B171]
 gi|194415255|gb|EDX31523.1| DNA repair protein, RadC family [Escherichia coli B171]
 gi|323158205|gb|EFZ44297.1| DNA repair protein RadC family protein [Escherichia coli E128010]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYYNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|37680435|ref|NP_935044.1| DNA repair protein [Vibrio vulnificus YJ016]
 gi|37199183|dbj|BAC95015.1| DNA repair protein [Vibrio vulnificus YJ016]
          Length = 184

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI  +   RGT+D   VY RE+V+  L ++A ++I  HNHPSG+P PS AD 
Sbjct: 89  LLLDNQHRLIEFKELFRGTVDAANVYPREVVKEALHVNAAAVIFAHNHPSGDPEPSQADK 148

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ ++I V DH+++G ++ VSF     I
Sbjct: 149 RITERLKDALSLVDIRVLDHVVVG-ESCVSFAERGWI 184


>gi|315614820|gb|EFU95458.1| DNA repair RadC family protein [Escherichia coli 3431]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|194469241|ref|ZP_03075225.1| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205358755|ref|ZP_02658774.2| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194455605|gb|EDX44444.1| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205332230|gb|EDZ18994.1| DNA repair protein, RadC family [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 160

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+ +PS AD 
Sbjct: 64  LYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTSPSQADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G    +SF    ++
Sbjct: 124 TITQRLVQALQLVDIRVPDHLIVGGTQILSFAEHGLL 160


>gi|218515385|ref|ZP_03512225.1| DNA repair protein RadC [Rhizobium etli 8C-3]
          Length = 274

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|26250960|ref|NP_757000.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|117625240|ref|YP_854323.1| putative radC-like protein YeeS [Escherichia coli APEC O1]
 gi|26111392|gb|AAN83574.1|AE016771_85 Putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|70608386|gb|AAZ04458.1| putative RadC-like protein [Escherichia coli]
 gi|115514364|gb|ABJ02439.1| putative radC-like protein YeeS [Escherichia coli APEC O1]
 gi|323957540|gb|EGB53256.1| DNA repair protein RadC [Escherichia coli H263]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNKLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|16762580|ref|NP_458197.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767014|ref|NP_462629.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144069|ref|NP_807411.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62182222|ref|YP_218639.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167549023|ref|ZP_02342782.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168235334|ref|ZP_02660392.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168241908|ref|ZP_02666840.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168260517|ref|ZP_02682490.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168464963|ref|ZP_02698855.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168818441|ref|ZP_02830441.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194447446|ref|YP_002047761.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471766|ref|ZP_03077750.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194738096|ref|YP_002116664.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251672|ref|YP_002148661.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264351|ref|ZP_03164425.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244011|ref|YP_002217690.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200388196|ref|ZP_03214808.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205354669|ref|YP_002228470.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858966|ref|YP_002245617.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213161281|ref|ZP_03346991.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213582558|ref|ZP_03364384.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213615654|ref|ZP_03371480.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647926|ref|ZP_03377979.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855129|ref|ZP_03383369.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224585529|ref|YP_002639328.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910236|ref|ZP_04654073.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289809998|ref|ZP_06540627.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289824121|ref|ZP_06543718.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|54039003|sp|P65961|YICR_SALTI RecName: Full=UPF0758 protein yicR
 gi|54041784|sp|P65960|YICR_SALTY RecName: Full=UPF0758 protein yicR
 gi|73913738|sp|Q57IA4|YICR_SALCH RecName: Full=UPF0758 protein yicR
 gi|238689782|sp|B4TZY0|YICR_SALSV RecName: Full=UPF0758 protein yicR
 gi|238689997|sp|B5EXE3|YICR_SALA4 RecName: Full=UPF0758 protein yicR
 gi|238690228|sp|B4T9C3|YICR_SALHS RecName: Full=UPF0758 protein yicR
 gi|238690333|sp|B5FM62|YICR_SALDC RecName: Full=UPF0758 protein yicR
 gi|238690466|sp|B5R5G2|YICR_SALEP RecName: Full=UPF0758 protein yicR
 gi|238690538|sp|B5RGE9|YICR_SALG2 RecName: Full=UPF0758 protein yicR
 gi|254789657|sp|C0Q1X1|YICR_SALPC RecName: Full=UPF0758 protein yicR
 gi|25322100|pir||AD0971 probable DNA repair protein radC [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16422297|gb|AAL22588.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16504885|emb|CAD03264.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139706|gb|AAO71271.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62129855|gb|AAX67558.1| putative DNA repair protein, associated with replication forks
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194405750|gb|ACF65969.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194458130|gb|EDX46969.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194713598|gb|ACF92819.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195632438|gb|EDX50922.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197215375|gb|ACH52772.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197242606|gb|EDY25226.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197291464|gb|EDY30816.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938527|gb|ACH75860.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605294|gb|EDZ03839.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205274450|emb|CAR39482.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205325640|gb|EDZ13479.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205338909|gb|EDZ25673.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205344387|gb|EDZ31151.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205350173|gb|EDZ36804.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710769|emb|CAR35130.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224470057|gb|ACN47887.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|301160266|emb|CBW19789.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914755|dbj|BAJ38729.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088149|emb|CBY97911.1| DNA repair protein radC homolog [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321226782|gb|EFX51832.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322612895|gb|EFY09847.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618960|gb|EFY15847.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625263|gb|EFY22090.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630070|gb|EFY26843.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634261|gb|EFY30996.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635838|gb|EFY32547.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643024|gb|EFY39601.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645048|gb|EFY41579.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649852|gb|EFY46275.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653059|gb|EFY49394.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322661122|gb|EFY57350.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662389|gb|EFY58602.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667267|gb|EFY63433.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674356|gb|EFY70449.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678436|gb|EFY74497.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680942|gb|EFY76976.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687122|gb|EFY83095.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716710|gb|EFZ08281.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132089|gb|ADX19519.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323195846|gb|EFZ81018.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198237|gb|EFZ83343.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323200855|gb|EFZ85925.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206609|gb|EFZ91567.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210478|gb|EFZ95364.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216234|gb|EGA00962.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220457|gb|EGA04911.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225320|gb|EGA09554.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228434|gb|EGA12565.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323234255|gb|EGA18343.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237240|gb|EGA21307.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244759|gb|EGA28763.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323245866|gb|EGA29856.1| hypothetical protein SEEM9199_16688 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250951|gb|EGA34827.1| hypothetical protein SEEM8282_21207 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257301|gb|EGA41000.1| hypothetical protein SEEM8283_22649 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262225|gb|EGA45786.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264564|gb|EGA48068.1| hypothetical protein SEEM8285_13785 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268854|gb|EGA52312.1| hypothetical protein SEEM8287_17174 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326629808|gb|EGE36151.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|237704007|ref|ZP_04534488.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226901919|gb|EEH88178.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
          Length = 163

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|262392610|ref|YP_003284464.1| DNA repair protein RadC [Vibrio sp. Ex25]
 gi|262336204|gb|ACY49999.1| DNA repair protein RadC [Vibrio sp. Ex25]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + LI+ E    GTID   +Y RE+++  L  +A ++I  HNHPSG   PS AD 
Sbjct: 63  MFLDNQHQLISFEELFFGTIDAASIYPREVLKTALNHNAAAVIFAHNHPSGIAEPSQADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +I  L  ++I V DHI++G +  VSF    +I
Sbjct: 123 RITQRLIDALKLVDIRVLDHIVVG-EGCVSFAEKGLI 158


>gi|326625474|gb|EGE31819.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|281181419|dbj|BAI57749.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|220927247|ref|YP_002502549.1| DNA repair protein RadC [Methylobacterium nodulans ORS 2060]
 gi|219951854|gb|ACL62246.1| DNA repair protein RadC [Methylobacterium nodulans ORS 2060]
          Length = 242

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 146 LFLDKRNRLIADEVQGRGTVDHTPVYPREVVRRALELSATALILVHNHPSGDPTPSQADI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+    PL I+VHDHI++G++   SFKGL++I
Sbjct: 206 RMTRDIVGAAEPLGIVVHDHIVVGREGHASFKGLKLI 242


>gi|117626422|ref|YP_859745.1| putative radC-like protein YeeS [Escherichia coli APEC O1]
 gi|115515546|gb|ABJ03621.1| putative radC-like protein YeeS [Escherichia coli APEC O1]
 gi|323950295|gb|EGB46176.1| DNA repair protein RadC [Escherichia coli H252]
 gi|323954374|gb|EGB50158.1| DNA repair protein RadC [Escherichia coli H263]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|260866447|ref|YP_003232849.1| putative DNA repair protein [Escherichia coli O111:H- str. 11128]
 gi|257762803|dbj|BAI34298.1| putative DNA repair protein [Escherichia coli O111:H- str. 11128]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|238760452|ref|ZP_04621590.1| DNA repair protein radC [Yersinia aldovae ATCC 35236]
 gi|238701347|gb|EEP93926.1| DNA repair protein radC [Yersinia aldovae ATCC 35236]
          Length = 222

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LMTTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 222


>gi|218699408|ref|YP_002407037.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
 gi|218369394|emb|CAR17153.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   P  AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPGKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|323951546|gb|EGB47421.1| DNA repair protein RadC [Escherichia coli H252]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNKLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|294666100|ref|ZP_06731358.1| DNA repair protein RadC [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292604114|gb|EFF47507.1| DNA repair protein RadC [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 225

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VSF     +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSFAERGWL 224


>gi|284922002|emb|CBG35080.1| putative DNA repair protein [Escherichia coli 042]
          Length = 163

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIIGGSQVFSFAEHGLL 163


>gi|238755011|ref|ZP_04616359.1| DNA repair protein RadC [Yersinia ruckeri ATCC 29473]
 gi|238706715|gb|EEP99084.1| DNA repair protein RadC [Yersinia ruckeri ATCC 29473]
          Length = 159

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+  E    G+I+   V+ REIV+  L  +A +++L HNHPSG   PS+AD 
Sbjct: 63  LFLDNQHRLLECETLFSGSINSSEVHPREIVKAALRHNAAAVVLAHNHPSGYAEPSEADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ  +  L  + + V DH ++G    VSF     +
Sbjct: 123 QVTQRTVNALTLVEVRVLDHFVVGGKEVVSFAERGWL 159


>gi|194445201|ref|YP_002042979.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|238693551|sp|B4SXE0|YICR_SALNS RecName: Full=UPF0758 protein yicR
 gi|194403864|gb|ACF64086.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 221

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|84386400|ref|ZP_00989428.1| DNA repair protein RadC-related protein [Vibrio splendidus 12B01]
 gi|84378824|gb|EAP95679.1| DNA repair protein RadC-related protein [Vibrio splendidus 12B01]
          Length = 157

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D+  SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDSCTSFAERGWL 157


>gi|330812589|ref|YP_004357051.1| putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380697|gb|AEA72047.1| putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 224

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + ++  E   RG+ID   V+ R++V+R L  +A ++IL HNHPSGN  PS AD 
Sbjct: 128 LFLNSKHQVLTFEALFRGSIDSASVHPRQVVKRALAHNAAALILCHNHPSGNTEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+G    +S      +
Sbjct: 188 VLTERLQEALELIDVRVLDHFIVGDGEPLSMAERGWM 224


>gi|323160906|gb|EFZ46830.1| DNA repair protein RadC family protein [Escherichia coli E128010]
          Length = 158

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|16129943|ref|NP_416506.1| CP4-44 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|89108821|ref|AP_002601.1| predicted DNA repair protein [Escherichia coli str. K-12 substr.
           W3110]
 gi|170081631|ref|YP_001730951.1| CP4-44 prophage; DNA repair protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|218558883|ref|YP_002391796.1| DNA repair protein; CP4-44 prophage [Escherichia coli S88]
 gi|218690065|ref|YP_002398277.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|218695627|ref|YP_002403294.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
 gi|238901193|ref|YP_002926989.1| CP4-44 prophage; putative DNA repair protein [Escherichia coli
           BW2952]
 gi|3025155|sp|P76362|YEES_ECOLI RecName: Full=UPF0758 protein yeeS
 gi|1736671|dbj|BAA15826.1| predicted DNA repair protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1788312|gb|AAC75063.1| CP4-44 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|169889466|gb|ACB03173.1| CP4-44 prophage; predicted DNA repair protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|218352359|emb|CAU98132.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
 gi|218365652|emb|CAR03388.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli S88]
 gi|218427629|emb|CAR08539.2| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|238860616|gb|ACR62614.1| CP4-44 prophage; predicted DNA repair protein [Escherichia coli
           BW2952]
 gi|260448897|gb|ACX39319.1| DNA repair protein RadC [Escherichia coli DH1]
 gi|315136634|dbj|BAJ43793.1| DNA repair protein, RadC family [Escherichia coli DH1]
          Length = 148

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 148


>gi|213418639|ref|ZP_03351705.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 167

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 71  IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 130

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 131 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 167


>gi|161525489|ref|YP_001580501.1| DNA repair protein RadC [Burkholderia multivorans ATCC 17616]
 gi|189349783|ref|YP_001945411.1| DNA repair protein [Burkholderia multivorans ATCC 17616]
 gi|160342918|gb|ABX16004.1| DNA repair protein RadC [Burkholderia multivorans ATCC 17616]
 gi|189333805|dbj|BAG42875.1| DNA repair protein [Burkholderia multivorans ATCC 17616]
          Length = 169

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   V+ RE+V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFLDTRHRLIDYAEMFRGTIDSAEVHPREVVKEALRLNAAAVIISHNHPSGNPEPSAADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  +++   DHII+      SF    +I
Sbjct: 133 AMTSQLRQALALVDVRTLDHIIVAGGTTTSFAERGLI 169


>gi|26250393|ref|NP_756433.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|26110823|gb|AAN83007.1|AE016769_122 Putative radC-like protein yeeS [Escherichia coli CFT073]
          Length = 148

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 148


>gi|73669792|ref|YP_305807.1| DNA repair protein RadC [Methanosarcina barkeri str. Fusaro]
 gi|121729469|sp|Q46A65|Y2303_METBF RecName: Full=UPF0758 protein Mbar_A2303
 gi|72396954|gb|AAZ71227.1| DNA replication and repair protein RadC [Methanosarcina barkeri
           str. Fusaro]
          Length = 229

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++ +EV S G+++   V+ RE+ +  L  S+ S+I++HNHPSG+P+PS  DI
Sbjct: 132 LCLDTKNQILKEEVVSIGSLNASIVHPREVFKSALMESSASVIMIHNHPSGDPSPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DHIIIG+  +VS K    +
Sbjct: 192 MVTEKMVEGGKLLGIDVLDHIIIGEGRYVSLKDEGFV 228


>gi|114762078|ref|ZP_01441546.1| DNA repair protein RadC [Pelagibaca bermudensis HTCC2601]
 gi|114545102|gb|EAU48105.1| DNA repair protein RadC [Roseovarius sp. HTCC2601]
          Length = 253

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 157 LFLDRKNVLIADEAQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSGADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I      L I +HDH++IG+   +SF+   ++
Sbjct: 217 EMTEQIRIAAEALGITLHDHLVIGRSRELSFRAEGLL 253


>gi|218707946|ref|YP_002415465.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           UMN026]
 gi|331650756|ref|ZP_08351784.1| putative DNA repair protein [Escherichia coli M718]
 gi|218435043|emb|CAR15996.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           UMN026]
 gi|323950625|gb|EGB46503.1| DNA repair protein RadC [Escherichia coli H252]
 gi|331051210|gb|EGI23259.1| putative DNA repair protein [Escherichia coli M718]
          Length = 163

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL 163


>gi|218510678|ref|ZP_03508556.1| DNA repair protein RadC [Rhizobium etli Brasil 5]
          Length = 274

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|170744786|ref|YP_001773441.1| DNA repair protein RadC [Methylobacterium sp. 4-46]
 gi|168199060|gb|ACA21007.1| DNA repair protein RadC [Methylobacterium sp. 4-46]
          Length = 247

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 81/97 (83%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+V+R LELSAT++ILVHNHPSG+P+PS ADI
Sbjct: 151 LFLDKRNRLIADEVQGRGTVDHTPVYPREVVRRALELSATALILVHNHPSGDPSPSQADI 210

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+    PL I+VHDHII+G+D   SFKGL++I
Sbjct: 211 RMTRDIVGAAEPLGIVVHDHIIVGRDGHASFKGLKLI 247


>gi|308188656|ref|YP_003932787.1| DNA repair protein radC [Pantoea vagans C9-1]
 gi|308059166|gb|ADO11338.1| DNA repair protein radC [Pantoea vagans C9-1]
          Length = 218

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  +    G+I+ V V+ REIV+  L+L+A ++IL HNHPSG   PS AD 
Sbjct: 122 LFLDNQHRVLRAQNMFSGSINSVEVHPREIVREALKLNAAALILAHNHPSGMAEPSRADR 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +       +I + DH++IG   +VSF     +
Sbjct: 182 EVTHKVSEACQLFDIRLLDHLVIGHGEYVSFAERGWL 218


>gi|191167170|ref|ZP_03028990.1| DNA repair protein, RadC family [Escherichia coli B7A]
 gi|190902827|gb|EDV62556.1| DNA repair protein, RadC family [Escherichia coli B7A]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLTHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|226942456|ref|YP_002797529.1| DNA repair protein RadC [Azotobacter vinelandii DJ]
 gi|259551855|sp|C1DI57|Y294_AZOVD RecName: Full=UPF0758 protein Avin_02940
 gi|226717383|gb|ACO76554.1| P-pantothenate cysteine ligase / P-pantothenoylcysteine
           decarboxylase [Azotobacter vinelandii DJ]
          Length = 224

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  +GT+D   VY R++++R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDAKHRVLAFEVLFQGTVDGASVYPRQVLKRALAHNAAALILTHNHPSGIAEPSQADF 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH I+G    +S      +
Sbjct: 188 SLTRRLKEALALVDVRVLDHFIVGDGEPLSMAEQGWL 224


>gi|121594972|ref|YP_986868.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|120607052|gb|ABM42792.1| DNA repair protein RadC [Acidovorax sp. JS42]
          Length = 168

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GTID   V+ RE+V++ L L+A ++++ HNHPSG+P PS AD 
Sbjct: 72  LFLDTRHRLIDYVEMFHGTIDSAEVHPREVVKQALRLNAAAVVVSHNHPSGSPEPSAADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+  +A  SF    +I
Sbjct: 132 ALTQRLREALGLVDVRVLDHIIVAGNATASFAERGLI 168


>gi|193069504|ref|ZP_03050458.1| DNA repair protein, RadC family [Escherichia coli E110019]
 gi|192957252|gb|EDV87701.1| DNA repair protein, RadC family [Escherichia coli E110019]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A++++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNASAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|91210173|ref|YP_540159.1| putative radC-like protein YeeS [Escherichia coli UTI89]
 gi|312966012|ref|ZP_07780238.1| DNA repair RadC family protein [Escherichia coli 2362-75]
 gi|91071747|gb|ABE06628.1| putative radC-like protein YeeS [Escherichia coli UTI89]
 gi|294490760|gb|ADE89516.1| DNA repair protein, RadC family [Escherichia coli IHE3034]
 gi|307627505|gb|ADN71809.1| putative DNA repair protein [Escherichia coli UM146]
 gi|312289255|gb|EFR17149.1| DNA repair RadC family protein [Escherichia coli 2362-75]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|78049584|ref|YP_365759.1| DNA repair protein RadC [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|123583963|sp|Q3BNA4|Y4028_XANC5 RecName: Full=UPF0758 protein XCV4028
 gi|78038014|emb|CAJ25759.1| DNA repair protein RadC [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 225

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VSF     +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSFAERGWL 224


>gi|238798812|ref|ZP_04642281.1| DNA repair protein radC [Yersinia mollaretii ATCC 43969]
 gi|238717320|gb|EEQ09167.1| DNA repair protein radC [Yersinia mollaretii ATCC 43969]
          Length = 222

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKANAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LMTTQVIKACSILDIRVLDHLVVGRGECVSFAERGWL 222


>gi|51891509|ref|YP_074200.1| DNA repair protein [Symbiobacterium thermophilum IAM 14863]
 gi|81692227|sp|Q67SI7|Y371_SYMTH RecName: Full=UPF0758 protein STH371
 gi|51855198|dbj|BAD39356.1| DNA repair protein [Symbiobacterium thermophilum IAM 14863]
          Length = 234

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +I  E  S GT+    V+ RE+ +  +  SA ++IL HNHPSG+P PS  D 
Sbjct: 136 ILLNAKNQVIDVECVSEGTLTASLVHPREVFKTAIRRSAHAVILAHNHPSGDPTPSREDR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH+++G+  + SF+   ++
Sbjct: 196 EITRRLVQAGRVIGIEVLDHLVVGQGGYTSFRERGLL 232


>gi|190891537|ref|YP_001978079.1| DNA repair protein [Rhizobium etli CIAT 652]
 gi|226736627|sp|B3PXW5|Y1935_RHIE6 RecName: Full=UPF0758 protein RHECIAT_CH0001935
 gi|190696816|gb|ACE90901.1| DNA repair protein [Rhizobium etli CIAT 652]
          Length = 274

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|170680081|ref|YP_001743141.1| RadC family DNA repair protein [Escherichia coli SMS-3-5]
 gi|170517799|gb|ACB15977.1| DNA repair protein, RadC family [Escherichia coli SMS-3-5]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADC 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|323945928|gb|EGB41970.1| DNA repair protein RadC [Escherichia coli H120]
          Length = 163

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL 163


>gi|331685379|ref|ZP_08385965.1| putative DNA repair protein [Escherichia coli H299]
 gi|323939165|gb|EGB35379.1| DNA repair protein RadC [Escherichia coli E482]
 gi|331077750|gb|EGI48962.1| putative DNA repair protein [Escherichia coli H299]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 158


>gi|288933007|ref|YP_003437066.1| DNA repair protein RadC [Klebsiella variicola At-22]
 gi|290511800|ref|ZP_06551168.1| DNA repair protein RadC [Klebsiella sp. 1_1_55]
 gi|288887736|gb|ADC56054.1| DNA repair protein RadC [Klebsiella variicola At-22]
 gi|289775590|gb|EFD83590.1| DNA repair protein RadC [Klebsiella sp. 1_1_55]
          Length = 221

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A ++IL HNHPSG+P PS AD 
Sbjct: 125 IFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH++IG+ A+VSF     I
Sbjct: 185 LITERVVKCCRFMEIRVLDHLVIGRGAYVSFAERGWI 221


>gi|26246178|ref|NP_752217.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|18265872|gb|AAL67345.1|AF447814_13 intergenic-region protein [Escherichia coli]
 gi|26106575|gb|AAN78761.1|AE016755_261 Putative radC-like protein yeeS [Escherichia coli CFT073]
          Length = 163

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|298382287|ref|ZP_06991884.1| radC-like protein yeeS [Escherichia coli FVEC1302]
 gi|298277427|gb|EFI18943.1| radC-like protein yeeS [Escherichia coli FVEC1302]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|261250535|ref|ZP_05943110.1| DNA repair protein RadC [Vibrio orientalis CIP 102891]
 gi|260939104|gb|EEX95091.1| DNA repair protein RadC [Vibrio orientalis CIP 102891]
          Length = 222

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GTID   VY RE+V+R LE +A ++IL HNHPSG   PS +D 
Sbjct: 126 LFLDNQHRVICGEPLFQGTIDAASVYPREVVKRSLEHNAAALILAHNHPSGVAEPSQSDR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   L  ++I V DH ++G    VSF     I
Sbjct: 186 RITRRITDALALVDIRVLDHFVVGDGEIVSFAERGWI 222


>gi|260845828|ref|YP_003223606.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
 gi|257760975|dbj|BAI32472.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
          Length = 158

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGRQVFSFAEHGLL 158


>gi|206579335|ref|YP_002236000.1| DNA repair protein RadC [Klebsiella pneumoniae 342]
 gi|238054489|sp|B5XTG5|Y116_KLEP3 RecName: Full=UPF0758 protein KPK_0116
 gi|206568393|gb|ACI10169.1| DNA repair protein RadC [Klebsiella pneumoniae 342]
          Length = 221

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A ++IL HNHPSG+P PS AD 
Sbjct: 125 IFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH++IG+ A+VSF     I
Sbjct: 185 LITERVVKCCRFMEIRVLDHLVIGRGAYVSFAERGWI 221


>gi|21244634|ref|NP_644216.1| DNA repair protein RadC [Xanthomonas axonopodis pv. citri str. 306]
 gi|25009022|sp|Q8PFR3|Y3915_XANAC RecName: Full=UPF0758 protein XAC3915
 gi|21110318|gb|AAM38752.1| DNA repair protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 225

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VSF     +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSFAERGWL 224


>gi|146309390|ref|YP_001189855.1| DNA repair protein RadC [Pseudomonas mendocina ymp]
 gi|166218789|sp|A4Y0K7|Y4376_PSEMY RecName: Full=UPF0758 protein Pmen_4376
 gi|145577591|gb|ABP87123.1| DNA replication and repair protein RadC [Pseudomonas mendocina ymp]
          Length = 224

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  RG+ID   VY R++V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDAKHRVLAFEVLFRGSIDSASVYPRQVVKRALANNAAAVILTHNHPSGVCEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  + + V DH I+G    +S   L  +
Sbjct: 188 VLTQRLKDALALVEVRVLDHFIVGDGEPLSMAELGWM 224


>gi|330503754|ref|YP_004380623.1| DNA repair protein RadC [Pseudomonas mendocina NK-01]
 gi|328918040|gb|AEB58871.1| DNA repair protein RadC [Pseudomonas mendocina NK-01]
          Length = 168

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++   HNHPSGNP PS AD 
Sbjct: 72  LFLDAKHRLIQYVEMFRGTIDSASVYPREVVKEALRLNAAAVFFAHNHPSGNPEPSQADK 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++   DHII+     VSF  L ++
Sbjct: 132 VLTQRLKEALALVDVRSLDHIIVAGQRTVSFAELGLL 168


>gi|319654115|ref|ZP_08008205.1| hypothetical protein HMPREF1013_04825 [Bacillus sp. 2_A_57_CT2]
 gi|317394200|gb|EFV74948.1| hypothetical protein HMPREF1013_04825 [Bacillus sp. 2_A_57_CT2]
          Length = 232

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N++I  +    G ++   V+ REI    ++ ++ SII+ H+HPSG+P PS  DI
Sbjct: 136 LFLNSKNVVIGKKTIFVGELNSCNVHPREIFHEAIQRTSASIIVAHSHPSGDPTPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +      + I V DH+IIG   ++S K    +
Sbjct: 196 EMTKRLREAGELIGIPVLDHVIIGNGRYISLKEKGYL 232


>gi|74318606|ref|YP_316346.1| DNA repair protein RadC [Thiobacillus denitrificans ATCC 25259]
 gi|123611212|sp|Q3SFR5|Y2588_THIDA RecName: Full=UPF0758 protein Tbd_2588
 gi|74058101|gb|AAZ98541.1| DNA repair protein RadC [Thiobacillus denitrificans ATCC 25259]
          Length = 224

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +IA E   RGT+    VY REIV+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 VFLNAQNRVIAVEELFRGTLTQTSVYPREIVKRALAHNAAAMILAHNHPSGVNEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DH II   + +SF     +
Sbjct: 188 SLTRRLAEALALVDIRVLDHFIIAGASALSFAEAGHL 224


>gi|15603017|ref|NP_246089.1| DNA repair protein RadC [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13431801|sp|P57913|Y1152_PASMU RecName: Full=UPF0758 protein PM1152
 gi|12721500|gb|AAK03236.1| RadC [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 224

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   ++ REI++  L  +A ++IL HNHPSGNP PS +D 
Sbjct: 128 LFLDNQHRLIKQEEMFLGTINCTTIHPREIIKSALFCNAAALILAHNHPSGNPEPSASDK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      + I + DH +IGK  + SF   R++
Sbjct: 188 MVTTKIQAAAELVEIRILDHFVIGKGCYYSFAENRLL 224


>gi|304407507|ref|ZP_07389159.1| DNA repair protein RadC [Paenibacillus curdlanolyticus YK9]
 gi|304343458|gb|EFM09300.1| DNA repair protein RadC [Paenibacillus curdlanolyticus YK9]
          Length = 229

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++A ++ S GT++   V+ RE+ +  ++ S+ SII  HNHPSG+P PS  DI
Sbjct: 133 LFLNTKNQVVAKDMLSVGTLNASLVHPREVFREAIKRSSASIICAHNHPSGDPTPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I V DH+IIG   FVS K   ++
Sbjct: 193 SLTRRLAEAGELIGIEVLDHLIIGDGKFVSLKEQGLL 229


>gi|302389307|ref|YP_003825128.1| DNA replication and repair protein RadC [Thermosediminibacter
           oceani DSM 16646]
 gi|302199935|gb|ADL07505.1| DNA replication and repair protein RadC [Thermosediminibacter
           oceani DSM 16646]
          Length = 237

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +I+ E  S G+++   V+ RE+ +  ++ S+ +IILVHNHPSG+P PS  DI
Sbjct: 141 ILLNVKNRVISVEDISIGSLNSSIVHPREVFKPAIKRSSAAIILVHNHPSGDPTPSREDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DH+IIG  ++VSFK   ++
Sbjct: 201 EITRRLVEAGRILGIDVLDHVIIGNPSYVSFKEKGLL 237


>gi|209693807|ref|YP_002261735.1| DNA repair protein RadC [Aliivibrio salmonicida LFI1238]
 gi|238058401|sp|B6EPP3|Y192_ALISL RecName: Full=UPF0758 protein VSAL_I0192
 gi|208007758|emb|CAQ77877.1| DNA repair protein RadC [Aliivibrio salmonicida LFI1238]
          Length = 224

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  EV   GTID   VY RE+V+R ++ +A +IIL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVLKGEVLFEGTIDAAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   +  ++I V DH +IG    VSF     I
Sbjct: 188 RITKRISDAVELVDIRVLDHFVIGDGEIVSFAERGWI 224


>gi|92115088|ref|YP_575016.1| DNA repair protein RadC [Chromohalobacter salexigens DSM 3043]
 gi|122419198|sp|Q1QT91|Y2972_CHRSD RecName: Full=UPF0758 protein Csal_2972
 gi|91798178|gb|ABE60317.1| DNA replication and repair protein RadC [Chromohalobacter
           salexigens DSM 3043]
          Length = 224

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E  S+GT+D   VY RE+ +R L L+A ++I  HNHPSG   PSDAD 
Sbjct: 128 LFLDTQHRVIRFETLSKGTLDSASVYPREVSRRALALNAGALIFAHNHPSGVAEPSDADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L   +I V DH ++G    VSF     +
Sbjct: 188 RITQRLSDALGLFDIRVLDHFVVGDGEVVSFAERGWL 224


>gi|311281126|ref|YP_003943357.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
 gi|308750321|gb|ADO50073.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
          Length = 160

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+ +PS AD 
Sbjct: 64  LYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALHFNAAAVILAHNHPSGDTSPSQADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G    +SF    ++
Sbjct: 124 TITQRLVQALQLVDIRVPDHLIVGGTQILSFAEHGLL 160


>gi|50119106|ref|YP_048273.1| DNA repair protein RadC [Pectobacterium atrosepticum SCRI1043]
 gi|73913734|sp|Q6DAV7|Y145_ERWCT RecName: Full=UPF0758 protein ECA0145
 gi|49609632|emb|CAG73065.1| DNA repair protein [Pectobacterium atrosepticum SCRI1043]
          Length = 221

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI+ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 125 LFLDNQHHVIRHQEMFVGTINSVEVHPREIVREALKANAAALILAHNHPSGKAEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+     L I V DH++IG   FVSF     I
Sbjct: 185 AITEQIVKACLLLEIRVLDHLVIGHGEFVSFAERGWI 221


>gi|330824214|ref|YP_004387517.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
 gi|321116516|dbj|BAJ72215.1| DNA repair protein RadC [Acidovorax sp. KKS102]
 gi|329309586|gb|AEB84001.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
          Length = 168

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   V+ RE+V++ L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 72  LFLDTRHRLIDYVEMFRGTIDAAEVHPREVVKQALRLNAAAVIVSHNHPSGNSEPSAADK 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  ++I   DH+I+      SF    ++
Sbjct: 132 AMTSQLRQALALVDIRTLDHVIVAGTRTTSFAERGLL 168


>gi|146278797|ref|YP_001168956.1| DNA repair protein RadC [Rhodobacter sphaeroides ATCC 17025]
 gi|145557038|gb|ABP71651.1| DNA repair protein RadC [Rhodobacter sphaeroides ATCC 17025]
          Length = 261

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS+ DI
Sbjct: 165 LFLDRKNVLIADEEQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSEQDI 224

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L I++HDH+I+G++  +SF+    +
Sbjct: 225 AMTGQIQDAAATLGIVLHDHLIVGRERELSFRAQGYL 261


>gi|222112697|ref|YP_002554961.1| DNA repair protein Radc [Acidovorax ebreus TPSY]
 gi|221732141|gb|ACM34961.1| DNA repair protein RadC [Acidovorax ebreus TPSY]
          Length = 169

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFLDSQHRLIEYTEMFRGTIDSASVYPRELVKEALRLNAAAVIVSHNHPSGNPEPSAADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +  +L  +++   DHI++   +  SF    +I
Sbjct: 133 ALTQRLKESLALVDVRTLDHIVVTGSSTTSFAERGLI 169


>gi|163793591|ref|ZP_02187566.1| DNA repair protein RadC [alpha proteobacterium BAL199]
 gi|159181393|gb|EDP65908.1| DNA repair protein RadC [alpha proteobacterium BAL199]
          Length = 229

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N LI DE Q RGT+DH P+Y RE+V+R LEL A+++I+VHNHPSG+P PS ADI
Sbjct: 133 LYLDRKNRLIRDERQGRGTVDHTPLYPREVVKRALELGASAVIVVHNHPSGDPTPSQADI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ L +I+HDH+I+ +    SF+   ++
Sbjct: 193 VVTRQLGEALSTLGLILHDHLIVARGGHTSFRSAGLL 229


>gi|24114260|ref|NP_708770.1| RADC family DNA repair protein [Shigella flexneri 2a str. 301]
 gi|30064313|ref|NP_838484.1| RADC family DNA repair protein [Shigella flexneri 2a str. 2457T]
 gi|24053414|gb|AAN44477.1| putative RADC family DNA repair protein [Shigella flexneri 2a str.
           301]
 gi|30042570|gb|AAP18294.1| putative RADC family DNA repair protein [Shigella flexneri 2a str.
           2457T]
 gi|281602347|gb|ADA75331.1| putative RADC family DNA repair protein [Shigella flexneri 2002017]
          Length = 163

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|157157651|ref|YP_001465824.1| RadC family DNA repair protein [Escherichia coli E24377A]
 gi|298378469|ref|ZP_06988353.1| radC-like protein yeeS [Escherichia coli FVEC1302]
 gi|157079681|gb|ABV19389.1| DNA repair protein, RadC family [Escherichia coli E24377A]
 gi|298280803|gb|EFI22304.1| radC-like protein yeeS [Escherichia coli FVEC1302]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL 158


>gi|320201859|gb|EFW76434.1| putative radC-like protein [Escherichia coli EC4100B]
          Length = 124

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 28  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 87

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 88  LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 124


>gi|170684134|ref|YP_001742412.1| RadC family DNA repair protein [Escherichia coli SMS-3-5]
 gi|170521852|gb|ACB20030.1| DNA repair protein, RadC family [Escherichia coli SMS-3-5]
          Length = 159

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+ +PS AD 
Sbjct: 63  LYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTSPSKADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G    +SF    ++
Sbjct: 123 TITQRLVQALQLVDIRVPDHLIVGGTQILSFAEHGLL 159


>gi|26247156|ref|NP_753196.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|331673519|ref|ZP_08374284.1| DNA repair protein, RADC family [Escherichia coli TA280]
 gi|26107557|gb|AAN79756.1|AE016759_30 Putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|307553028|gb|ADN45803.1| DNA repair protein [Escherichia coli ABU 83972]
 gi|331069313|gb|EGI40703.1| DNA repair protein, RADC family [Escherichia coli TA280]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|309704613|emb|CBJ03963.1| putative radC DNA repair protein [Escherichia coli ETEC H10407]
          Length = 148

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|296100494|ref|YP_003610640.1| DNA repair protein RadC [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295054953|gb|ADF59691.1| DNA repair protein RadC [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 222

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++L+A  +IL HNHPSG   PS AD 
Sbjct: 126 IFLDNRNRVLKHSHLFSGTLSHVEVHPREIVREAIKLNAAGVILAHNHPSGCAEPSRADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I+     ++I V DH+IIG+  ++SF     I
Sbjct: 186 EITDRIVKCCQFMDIRVLDHLIIGRGEYLSFAEHGWI 222


>gi|325928297|ref|ZP_08189499.1| DNA replication and repair protein RadC [Xanthomonas perforans
           91-118]
 gi|325541334|gb|EGD12874.1| DNA replication and repair protein RadC [Xanthomonas perforans
           91-118]
          Length = 243

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 146 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VSF     +
Sbjct: 206 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSFAERGWL 242


>gi|221640666|ref|YP_002526928.1| DNA repair protein RadC [Rhodobacter sphaeroides KD131]
 gi|221161447|gb|ACM02427.1| DNA repair protein [Rhodobacter sphaeroides KD131]
          Length = 254

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PSD D+
Sbjct: 158 LYLDRKNVLIADEEQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSDQDV 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L I++HDH++IG+   VSF+G   +
Sbjct: 218 AMTAQIQEAAATLGIVLHDHLVIGRGREVSFRGQGYL 254


>gi|218692437|ref|YP_002400649.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|218702808|ref|YP_002410437.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
 gi|254162884|ref|YP_003045992.1| putative DNA repair protein [Escherichia coli B str. REL606]
 gi|218372794|emb|CAR20673.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           IAI39]
 gi|218430001|emb|CAR10981.2| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|253974785|gb|ACT40456.1| predicted DNA repair protein [Escherichia coli B str. REL606]
          Length = 148

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 148


>gi|311278018|ref|YP_003940249.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
 gi|308747213|gb|ADO46965.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
          Length = 160

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E+   G+I    V+ RE+V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 64  LYLNQQNQLIAHEILFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G    +SF    ++
Sbjct: 124 TITQRLVQALQLIDIRVPDHLIVGGSQILSFAEHGLL 160


>gi|256024477|ref|ZP_05438342.1| putative radC-like protein YeeS [Escherichia sp. 4_1_40B]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|268593307|ref|ZP_06127528.1| DNA repair protein RadC [Providencia rettgeri DSM 1131]
 gi|291311004|gb|EFE51457.1| DNA repair protein RadC [Providencia rettgeri DSM 1131]
          Length = 239

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  E   +GT++ V V+ REI++  ++++A  IIL HNHPSGNP PS AD 
Sbjct: 143 IFLNNKNQIICHEELFKGTLNKVEVHPREIIRFAIKMNANGIILAHNHPSGNPEPSTADR 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I + DH ++G    VSF     +
Sbjct: 203 QVTERIQRACAIMGIKLLDHFVVGHKQCVSFVERGWL 239


>gi|20090827|ref|NP_616902.1| DNA repair protein RadC [Methanosarcina acetivorans C2A]
 gi|25009026|sp|Q8TPD4|Y1979_METAC RecName: Full=UPF0758 protein MA_1979
 gi|19915895|gb|AAM05382.1| DNA repair protein [Methanosarcina acetivorans C2A]
          Length = 229

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N ++ +EV S G+++   V+ RE+ +  L  S+ S+I+VHNHPSG+P+PS  DI
Sbjct: 132 LYLDTKNQILKEEVVSIGSLNASIVHPREVFKSALLESSASVIMVHNHPSGDPSPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I + DHIIIG   +VS K    +
Sbjct: 192 MVTEKLVEGGKLLGIDILDHIIIGDGRYVSLKDEGFV 228


>gi|300905935|ref|ZP_07123664.1| putative DNA repair protein RadC [Escherichia coli MS 84-1]
 gi|300402241|gb|EFJ85779.1| putative DNA repair protein RadC [Escherichia coli MS 84-1]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGEPLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|123440463|ref|YP_001004457.1| DNA repair protein RadC [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166218800|sp|A1JHX2|Y063_YERE8 RecName: Full=UPF0758 protein YE0063
 gi|122087424|emb|CAL10205.1| putative DNA repair protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 222

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V ++ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTISSVEIHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LMTTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 222


>gi|296104052|ref|YP_003614198.1| putative DNA repair protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295058511|gb|ADF63249.1| putative DNA repair protein [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LIA E    GTI+   V+ RE+V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 62  LYLDNQNQLIAHETLFTGTINRTEVHPREVVKRALHFNAAAVILAHNHPSGETTPSQADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 ALTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL 158


>gi|313648066|gb|EFS12512.1| DNA repair RadC family protein [Shigella flexneri 2a str. 2457T]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|218696658|ref|YP_002404325.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
 gi|218353390|emb|CAU99429.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
          Length = 148

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|56415619|ref|YP_152694.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364546|ref|YP_002144183.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|73913739|sp|Q5PC30|YICR_SALPA RecName: Full=UPF0758 protein yicR
 gi|238690754|sp|B5BI12|YICR_SALPK RecName: Full=UPF0758 protein yicR
 gi|56129876|gb|AAV79382.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197096023|emb|CAR61610.1| putative DNA repair protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 221

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDVQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|21242914|ref|NP_642496.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108411|gb|AAM37032.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 169

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   V+ RE+V+  L  +A ++IL HNHPSG+P PS AD 
Sbjct: 73  LFLDTQHRLIEYTEMFRGTIDSASVHPREVVKEALRTNAAAVILAHNHPSGHPEPSTADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++   DHII+   A  SF    ++
Sbjct: 133 ALTRQLKAALELVDVRTLDHIIVAGGANTSFAERGLL 169


>gi|315296395|gb|EFU55695.1| DNA repair protein RadC family protein [Escherichia coli MS 16-3]
          Length = 159

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 63  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 123 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 159


>gi|294675779|ref|YP_003576394.1| DNA repair protein RadC [Rhodobacter capsulatus SB 1003]
 gi|294474599|gb|ADE83987.1| DNA repair protein RadC [Rhodobacter capsulatus SB 1003]
          Length = 254

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL A+++ILVHNHPSG+P PS ADI
Sbjct: 158 LFLDRKNLLIADEEQARGTVDHVPVYPREVVKRALELDASALILVHNHPSGDPTPSQADI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L +++HDH++IGK   +SF+   ++
Sbjct: 218 AMTDQIRHAAEALGLVLHDHLVIGKGRELSFRAEGLL 254


>gi|110640540|ref|YP_668268.1| RadC-like DNA repair protein [Escherichia coli 536]
 gi|191171181|ref|ZP_03032731.1| DNA repair protein, RadC family [Escherichia coli F11]
 gi|28316258|emb|CAD66203.1| hypothetical protein [Escherichia coli]
 gi|110342132|gb|ABG68369.1| RadC-like DNA repair protein [Escherichia coli 536]
 gi|190908481|gb|EDV68070.1| DNA repair protein, RadC family [Escherichia coli F11]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|331654132|ref|ZP_08355132.1| putative DNA repair protein [Escherichia coli M718]
 gi|331047514|gb|EGI19591.1| putative DNA repair protein [Escherichia coli M718]
          Length = 163

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 163


>gi|309704104|emb|CBJ03451.1| putative radC-like protein [Escherichia coli ETEC H10407]
          Length = 158

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 158


>gi|332159686|ref|YP_004296263.1| DNA repair protein RadC [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318603785|emb|CBY25283.1| DNA repair protein RadC [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325663916|gb|ADZ40560.1| DNA repair protein RadC [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330859989|emb|CBX70317.1| DNA repair protein radC homolog [Yersinia enterocolitica W22703]
          Length = 222

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V ++ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTISSVEIHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LMTTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 222


>gi|254515838|ref|ZP_05127898.1| DNA repair protein RadC family [gamma proteobacterium NOR5-3]
 gi|219675560|gb|EED31926.1| DNA repair protein RadC family [gamma proteobacterium NOR5-3]
          Length = 224

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+  +    GT+D   VY RE+V R L+  A +IIL HNHPSG   PS AD 
Sbjct: 128 LFLDSQHRLLHCDDLFLGTLDGAAVYPREVVVRALQYRAAAIILAHNHPSGLTQPSTADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+G+    SF    +I
Sbjct: 188 RITQRLCDALALVDVPVLDHVIVGRGKCYSFAEAGLI 224


>gi|33151902|ref|NP_873255.1| DNA repair protein RadC [Haemophilus ducreyi 35000HP]
 gi|38372438|sp|Q7VN51|Y732_HAEDU RecName: Full=UPF0758 protein HD_0732
 gi|33148123|gb|AAP95644.1| DNA repair protein [Haemophilus ducreyi 35000HP]
          Length = 223

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E    GTI+   V+ REI++  L+ +A +II+ HNHPSGN   S AD 
Sbjct: 124 LFLDNQNRLIKKEKMFYGTINQATVHPREIIKEALKCNAAAIIVAHNHPSGNCTASQADR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ I    + + +   DHII+GK ++ SF+  R 
Sbjct: 184 QLTQKIKAACHLVEVRFVDHIIVGKGSYFSFEEERF 219


>gi|313109023|ref|ZP_07794996.1| RadC-like protein [Pseudomonas aeruginosa 39016]
 gi|310881498|gb|EFQ40092.1| RadC-like protein [Pseudomonas aeruginosa 39016]
          Length = 169

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  + LI       GTID   VY RE+V+  L L+A ++++ HNHPSGNP PS AD 
Sbjct: 73  LFMDTRHRLIEYREMFHGTIDGASVYPREVVKEALRLNAAAVVVSHNHPSGNPEPSAADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+  +   SF    +I
Sbjct: 133 ALTQRLKEALGLVDVRVLDHIIVAGNETASFAEHGLI 169


>gi|301304730|ref|ZP_07210837.1| putative DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|300839961|gb|EFK67721.1| putative DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|315252324|gb|EFU32292.1| putative DNA repair protein RadC [Escherichia coli MS 85-1]
          Length = 158

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGEPLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|218561228|ref|YP_002394141.1| DNA repair protein; CP4-44 prophage [Escherichia coli S88]
 gi|218367997|emb|CAR05797.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli S88]
          Length = 148

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|194426265|ref|ZP_03058820.1| DNA repair protein, RadC family [Escherichia coli B171]
 gi|194415573|gb|EDX31840.1| DNA repair protein, RadC family [Escherichia coli B171]
 gi|323161557|gb|EFZ47445.1| DNA repair protein RadC family protein [Escherichia coli E128010]
          Length = 158

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADQ 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|91211289|ref|YP_541275.1| hypothetical protein UTI89_C2276 [Escherichia coli UTI89]
 gi|91213942|ref|YP_543928.1| hypothetical protein UTI89_C4994 [Escherichia coli UTI89]
 gi|110644738|ref|YP_672468.1| putative DNA repair protein [Escherichia coli 536]
 gi|191170846|ref|ZP_03032398.1| DNA repair protein, RadC family [Escherichia coli F11]
 gi|23954299|emb|CAD42098.1| hypothetical protein [Escherichia coli]
 gi|91072863|gb|ABE07744.1| hypothetical protein UTI89_C2276 [Escherichia coli UTI89]
 gi|91075516|gb|ABE10397.1| hypothetical protein UTI89_C4994 [Escherichia coli UTI89]
 gi|110346330|gb|ABG72567.1| putative DNA repair protein [Escherichia coli 536]
 gi|190909070|gb|EDV68657.1| DNA repair protein, RadC family [Escherichia coli F11]
 gi|307626452|gb|ADN70756.1| putative DNA repair protein [Escherichia coli UM146]
 gi|307629456|gb|ADN73760.1| putative DNA repair protein [Escherichia coli UM146]
 gi|330907975|gb|EGH36494.1| putative radC-like protein yeeS [Escherichia coli AA86]
          Length = 158

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|323152386|gb|EFZ38674.1| DNA repair radC domain protein [Escherichia coli EPECa14]
          Length = 148

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|306814130|ref|ZP_07448300.1| putative DNA repair protein [Escherichia coli NC101]
 gi|331656222|ref|ZP_08357184.1| intergenic-region protein [Escherichia coli TA206]
 gi|305852517|gb|EFM52966.1| putative DNA repair protein [Escherichia coli NC101]
 gi|307552078|gb|ADN44853.1| putative radC-like protein [Escherichia coli ABU 83972]
 gi|331054470|gb|EGI26479.1| intergenic-region protein [Escherichia coli TA206]
          Length = 158

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|218672510|ref|ZP_03522179.1| DNA repair protein RadC [Rhizobium etli GR56]
          Length = 274

 Score =  134 bits (339), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|300824031|ref|ZP_07104152.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|300523421|gb|EFK44490.1| putative DNA repair protein RadC [Escherichia coli MS 119-7]
          Length = 158

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|218698082|ref|YP_002405749.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
 gi|218354814|emb|CAV01931.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
          Length = 148

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|153870452|ref|ZP_01999852.1| DNA repair protein RadC [Beggiatoa sp. PS]
 gi|152073088|gb|EDN70154.1| DNA repair protein RadC [Beggiatoa sp. PS]
          Length = 242

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTID   VY RE+V+  L+ +A ++IL HNHPSG   PS+ADI
Sbjct: 146 LFLDNKHRVIKFEELFYGTIDGASVYPREVVKHTLQWNAAALILAHNHPSGVAEPSEADI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   L+ +++ V DH +IG    VS     +I
Sbjct: 206 SITQRLREALSLIDVRVLDHFVIGDGYCVSLMERGLI 242


>gi|332112547|gb|EGJ12340.1| hypothetical protein RBXJA2T_18503 [Rubrivivax benzoatilyticus JA2]
          Length = 225

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GT+    VY RE+ +R L L+A ++IL HNHPSG   PS AD 
Sbjct: 129 LFLDSQHRLIVMEEMFHGTLTQTSVYPREVARRALALNAGAVILAHNHPSGVAEPSRADE 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  L++ V DH+++G+   VS     ++
Sbjct: 189 FLTQTLRQALQLLDVRVLDHLVVGRGQVVSMAERGLV 225


>gi|15801143|ref|NP_287160.1| RadC family DNA repair protein [Escherichia coli O157:H7 EDL933]
 gi|12514552|gb|AAG55772.1|AE005313_7 putative DNA repair protein, RADC family [Escherichia coli O157:H7
           str. EDL933]
          Length = 158

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETXFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|218682712|ref|ZP_03530313.1| DNA repair protein RadC [Rhizobium etli CIAT 894]
          Length = 278

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 182 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAMILVHNHPSGDPTPSRADI 241

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDH+IIGKD  VS KGL+++
Sbjct: 242 DMTKVIIDAAKALDITVHDHVIIGKDGHVSLKGLKLM 278


>gi|77464752|ref|YP_354256.1| DNA repair protein RadC [Rhodobacter sphaeroides 2.4.1]
 gi|77389170|gb|ABA80355.1| DNA repair protein [Rhodobacter sphaeroides 2.4.1]
          Length = 254

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PSD D+
Sbjct: 158 LYLDRKNVLIADEEQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSDQDV 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I    + L I++HDH++IG+   VSF+G   +
Sbjct: 218 AMTAQIQEAASTLGIVLHDHLVIGRGREVSFRGQGYL 254


>gi|153833510|ref|ZP_01986177.1| DNA repair protein [Vibrio harveyi HY01]
 gi|148870161|gb|EDL69102.1| DNA repair protein [Vibrio harveyi HY01]
          Length = 157

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|197334055|ref|YP_002154894.1| DNA repair protein RadC [Vibrio fischeri MJ11]
 gi|238690291|sp|B5FFF6|Y123_VIBFM RecName: Full=UPF0758 protein VFMJ11_0123
 gi|197315545|gb|ACH64992.1| DNA repair protein RadC [Vibrio fischeri MJ11]
          Length = 224

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+   GTID   VY RE+V+R ++ +A +IIL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVLKGEILFEGTIDAAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   +  ++I V DH +IG    VSF     I
Sbjct: 188 RITKRISDAVELVDIRVLDHFVIGDGEIVSFAERGWI 224


>gi|157156526|ref|YP_001464352.1| RadC family DNA repair protein [Escherichia coli E24377A]
 gi|157078556|gb|ABV18264.1| DNA repair protein, RadC family [Escherichia coli E24377A]
          Length = 158

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVIPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 158


>gi|238794408|ref|ZP_04638019.1| DNA repair protein radC [Yersinia intermedia ATCC 29909]
 gi|238726309|gb|EEQ17852.1| DNA repair protein radC [Yersinia intermedia ATCC 29909]
          Length = 222

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 222


>gi|323497063|ref|ZP_08102086.1| hypothetical protein VISI1226_16688 [Vibrio sinaloensis DSM 21326]
 gi|323317907|gb|EGA70895.1| hypothetical protein VISI1226_16688 [Vibrio sinaloensis DSM 21326]
          Length = 214

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + +I+ E   +GTID   VY RE+V+R LE +A ++I+ HNHPSG   PS +D 
Sbjct: 118 LYLDNQHRVISGESLFQGTIDAASVYPREVVKRSLEHNAAAVIIAHNHPSGVAEPSQSDR 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   L  ++I + DH ++G    VSF     I
Sbjct: 178 RITRRISDALALVDIRILDHFVVGDGEIVSFAERGWI 214


>gi|86357475|ref|YP_469367.1| DNA repair protein RadC [Rhizobium etli CFN 42]
 gi|123512146|sp|Q2K946|Y1848_RHIEC RecName: Full=UPF0758 protein RHE_CH01848
 gi|86281577|gb|ABC90640.1| DNA repair protein [Rhizobium etli CFN 42]
          Length = 274

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|238789557|ref|ZP_04633341.1| DNA repair protein radC [Yersinia frederiksenii ATCC 33641]
 gi|238722310|gb|EEQ13966.1| DNA repair protein radC [Yersinia frederiksenii ATCC 33641]
          Length = 235

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 139 MFLDNQHRVIRHEEMFTGTISSVEVHPREIVRAALKVNAAALILAHNHPSGKAEPSQADR 198

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  ++   + L+I V DH+++G+   VSF     +
Sbjct: 199 LMTTQVVKACSLLDIRVLDHLVVGRGECVSFAERGWL 235


>gi|218560008|ref|YP_002392921.1| DNA repair protein; CP4-44 prophage [Escherichia coli S88]
 gi|218366777|emb|CAR04544.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli S88]
          Length = 148

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNKLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|188532227|ref|YP_001906024.1| DNA repair protein RadC [Erwinia tasmaniensis Et1/99]
 gi|188027269|emb|CAO95112.1| DNA repair protein RadC [Erwinia tasmaniensis Et1/99]
          Length = 223

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F D  + +I       GT++ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 127 IFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALILAHNHPSGLAEPSRADR 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+     +NI V DH++IG+  +VSF     +
Sbjct: 187 DITQQIVHACALMNIRVLDHMVIGRGEYVSFAERGWM 223


>gi|225175173|ref|ZP_03729169.1| DNA repair protein RadC [Dethiobacter alkaliphilus AHT 1]
 gi|225169349|gb|EEG78147.1| DNA repair protein RadC [Dethiobacter alkaliphilus AHT 1]
          Length = 232

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N ++  E  S G+++   V+ RE+ +  +  +  SIIL+HNHPSG+P PS  D+
Sbjct: 133 IMLDTKNKVLGIEEISIGSLNTSLVHPREVFRPAIRKACASIILIHNHPSGDPTPSREDL 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DHIIIG   F+SF+   ++
Sbjct: 193 DVTRRLREAGRLIGIEILDHIIIGDGKFISFREKGLL 229


>gi|152972484|ref|YP_001337630.1| DNA repair protein RadC [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238897079|ref|YP_002921825.1| DNA repair protein RadC [Klebsiella pneumoniae NTUH-K2044]
 gi|329996935|ref|ZP_08302632.1| DNA repair protein RadC [Klebsiella sp. MS 92-3]
 gi|166218784|sp|A6TFM9|Y3939_KLEP7 RecName: Full=UPF0758 protein KPN78578_39390
 gi|150957333|gb|ABR79363.1| DNA repair protein RadC [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238549407|dbj|BAH65758.1| DNA repair protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328539225|gb|EGF65254.1| DNA repair protein RadC [Klebsiella sp. MS 92-3]
          Length = 221

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A ++IL HNHPSG+P PS AD 
Sbjct: 125 IFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I V DH++IG+ A+VSF     I
Sbjct: 185 LITERVIKCCRFMEIRVLDHLVIGRGAYVSFAERGWI 221


>gi|213425229|ref|ZP_03357979.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 198

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+  EIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 102 IFLDAQHRVLQHSRLFSGTLNHVEVHPCEIVREAIKLNASAVILAHNHPSGCAEPSKADK 161

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 162 LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 198


>gi|91772435|ref|YP_565127.1| DNA repair protein RadC [Methanococcoides burtonii DSM 6242]
 gi|121684487|sp|Q12YU9|Y382_METBU RecName: Full=UPF0758 protein Mbur_0382
 gi|91711450|gb|ABE51377.1| DNA repair protein RadC [Methanococcoides burtonii DSM 6242]
          Length = 229

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N +I +EV S G+++   V+ RE+ +  L  S+ S+IL HNHPSG+P PS  DI
Sbjct: 132 LYLDTKNNIIKEEVISIGSLNANIVHPREVFKSALMESSASVILTHNHPSGDPAPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DH+IIG   +VS K    I
Sbjct: 192 AVTEKLVEGGKILGISVLDHVIIGDGRYVSLKEEGYI 228


>gi|86146760|ref|ZP_01065080.1| DNA repair protein [Vibrio sp. MED222]
 gi|85835410|gb|EAQ53548.1| DNA repair protein [Vibrio sp. MED222]
          Length = 156

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI  E   +GTID   VY RE+V+  L+ +A ++I  HNHPSG+P PS AD 
Sbjct: 61  MLLDNQHRLIEFEELFQGTIDAASVYPREVVKTALKANAAAVIFAHNHPSGDPEPSQADK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHI++G +   SF     +
Sbjct: 121 RITTRLQDALALIDVRVLDHIVVG-EQCTSFAERGWL 156


>gi|262040687|ref|ZP_06013925.1| DNA repair protein RadC [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042051|gb|EEW43084.1| DNA repair protein RadC [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 221

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A ++IL HNHPSG+P PS AD 
Sbjct: 125 IFLDNQNRVLKHSRLFSGTLSHVEVHPREIVREAIKVNAAAVILAHNHPSGSPEPSQADR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I V DH++IG+ A+VSF     I
Sbjct: 185 LITERVIKCCRFMEIRVLDHLVIGRGAYVSFAERGWI 221


>gi|323969877|gb|EGB65155.1| DNA repair protein RadC [Escherichia coli TA007]
          Length = 158

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|315618026|gb|EFU98618.1| DNA repair radC domain protein [Escherichia coli 3431]
          Length = 108

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 12  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 71

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 72  LITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL 108


>gi|144897615|emb|CAM74479.1| DNA repair protein RadC [Magnetospirillum gryphiswaldense MSR-1]
          Length = 237

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE+Q +GT+DH P+Y RE+V+R L+L+A++II+VHNHPSG+P PS ADI
Sbjct: 141 LFLDRKNVLIADELQGQGTVDHTPLYPREVVKRALDLNASAIIMVHNHPSGDPAPSRADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ +   L  + I+VHDH+IIG+   VSFK   ++
Sbjct: 201 DMTKMVANALKGVGIVVHDHLIIGRKGHVSFKAQGLL 237


>gi|327192095|gb|EGE59073.1| DNA repair protein RadC [Rhizobium etli CNPAF512]
          Length = 274

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEV  RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 178 LFLDKRNVLIADEVHGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 237

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 238 DMTKVIIEAAKALDITVHDHIIIGKDGHVSLKGLKLI 274


>gi|134298847|ref|YP_001112343.1| DNA repair protein RadC [Desulfotomaculum reducens MI-1]
 gi|134051547|gb|ABO49518.1| DNA replication and repair protein RadC [Desulfotomaculum reducens
           MI-1]
          Length = 231

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I  E  S GT++   V+ RE+ ++ +  SA ++ILVHNHPSG+P PS  DI
Sbjct: 135 LLLNTKNHVIGKETISIGTLNSSMVHPRELFKQAIRRSAAAVILVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +I     + I V DHI++G D F S K   +I
Sbjct: 195 SLTKRLIEAGEIIGIDVLDHIVLGFDKFTSLKSKGLI 231


>gi|218706553|ref|YP_002414072.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           UMN026]
 gi|218433650|emb|CAR14565.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           UMN026]
          Length = 148

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|260767607|ref|ZP_05876543.1| DNA repair protein RadC [Vibrio furnissii CIP 102972]
 gi|260617507|gb|EEX42690.1| DNA repair protein RadC [Vibrio furnissii CIP 102972]
          Length = 157

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|261341753|ref|ZP_05969611.1| hypothetical protein ENTCAN_08232 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316121|gb|EFC55059.1| DNA repair protein RadC [Enterobacter cancerogenus ATCC 35316]
          Length = 221

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++++A  +IL HNHPSG   PS AD 
Sbjct: 125 IFLDNKNRVLKHCHLFSGTLSHVEVHPREIVREAIKVNAAGVILAHNHPSGCAEPSRADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II     ++I V DH+IIG+  ++SF     I
Sbjct: 185 EITKRIIKCCQIMDIRVLDHLIIGRGEYLSFAEHGWI 221


>gi|56964380|ref|YP_176111.1| DNA repair protein RadC [Bacillus clausii KSM-K16]
 gi|73913732|sp|Q5WER0|Y2615_BACSK RecName: Full=UPF0758 protein ABC2615
 gi|56910623|dbj|BAD65150.1| DNA repair protein RadC [Bacillus clausii KSM-K16]
          Length = 230

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +  L+ S+ S+I +HNHPSG+P+PS  DI
Sbjct: 130 LYLNTKNHVIKQKTLFIGSLNASIVHPREVFKEALQSSSASVICLHNHPSGDPSPSPEDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ +      L I + DHII+G   F+S K    
Sbjct: 190 SVTKRLRQAGAILGIELLDHIIVGDGCFISLKERGF 225


>gi|56459351|ref|YP_154632.1| hypothetical protein IL0240 [Idiomarina loihiensis L2TR]
 gi|73913736|sp|Q5QZB4|Y240_IDILO RecName: Full=UPF0758 protein IL0240
 gi|56178361|gb|AAV81083.1| RadC [Idiomarina loihiensis L2TR]
          Length = 224

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + L+  E   +GTI+  PVY RE+++  ++ +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRLLRYEELFQGTINAAPVYPREVIKLVMQYNAAAVILAHNHPSGVAEPSQADQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH ++G    +SF    ++
Sbjct: 188 RVTERVKKALTLIDVALLDHFVVGAGDPISFAERGLL 224


>gi|254241654|ref|ZP_04934976.1| DNA repair protein RadC [Pseudomonas aeruginosa 2192]
 gi|126195032|gb|EAZ59095.1| DNA repair protein RadC [Pseudomonas aeruginosa 2192]
          Length = 169

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  + LI      RGTID   VY RE V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFMDTQHRLIEYAEMFRGTIDGASVYPRERVKEALRLNAAAVIVSHNHPSGNPEPSGADR 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+      SF    +I
Sbjct: 133 ALTQRLKEALGLVDVRVLDHVIVAGTDTTSFAERGLI 169


>gi|117919701|ref|YP_868893.1| DNA repair protein RadC [Shewanella sp. ANA-3]
 gi|117612033|gb|ABK47487.1| DNA repair protein RadC [Shewanella sp. ANA-3]
          Length = 169

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A ++I  HNHPSGN  PS AD 
Sbjct: 73  LFLDSQHRLIEYTEMFRGTIDSASVYPREVVKEALRLNAAAVIFSHNHPSGNSEPSRADE 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++   DH+I+     +SF    +I
Sbjct: 133 AITNRLKEALALVDVRSLDHVIVAGSDTMSFAERGLI 169


>gi|293390968|ref|ZP_06635302.1| DNA repair protein RadC [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951502|gb|EFE01621.1| DNA repair protein RadC [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 219

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A +IIL HNHPSG   PS +D 
Sbjct: 123 LFLDNQHRLIKQERLFLGTINKAMVYPREIIKEALACNAAAIILAHNHPSGVAEPSISDK 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I    + ++I V DH +IG   + SF    ++
Sbjct: 183 QITDTIRQAADLVDIRVLDHFVIGNGRYFSFAEQNLL 219


>gi|254692435|emb|CAR48078.1| hypothetical protein [Escherichia coli]
          Length = 148

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADQ 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|153800936|ref|ZP_01955522.1| DNA repair protein [Vibrio cholerae MZO-3]
 gi|124123527|gb|EAY42270.1| DNA repair protein [Vibrio cholerae MZO-3]
          Length = 157

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDNCTSFAERGWL 157


>gi|328543235|ref|YP_004303344.1| DNA repair protein RadC [Polymorphum gilvum SL003B-26A1]
 gi|326412981|gb|ADZ70044.1| DNA repair protein RadC [Polymorphum gilvum SL003B-26A1]
          Length = 236

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+++R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 140 LFLDKRNGLIADEVQQRGTVDHTPVYPREVIRRALELSATAVILVHNHPSGDPTPSRADI 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+    PL I VHDHII+G++  VSF+GL++I
Sbjct: 200 QMTRQIVDIAKPLGIEVHDHIIVGREGQVSFRGLQLI 236


>gi|222148674|ref|YP_002549631.1| DNA repair protein RadC [Agrobacterium vitis S4]
 gi|221735660|gb|ACM36623.1| DNA repair protein [Agrobacterium vitis S4]
          Length = 278

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 182 LFLDKRNTLIADEVQGRGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 241

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDH+IIGK    S KGLR+I
Sbjct: 242 EMTKTIIDTAKPLGITVHDHVIIGKQGHASLKGLRLI 278


>gi|242239772|ref|YP_002987953.1| DNA repair protein RadC [Dickeya dadantii Ech703]
 gi|242131829|gb|ACS86131.1| DNA repair protein RadC [Dickeya dadantii Ech703]
          Length = 169

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD H+ LI       GTID   VY RE+V+  L L+A ++IL HNHPSGNP PS AD 
Sbjct: 73  LFLDTHHQLIEYREMFHGTIDSASVYPREVVKEALRLNAAAVILSHNHPSGNPEPSSADK 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  + +   DH+I+     VSF    +I
Sbjct: 133 ALTQRLKEALGLVEVRTLDHVIVAGADTVSFAERGLI 169


>gi|218561456|ref|YP_002394369.1| DNA repair protein; CP4-44 prophage [Escherichia coli S88]
 gi|218368225|emb|CAR06041.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli S88]
          Length = 148

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL 148


>gi|159184835|ref|NP_354601.2| DNA repair protein RadC [Agrobacterium tumefaciens str. C58]
 gi|25009015|sp|Q8UEZ6|Y1607_AGRT5 RecName: Full=UPF0758 protein Atu1607
 gi|159140119|gb|AAK87386.2| DNA repair protein [Agrobacterium tumefaciens str. C58]
          Length = 280

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ +GT+DH PVY REIV+R LELS+T++IL+HNHPSG+P PS ADI
Sbjct: 184 LFLDKRNVLIADEVQGQGTVDHTPVYPREIVRRALELSSTALILIHNHPSGDPTPSRADI 243

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIGKD   SFKGLR+I
Sbjct: 244 EMTKTIIDTAKPLGITVHDHIIIGKDGHASFKGLRLI 280


>gi|146280868|ref|YP_001171021.1| DNA repair protein RadC [Pseudomonas stutzeri A1501]
 gi|166218790|sp|A4VGS8|Y473_PSEU5 RecName: Full=UPF0758 protein PST_0473
 gi|145569073|gb|ABP78179.1| DNA repair protein RadC [Pseudomonas stutzeri A1501]
          Length = 224

 Score =  134 bits (337), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV   GTID   VY R++V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDAKHRVLAFEVLFHGTIDGASVYPRQVVKRALAQNAAAVILTHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH I+G    +S      +
Sbjct: 188 QLTQRLKDALALIDVRVLDHFIVGDGEPLSMAEYGWM 224


>gi|258623772|ref|ZP_05718729.1| RadC-like protein [Vibrio mimicus VM603]
 gi|258583895|gb|EEW08687.1| RadC-like protein [Vibrio mimicus VM603]
          Length = 157

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|293376482|ref|ZP_06622711.1| DNA repair protein RadC [Turicibacter sanguinis PC909]
 gi|325842026|ref|ZP_08167563.1| DNA repair protein RadC [Turicibacter sp. HGF1]
 gi|292644904|gb|EFF62985.1| DNA repair protein RadC [Turicibacter sanguinis PC909]
 gi|325489748|gb|EGC92104.1| DNA repair protein RadC [Turicibacter sp. HGF1]
          Length = 223

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I+ +    G+++   V+ RE+ +  ++ SA S+I  HNHPSG+P PS+ DI
Sbjct: 127 LFLDTKNYIISKKTIFIGSLNKAIVHPREVFKEAIKRSAASVICAHNHPSGDPTPSEQDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I V DH+IIG D FVS K    +
Sbjct: 187 GLTHRLYEAGELIGIKVLDHLIIGDDQFVSLKEKGYL 223


>gi|118581981|ref|YP_903231.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
 gi|166218787|sp|A1AV03|Y3582_PELPD RecName: Full=UPF0758 protein Ppro_3582
 gi|118504691|gb|ABL01174.1| DNA replication and repair protein RadC [Pelobacter propionicus DSM
           2379]
          Length = 229

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I     S G+++   V+ RE+  + ++ SA ++ILVHNHP+G+P PS  DI
Sbjct: 133 LLLDGKNRIIRRVQVSEGSLNQSIVHPREVFCQAVKESAAAVILVHNHPTGDPTPSQEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I V DHIIIG   ++SF    ++
Sbjct: 193 AITRRLKEAGEIMGIRVLDHIIIGDGEYLSFVERGVL 229


>gi|91228537|ref|ZP_01262458.1| DNA repair protein RadC [Vibrio alginolyticus 12G01]
 gi|91187913|gb|EAS74224.1| DNA repair protein RadC [Vibrio alginolyticus 12G01]
          Length = 155

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + LIA E    GTID   VY RE+++  L+++A ++I  HNHPSG+  PS AD 
Sbjct: 60  MFLDNQHRLIAFEELFFGTIDSASVYPREVLKAALKINAAALIFAHNHPSGDATPSQADK 119

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DHI++G  A  SF    ++
Sbjct: 120 QITQRLKEALALVDIRVLDHIVVGDSAI-SFAERGLL 155


>gi|116251828|ref|YP_767666.1| DNA repair protein RadC [Rhizobium leguminosarum bv. viciae 3841]
 gi|226736628|sp|Q1MHK3|Y2068_RHIL3 RecName: Full=UPF0758 protein RL2068
 gi|115256476|emb|CAK07560.1| putative DNA repair protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 275

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT+++LVHNHPSG+P PS ADI
Sbjct: 179 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAMVLVHNHPSGDPTPSRADI 238

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDHIIIGKD  VS KGL++I
Sbjct: 239 DMTKVIIDAAKALDITVHDHIIIGKDGHVSLKGLKLI 275


>gi|213029140|ref|ZP_03343587.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 129

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 33  IFLDAQHRVLQHSRLFSGTLNHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 92

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH+IIG+  +VSF     I
Sbjct: 93  LITERVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 129


>gi|56476855|ref|YP_158444.1| RadC family DNA repair protein [Aromatoleum aromaticum EbN1]
 gi|56312898|emb|CAI07543.1| DNA repair protein similar to radC-family [Aromatoleum aromaticum
           EbN1]
          Length = 164

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSGN  PS AD 
Sbjct: 68  VFLDNQHQVLAFEPLFKGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++ V DH I+GK +  SF    ++
Sbjct: 128 AITERLKSALATVDVRVLDHFIVGKGSPYSFAEAGLL 164


>gi|15836753|ref|NP_297441.1| DNA repair protein RadC [Xylella fastidiosa 9a5c]
 gi|9104937|gb|AAF82961.1|AE003868_7 DNA repair protein [Xylella fastidiosa 9a5c]
          Length = 232

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I+ E    GTI+   V+ RE+V+R L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 136 LFLDNRHRAISFEELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ + DH +IG  A VSF     +
Sbjct: 196 MITQRLKNALDLIDVRLVDHFVIGDGAPVSFAEHGWL 232


>gi|124267582|ref|YP_001021586.1| DNA repair protein [Methylibium petroleiphilum PM1]
 gi|124260357|gb|ABM95351.1| DNA repair protein [Methylibium petroleiphilum PM1]
          Length = 164

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSGN  PS AD 
Sbjct: 68  VFLDNQHQVLAFEPLFKGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++ V DH I+GK +  SF    ++
Sbjct: 128 AITERLKSALATVDVRVLDHFIVGKGSPYSFAEAGLL 164


>gi|260912778|ref|ZP_05919264.1| DNA repair protein RadC [Pasteurella dagmatis ATCC 43325]
 gi|260633156|gb|EEX51321.1| DNA repair protein RadC [Pasteurella dagmatis ATCC 43325]
          Length = 214

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD    LI  E    GTI+   V+ REI++  L  +A ++IL HNHPSG   PS++D 
Sbjct: 118 LFLDNQQRLIKQEEMFLGTINMATVHPREIIKAALYCNAAALILAHNHPSGIAEPSESDK 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I      + I + DH IIGK  + SF    ++
Sbjct: 178 RITQKIKNVAELMEIRILDHFIIGKGCYTSFAENGLL 214


>gi|302878190|ref|YP_003846754.1| DNA repair protein RadC [Gallionella capsiferriformans ES-2]
 gi|302580979|gb|ADL54990.1| DNA repair protein RadC [Gallionella capsiferriformans ES-2]
          Length = 205

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GT+    VY RE+V+R L  +A +++L HNHPSG   PS AD 
Sbjct: 109 LFLDTQHRLIAAEELFHGTLTQTSVYPREVVKRALMHNAAAVLLAHNHPSGLAEPSQADQ 168

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++   DH IIG ++ +SF    +I
Sbjct: 169 LLTNALKQALALVDVRALDHFIIGDESALSFAERGLI 205


>gi|167621616|ref|YP_001672124.1| DNA repair protein RadC [Caulobacter sp. K31]
 gi|167351739|gb|ABZ74465.1| DNA repair protein RadC [Caulobacter sp. K31]
          Length = 253

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+ + GT+DH PVY RE+V+R LE+SA+++ILVHNHPSG+  PS ADI
Sbjct: 157 LFLDKKNQLIADEILNHGTVDHAPVYPREVVRRALEVSASAVILVHNHPSGDQTPSSADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++     L I VHDH+I+G+    SFK L +I
Sbjct: 217 EMTKKVVDAARTLGIAVHDHVIVGRAEVASFKALGLI 253


>gi|300916723|ref|ZP_07133437.1| putative DNA repair protein RadC [Escherichia coli MS 115-1]
 gi|300415989|gb|EFJ99299.1| putative DNA repair protein RadC [Escherichia coli MS 115-1]
          Length = 158

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LIA E    GTI+   V+ RE+V+R L  +A ++ILVHNHPSG   PS AD 
Sbjct: 62  LYLDNQNQLIAHETLFSGTINRTEVHPREVVKRALHFNAAAVILVHNHPSGETTPSQADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I + DH+I+G     SF    ++
Sbjct: 122 ALTQRLTQVLQLVDIRIPDHLIVGGRQIYSFAEHGLL 158


>gi|283787728|ref|YP_003367593.1| DNA repair protein [Citrobacter rodentium ICC168]
 gi|282951182|emb|CBG90875.1| DNA repair protein [Citrobacter rodentium ICC168]
          Length = 221

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT+ HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDTQHKVIKHSRLFSGTLSHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     ++I V DH++IG+  +VSF     I
Sbjct: 185 LITERVIKCCQFMDIRVLDHLVIGRGEYVSFAERGWI 221


>gi|294625196|ref|ZP_06703838.1| DNA repair protein RadC [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600515|gb|EFF44610.1| DNA repair protein RadC [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 225

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+ D 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEPDR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VSF     +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSFAERGWL 224


>gi|220933291|ref|YP_002512190.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
 gi|254789667|sp|B8GTE3|Y100_THISH RecName: Full=UPF0758 protein Tgr7_0100
 gi|219994601|gb|ACL71203.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
          Length = 223

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA E   RGTID   V+ RE+V+R L  +A ++IL HNHPSG   PS +D 
Sbjct: 128 LFLDNRHRVIAFEELFRGTIDGASVHPREVVRRALAHNAAALILAHNHPSGVAEPSRSDE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH+++G  + VSF    ++
Sbjct: 188 AITRRLRDALALVDIRVLDHVVVGD-SLVSFAERGLL 223


>gi|238794329|ref|ZP_04637941.1| radC-like protein yeeS [Yersinia intermedia ATCC 29909]
 gi|238726323|gb|EEQ17865.1| radC-like protein yeeS [Yersinia intermedia ATCC 29909]
          Length = 159

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N L+A E    GT+ H  V+ RE+V+R L  +A ++I  HNHPSG   PS AD 
Sbjct: 63  LYLNNQNQLLAHETLFTGTLSHTEVHPREVVKRALYFNAAAVIFAHNHPSGEVAPSQADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  + I V DH+I+G     SF    +I
Sbjct: 123 AITQRLVQALMLVEIRVPDHLIVGGRQIFSFAEHGLI 159


>gi|260587686|ref|ZP_05853599.1| DNA repair protein RadC [Blautia hansenii DSM 20583]
 gi|331084025|ref|ZP_08333132.1| hypothetical protein HMPREF0992_02056 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260541951|gb|EEX22520.1| DNA repair protein RadC [Blautia hansenii DSM 20583]
 gi|330402387|gb|EGG81957.1| hypothetical protein HMPREF0992_02056 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 231

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/96 (39%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+ DE+  +GT++      REI    +   A  I+LVHNHPSG+  PS AD+
Sbjct: 135 MMLDTKNHLLGDEMIFKGTVNSSLANPREIFLSAVSYHAVGILLVHNHPSGDCTPSQADV 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           + TQ +      L I + DHIIIG   ++SF+   I
Sbjct: 195 DFTQRVKEAGELLGIPLLDHIIIGDCKYLSFREQGI 230


>gi|328471743|gb|EGF42620.1| DNA repair protein [Vibrio parahaemolyticus 10329]
          Length = 157

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTLDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|172046060|sp|A8FFU0|Y2444_BACP2 RecName: Full=UPF0758 protein BPUM_2444
          Length = 224

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++       G+++   V+ REI +   + SA S I VHNHPSG+P PS  DI
Sbjct: 128 LYLNTKNQVLHKHTVFIGSLNSSIVHPREIFKEAFKRSAASFICVHNHPSGDPTPSREDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +      + I + DH++IG   FVS K    +
Sbjct: 188 EVTQRLFECGKLIGIQLLDHLVIGDQKFVSLKEKGYL 224


>gi|331654543|ref|ZP_08355543.1| intergenic-region protein [Escherichia coli M718]
 gi|331047925|gb|EGI20002.1| intergenic-region protein [Escherichia coli M718]
          Length = 163

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LI  E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLITGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVIPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+IIG     SF    ++
Sbjct: 127 LITERLVQALALVDIRVPDHLIIGGSQVFSFAEHGLL 163


>gi|260581787|ref|ZP_05849584.1| DNA repair protein RadC [Haemophilus influenzae NT127]
 gi|260095380|gb|EEW79271.1| DNA repair protein RadC [Haemophilus influenzae NT127]
          Length = 234

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 138 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 198 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 234


>gi|290488|gb|AAA61991.1| differs from radC sequence in X63366; similar to S. aureus putative
           25 kD protein [Escherichia coli]
          Length = 224

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|218697844|ref|YP_002405511.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
 gi|12643227|gb|AAK00479.1| unknown [Shigella flexneri 2a]
 gi|218354576|emb|CAV01492.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           55989]
          Length = 148

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVPPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALALVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|37678709|ref|NP_933318.1| DNA repair protein [Vibrio vulnificus YJ016]
 gi|37197450|dbj|BAC93289.1| DNA repair protein [Vibrio vulnificus YJ016]
          Length = 157

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  +   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGNTCTSFAERGWL 157


>gi|134300388|ref|YP_001113884.1| DNA repair protein RadC [Desulfotomaculum reducens MI-1]
 gi|172044335|sp|A4J7K6|Y2549_DESRM RecName: Full=UPF0758 protein Dred_2549
 gi|134053088|gb|ABO51059.1| DNA replication and repair protein RadC [Desulfotomaculum reducens
           MI-1]
          Length = 227

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N ++A E  S GT++   V+ RE+ +  +  SA S+ILVHNHPSG+P PS  DI
Sbjct: 131 LLLNTKNQVLARETISIGTLNSSVVHPRELFKVAIRRSAASMILVHNHPSGDPTPSREDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I V DHIIIG + F S K   +I
Sbjct: 191 VLTKRLIEAGEIIGIDVLDHIIIGDNKFTSLKSKGLI 227


>gi|88705460|ref|ZP_01103171.1| DNA repair protein RadC [Congregibacter litoralis KT71]
 gi|88700550|gb|EAQ97658.1| DNA repair protein RadC [Congregibacter litoralis KT71]
          Length = 224

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+  E    GT+D   VY RE+V R L   A +++L HNHPSG  +PS AD 
Sbjct: 128 LFLDSQHHLLCCEDVFSGTLDGAAVYPREVVLRALHHRAAAVVLAHNHPSGLTHPSSADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   L  ++I V DH IIG+    SF    ++
Sbjct: 188 HITQRLRDALALVDIRVLDHFIIGRGRSYSFAEAGLL 224


>gi|241204438|ref|YP_002975534.1| DNA repair protein RadC [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858328|gb|ACS55995.1| DNA repair protein RadC [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 275

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 179 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATALILVHNHPSGDPTPSRADI 238

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDH+IIGKD  VS KGL++I
Sbjct: 239 DMTKVIIDAAKALDITVHDHVIIGKDGHVSLKGLKLI 275


>gi|152994658|ref|YP_001339493.1| DNA repair protein RadC [Marinomonas sp. MWYL1]
 gi|189029397|sp|A6VSX9|Y624_MARMS RecName: Full=UPF0758 protein Mmwyl1_0624
 gi|150835582|gb|ABR69558.1| DNA repair protein RadC [Marinomonas sp. MWYL1]
          Length = 224

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +    GTID   VY RE+V+  L+ +A ++IL HNHPSG   PS ADI
Sbjct: 128 LFLDTQHRLIRYQELFMGTIDAAAVYPREVVKAALQYNAAAVILAHNHPSGIAEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I   L+ +++ + DH ++G    VS     ++
Sbjct: 188 SITDKIKRALDLVDVRLLDHFVVGDGLPVSLAERGLV 224


>gi|310829102|ref|YP_003961459.1| DNA repair protein RadC [Eubacterium limosum KIST612]
 gi|308740836|gb|ADO38496.1| DNA repair protein RadC [Eubacterium limosum KIST612]
          Length = 234

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I  E  S GTI+   V+ RE+  + +   A ++IL HNHPSG+P PS  D 
Sbjct: 138 LLLDNKNKVIKTETISIGTINASLVHPREVFVKAIRQHAAAVILAHNHPSGDPKPSAEDR 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +   L I V DH++IG   +VSFK    I
Sbjct: 198 AITKRLLESGELLGIPVLDHVVIGGADYVSFKESGYI 234


>gi|217969374|ref|YP_002354608.1| DNA repair protein RadC [Thauera sp. MZ1T]
 gi|217506701|gb|ACK53712.1| DNA repair protein RadC [Thauera sp. MZ1T]
          Length = 164

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSGN  PS AD 
Sbjct: 68  VFLDNQHQVLAFEPLFQGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++ V DH I+GK +  SF    ++
Sbjct: 128 AITERLKSALATVDVRVLDHFIVGKGSPYSFAEAGLL 164


>gi|121594529|ref|YP_986425.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|120606609|gb|ABM42349.1| DNA repair protein RadC [Acidovorax sp. JS42]
          Length = 164

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSGN  PS AD 
Sbjct: 68  VFLDNQHQVLAFEPLFKGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++ V DH I+GK +  SF    ++
Sbjct: 128 AITERLKSALATVDVRVLDHFIVGKGSPYSFAEAGLL 164


>gi|114330795|ref|YP_747017.1| DNA repair protein RadC [Nitrosomonas eutropha C91]
 gi|122314267|sp|Q0AHY0|Y782_NITEC RecName: Full=UPF0758 protein Neut_0782
 gi|114307809|gb|ABI59052.1| DNA replication and repair protein RadC [Nitrosomonas eutropha C91]
          Length = 224

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  +  I  E   RGT+    VY RE+V+R L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 IFLDARHRTIMIEELFRGTLTQASVYPREVVKRALYHNAAAMIFAHNHPSGVAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++   L  +++ V DH +IG +  VSF    +I
Sbjct: 188 MLTQSLKQALALVDVKVLDHFVIGNNETVSFAERGLI 224


>gi|82779592|ref|YP_405941.1| putative DNA repair protein [Shigella dysenteriae Sd197]
 gi|309787459|ref|ZP_07682071.1| DNA repair RadC family protein [Shigella dysenteriae 1617]
 gi|81243740|gb|ABB64450.1| putative DNA repair protein [Shigella dysenteriae Sd197]
 gi|308925037|gb|EFP70532.1| DNA repair RadC family protein [Shigella dysenteriae 1617]
          Length = 158

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRSLYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G +   SF    ++
Sbjct: 122 LITERLVQALALVDIRVPDHLIVGGNQVFSFAEHGLL 158


>gi|331654133|ref|ZP_08355133.1| putative DNA repair protein [Escherichia coli M718]
 gi|331047515|gb|EGI19592.1| putative DNA repair protein [Escherichia coli M718]
          Length = 105

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 9   LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 68

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 69  LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 105


>gi|327479136|gb|AEA82446.1| DNA repair protein RadC [Pseudomonas stutzeri DSM 4166]
          Length = 224

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV   GTID   VY R++V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDAKHRVLAFEVLFHGTIDGASVYPRQVVKRALAQNAAAVILTHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH I+G    +S      +
Sbjct: 188 QLTQRLKDALALIDVRVLDHFIVGDGEPLSMAEYGWM 224


>gi|188578899|ref|YP_001915828.1| DNA repair protein RadC [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|172044625|sp|Q5H5M1|Y495_XANOR RecName: Full=UPF0758 protein XOO0495
 gi|238689548|sp|B2SS21|Y2919_XANOP RecName: Full=UPF0758 protein PXO_02919
 gi|188523351|gb|ACD61296.1| DNA repair protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 225

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSKADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VS      +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSLAERGWL 224


>gi|59710733|ref|YP_203509.1| DNA repair protein RadC [Vibrio fischeri ES114]
 gi|71648820|sp|Q5E8M5|Y126_VIBF1 RecName: Full=UPF0758 protein VF_0126
 gi|59478834|gb|AAW84621.1| protein associated with replication fork, possible DNA repair
           protein [Vibrio fischeri ES114]
          Length = 224

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+   GTID   VY RE+V+R ++ +A +IIL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVLKGEILFEGTIDVAAVYPREVVKRSIDYNAAAIILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   +  ++I V DH +IG    VSF     I
Sbjct: 188 RITKRISDAVELVDIRVLDHFVIGDGEIVSFAERGWI 224


>gi|89110373|ref|AP_004153.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli str. K-12 substr. W3110]
 gi|162135914|ref|NP_418095.4| conserved protein, UPF0758 family; not radC [Escherichia coli str.
           K-12 substr. MG1655]
 gi|170083146|ref|YP_001732466.1| protein associated with replication fork, DNA repair protein
           [Escherichia coli str. K-12 substr. DH10B]
 gi|238902729|ref|YP_002928525.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli BW2952]
 gi|6686314|sp|P25531|YICR_ECOLI RecName: Full=UPF0758 protein yicR
 gi|229485552|sp|B1X972|YICR_ECODH RecName: Full=UPF0758 protein yicR
 gi|259551860|sp|C4ZXN0|YICR_ECOBW RecName: Full=UPF0758 protein yicR
 gi|85676404|dbj|BAE77654.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli str. K12 substr. W3110]
 gi|87082300|gb|AAC76662.2| conserved protein, UPF0758 family; not radC [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169890981|gb|ACB04688.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli str. K-12 substr. DH10B]
 gi|238863294|gb|ACR65292.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli BW2952]
 gi|260447343|gb|ACX37765.1| DNA repair protein RadC [Escherichia coli DH1]
 gi|315138220|dbj|BAJ45379.1| DNA repair protein RadC [Escherichia coli DH1]
          Length = 222

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|326405093|ref|YP_004285175.1| hypothetical protein ACMV_29460 [Acidiphilium multivorum AIU301]
 gi|325051955|dbj|BAJ82293.1| hypothetical protein ACMV_29460 [Acidiphilium multivorum AIU301]
          Length = 266

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N L+ADEV SRGT++H  VY+RE+V+R +E  AT++ILVHNHPSG+P+PS  D+
Sbjct: 165 IYLDNRNRLLADEVASRGTVNHTQVYVREVVRRAIETRATALILVHNHPSGDPSPSRDDV 224

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   +  L+I +HDH+IIGK  ++SF+    +
Sbjct: 225 EMTREVQRAVALLDITLHDHVIIGKAGWLSFRREGFL 261


>gi|313200117|ref|YP_004038775.1| DNA repair protein radc [Methylovorus sp. MP688]
 gi|312439433|gb|ADQ83539.1| DNA repair protein RadC [Methylovorus sp. MP688]
          Length = 224

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++A E    GT+    V+ REIV+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 IFLDAQNRVLAHEEMFAGTLTQTSVHPREIVKRALYYNAGAVILAHNHPSGVAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + T L+ +++ V DH ++  +  +SF    ++
Sbjct: 188 MITAQLKTALDLVDVRVLDHFVVAGNTTLSFAERGLL 224


>gi|218691142|ref|YP_002399354.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|331681607|ref|ZP_08382243.1| intergenic-region protein [Escherichia coli H299]
 gi|218428706|emb|CAR09496.1| putative DNA repair protein; CP4-44 prophage [Escherichia coli
           ED1a]
 gi|331081181|gb|EGI52343.1| intergenic-region protein [Escherichia coli H299]
          Length = 148

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|238750954|ref|ZP_04612451.1| radC-like protein yeeS [Yersinia rohdei ATCC 43380]
 gi|238710868|gb|EEQ03089.1| radC-like protein yeeS [Yersinia rohdei ATCC 43380]
          Length = 159

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N L+A E    GTI H  V+ RE+V+R L  +A ++I  HNHPSG   PS AD 
Sbjct: 63  LYLNNQNQLLAHETLFTGTISHTEVHPREVVKRALYFNAAAVIFAHNHPSGEVAPSQADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  + I V DH+I+G     SF    +I
Sbjct: 123 AITQRLVQALMLVEIRVPDHLIVGGRQIFSFAEHGLI 159


>gi|220935036|ref|YP_002513935.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996346|gb|ACL72948.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
          Length = 168

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GTID   V+ RE+V++ L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 72  LFLDTRHRLIDYVEMFHGTIDAAEVHPREVVKQALRLNAAAVIVSHNHPSGNPEPSAADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +   L  +++   DH+I+      SF    +I
Sbjct: 132 SMTAQLRQALALVDVRTLDHVIVAGTRTTSFAERGLI 168


>gi|58580118|ref|YP_199134.1| DNA repair protein RadC [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58424712|gb|AAW73749.1| DNA repair protein [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 243

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS AD 
Sbjct: 146 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSKADR 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VS      +
Sbjct: 206 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSLAERGWL 242


>gi|260584697|ref|ZP_05852443.1| DNA repair protein RadC [Granulicatella elegans ATCC 700633]
 gi|260157720|gb|EEW92790.1| DNA repair protein RadC [Granulicatella elegans ATCC 700633]
          Length = 228

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 52/96 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  ++  RG ++   V+ REI +  +  SA  II+ HNHPSGN  PS ADI
Sbjct: 132 LFLNSKNEVIKKKIIFRGGLNQAVVHPREIFREAVRFSAARIIIGHNHPSGNVTPSQADI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           + T+ +      + I + DH I+G   + S K    
Sbjct: 192 DFTRRLSECGEMMGIELLDHFIVGDHTYCSLKEEGY 227


>gi|84622119|ref|YP_449491.1| DNA repair protein RadC [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|123523355|sp|Q2P8B0|Y462_XANOM RecName: Full=UPF0758 protein XOO0462
 gi|84366059|dbj|BAE67217.1| DNA repair protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 225

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VS      +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSLAERGWL 224


>gi|89098968|ref|ZP_01171848.1| DNA repair protein RadC [Bacillus sp. NRRL B-14911]
 gi|89086372|gb|EAR65493.1| DNA repair protein RadC [Bacillus sp. NRRL B-14911]
          Length = 223

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     SA SII +HNHPSG+P PS  DI
Sbjct: 127 LYLNTKNQVLHKQTIFIGSLNASIVHPREVFKEAFRRSAASIICIHNHPSGDPAPSREDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I V DH+IIG++ +VS K    +
Sbjct: 187 EVTKRLAECGKIIGIDVLDHLIIGENKYVSLKEKGYL 223


>gi|157693205|ref|YP_001487667.1| DNA repair protein RadC [Bacillus pumilus SAFR-032]
 gi|157681963|gb|ABV63107.1| DNA repair protein RadC [Bacillus pumilus SAFR-032]
          Length = 232

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++       G+++   V+ REI +   + SA S I VHNHPSG+P PS  DI
Sbjct: 136 LYLNTKNQVLHKHTVFIGSLNSSIVHPREIFKEAFKRSAASFICVHNHPSGDPTPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +      + I + DH++IG   FVS K    +
Sbjct: 196 EVTQRLFECGKLIGIQLLDHLVIGDQKFVSLKEKGYL 232


>gi|194017399|ref|ZP_03056011.1| DNA repair protein RadC [Bacillus pumilus ATCC 7061]
 gi|194011267|gb|EDW20837.1| DNA repair protein RadC [Bacillus pumilus ATCC 7061]
          Length = 232

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++       G+++   V+ REI +   + SA S I VHNHPSG+P PS  DI
Sbjct: 136 LYLNTKNQVLHKHTVFIGSLNSSIVHPREIFKEAFKRSAASFICVHNHPSGDPTPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +      + I + DH++IG   FVS K    +
Sbjct: 196 EVTQRLFECGKLIGIQLLDHLVIGDQKFVSLKEKGYL 232


>gi|301648526|ref|ZP_07248250.1| DNA repair protein RadC domain protein [Escherichia coli MS 146-1]
 gi|301073429|gb|EFK88235.1| DNA repair protein RadC domain protein [Escherichia coli MS 146-1]
          Length = 116

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 20  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 79

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 80  LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 116


>gi|258626046|ref|ZP_05720901.1| Putative radC-like protein [Vibrio mimicus VM603]
 gi|258581666|gb|EEW06560.1| Putative radC-like protein [Vibrio mimicus VM603]
          Length = 157

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|170021431|ref|YP_001726385.1| DNA repair protein RadC [Escherichia coli ATCC 8739]
 gi|169756359|gb|ACA79058.1| DNA repair protein RadC [Escherichia coli ATCC 8739]
          Length = 159

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GTI+H  V+ RE+V+  L+ +  ++I+ H+HPSG   PS AD 
Sbjct: 63  LFLDNQHRLIAHETLFTGTINHTQVHPREVVKAGLKHNCAAVIVAHSHPSGEAEPSKADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L+ ++I + DH+++G     SF     +
Sbjct: 123 QVTTRIQQALDLVDIRLLDHLVVGGMEITSFADRGWL 159


>gi|331005601|ref|ZP_08328971.1| DNA repair protein RadC [gamma proteobacterium IMCC1989]
 gi|330420574|gb|EGG94870.1| DNA repair protein RadC [gamma proteobacterium IMCC1989]
          Length = 224

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  +    GT++   VY REIV+  L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 LFLDSQHQLIRYQEVFFGTVNAANVYPREIVKLALAYNACAVIFAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   LN +++ V DH+I+G     SF     +
Sbjct: 188 HITQELKDALNLIDVRVLDHLIVGDGDIHSFAENGWL 224


>gi|94499761|ref|ZP_01306297.1| DNA repair protein RadC [Oceanobacter sp. RED65]
 gi|94427962|gb|EAT12936.1| DNA repair protein RadC [Oceanobacter sp. RED65]
          Length = 223

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LIA E   RGTID   VY RE+V++ L  +A ++I  HNHPSG   PSD+DI
Sbjct: 128 LYLDNQHRLIAFEELFRGTIDGASVYPREVVKQVLAHNAAAVIFAHNHPSGIAEPSDSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH ++G    +SF    ++
Sbjct: 188 RITKRLQDALALVDVRVLDHFVVGD-EVISFAQRGML 223


>gi|82779128|ref|YP_405477.1| DNA repair protein RadC [Shigella dysenteriae Sd197]
 gi|81243276|gb|ABB63986.1| DNA repair protein [Shigella dysenteriae Sd197]
          Length = 224

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRIFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|323703616|ref|ZP_08115260.1| DNA repair protein RadC [Desulfotomaculum nigrificans DSM 574]
 gi|323531449|gb|EGB21344.1| DNA repair protein RadC [Desulfotomaculum nigrificans DSM 574]
          Length = 227

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +++ E  S GT++   V+ RE+ +  +  SA +IIL HNHPSG+P PS  DI
Sbjct: 131 LLLNTKNRVLSKETISIGTLNSSMVHPRELFKIAIRRSAAAIILAHNHPSGDPTPSREDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I V DHIIIG + F S K   +I
Sbjct: 191 MLTKRLIEVGQIIGIDVLDHIIIGDNRFTSLKSKGLI 227


>gi|261867145|ref|YP_003255067.1| DNA repair protein RadC [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412477|gb|ACX81848.1| DNA repair protein RadC [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 219

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A +IIL HNHPSG   PS +D 
Sbjct: 123 LFLDNQHRLIKQERLFLGTINKAMVYPREIIKEALACNAAAIILAHNHPSGVAEPSISDK 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I    + ++I V DH +IG   + SF    ++
Sbjct: 183 QITDTIRQAADLVDIRVLDHFVIGNGRYFSFAEQNLL 219


>gi|254419835|ref|ZP_05033559.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
 gi|196186012|gb|EDX80988.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
          Length = 243

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LDK N LI DEVQ+RGT+DH PVY RE+V+R LELSA+++ILVHNHPSG+P PS ADI
Sbjct: 147 LYLDKKNQLILDEVQNRGTVDHAPVYPREVVRRALELSASALILVHNHPSGDPTPSRADI 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     LN+ VHDH+++G+D   SFK L ++
Sbjct: 207 EITKQVVQAGRALNVEVHDHLVVGRDGVASFKQLGLM 243


>gi|237728935|ref|ZP_04559416.1| DNA repair protein radC [Citrobacter sp. 30_2]
 gi|226909557|gb|EEH95475.1| DNA repair protein radC [Citrobacter sp. 30_2]
          Length = 234

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + +I       GT+ HV V+ REIV+  ++++A+++IL HNHPSG   PS AD 
Sbjct: 138 IFMDSQHRVIKHSKLFSGTLSHVEVHPREIVREAIKMNASAVILAHNHPSGCAEPSKADK 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     ++I V DH++IG+  +VSF     I
Sbjct: 198 LITERVVKCCQFMDIRVLDHLVIGRGEYVSFAERGWI 234


>gi|237704459|ref|ZP_04534940.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226900825|gb|EEH87084.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|294491633|gb|ADE90389.1| DNA repair protein, RadC family [Escherichia coli IHE3034]
 gi|307554072|gb|ADN46847.1| DNA repair protein [Escherichia coli ABU 83972]
 gi|323956170|gb|EGB51921.1| DNA repair protein RadC [Escherichia coli H263]
          Length = 158

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++  L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKCALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|89094938|ref|ZP_01167869.1| DNA repair protein RadC [Oceanospirillum sp. MED92]
 gi|89080804|gb|EAR60045.1| DNA repair protein RadC [Oceanospirillum sp. MED92]
          Length = 224

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI+   VY REIV R L  +A +++L HNHPSG   PSDAD 
Sbjct: 128 LFLDNKHRVIQYENLFWGTINAAAVYPREIVSRALHHNAGAVVLAHNHPSGVAEPSDADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH+++G     SF    ++
Sbjct: 188 QITLKLQKALALVDVRVIDHMVVGDGEVFSFAEQGVL 224


>gi|83950724|ref|ZP_00959457.1| DNA repair protein RadC [Roseovarius nubinhibens ISM]
 gi|83838623|gb|EAP77919.1| DNA repair protein RadC [Roseovarius nubinhibens ISM]
          Length = 250

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 70/96 (72%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           FLD  N LIADE Q+RGT+DHVPVY RE+V+R L L+AT++ILVHNHPSG+P PS +DI 
Sbjct: 155 FLDTKNTLIADEDQARGTVDHVPVYPREVVKRALALNATALILVHNHPSGDPTPSQSDIA 214

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT  I      L I +HDHIIIGK   +SF+   ++
Sbjct: 215 MTAQIAQAAGSLGITLHDHIIIGKSRELSFRAEGLL 250


>gi|209921109|ref|YP_002295193.1| DNA repair protein RadC [Escherichia coli SE11]
 gi|300815123|ref|ZP_07095348.1| DNA repair protein RadC [Escherichia coli MS 107-1]
 gi|209914368|dbj|BAG79442.1| DNA repair protein [Escherichia coli SE11]
 gi|300532015|gb|EFK53077.1| DNA repair protein RadC [Escherichia coli MS 107-1]
          Length = 224

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|22124012|ref|NP_667435.1| DNA repair protein RadC [Yersinia pestis KIM 10]
 gi|45439915|ref|NP_991454.1| DNA repair protein RadC [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594404|ref|YP_068595.1| DNA repair protein RadC [Yersinia pseudotuberculosis IP 32953]
 gi|108809484|ref|YP_653400.1| DNA repair protein RadC [Yersinia pestis Antiqua]
 gi|108813961|ref|YP_649728.1| DNA repair protein RadC [Yersinia pestis Nepal516]
 gi|145601096|ref|YP_001165172.1| DNA repair protein RadC [Yersinia pestis Pestoides F]
 gi|150260887|ref|ZP_01917615.1| putative DNA repair protein [Yersinia pestis CA88-4125]
 gi|153948496|ref|YP_001399062.1| DNA repair protein RadC [Yersinia pseudotuberculosis IP 31758]
 gi|162421088|ref|YP_001604695.1| DNA repair protein RadC [Yersinia pestis Angola]
 gi|165926061|ref|ZP_02221893.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936188|ref|ZP_02224757.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011487|ref|ZP_02232385.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213687|ref|ZP_02239722.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402113|ref|ZP_02307590.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418902|ref|ZP_02310655.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426676|ref|ZP_02318429.1| DNA repair protein RadC [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170026362|ref|YP_001722867.1| DNA repair protein RadC [Yersinia pseudotuberculosis YPIII]
 gi|186893392|ref|YP_001870504.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
 gi|218927270|ref|YP_002345145.1| DNA repair protein RadC [Yersinia pestis CO92]
 gi|229836162|ref|ZP_04456330.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis Pestoides A]
 gi|229839898|ref|ZP_04460057.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229841980|ref|ZP_04462135.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229904491|ref|ZP_04519602.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis Nepal516]
 gi|270488490|ref|ZP_06205564.1| DNA repair protein RadC [Yersinia pestis KIM D27]
 gi|294502156|ref|YP_003566218.1| DNA repair protein RadC [Yersinia pestis Z176003]
 gi|25009034|sp|Q8ZJP3|Y049_YERPE RecName: Full=UPF0758 protein YPO0049/y0092/YP_0050
 gi|73913745|sp|Q66GD6|Y046_YERPS RecName: Full=UPF0758 protein YPTB0046
 gi|123245478|sp|Q1C267|Y3493_YERPA RecName: Full=UPF0758 protein YPA_3493
 gi|123372833|sp|Q1CD02|Y3801_YERPN RecName: Full=UPF0758 protein YPN_3801
 gi|166218801|sp|A4TSD7|Y3856_YERPP RecName: Full=UPF0758 protein YPDSF_3856
 gi|166918668|sp|A7FCT4|Y061_YERP3 RecName: Full=UPF0758 protein YpsIP31758_0061
 gi|238687317|sp|A9R674|Y055_YERPG RecName: Full=UPF0758 protein YpAngola_A0055
 gi|238688492|sp|B1JQX3|Y4155_YERPY RecName: Full=UPF0758 protein YPK_4155
 gi|238691334|sp|B2JYN3|Y048_YERPB RecName: Full=UPF0758 protein YPTS_0048
 gi|21956754|gb|AAM83686.1|AE013609_11 DNA repair protein [Yersinia pestis KIM 10]
 gi|45434770|gb|AAS60331.1| putative DNA repair protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51587686|emb|CAH19286.1| putative DNA repair protein [Yersinia pseudotuberculosis IP 32953]
 gi|108777609|gb|ABG20128.1| DNA repair protein [Yersinia pestis Nepal516]
 gi|108781397|gb|ABG15455.1| putative DNA repair protein [Yersinia pestis Antiqua]
 gi|115345881|emb|CAL18739.1| putative DNA repair protein [Yersinia pestis CO92]
 gi|145212792|gb|ABP42199.1| DNA repair protein [Yersinia pestis Pestoides F]
 gi|149290295|gb|EDM40372.1| putative DNA repair protein [Yersinia pestis CA88-4125]
 gi|152959991|gb|ABS47452.1| DNA repair protein RadC [Yersinia pseudotuberculosis IP 31758]
 gi|162353903|gb|ABX87851.1| DNA repair protein RadC [Yersinia pestis Angola]
 gi|165915802|gb|EDR34410.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921921|gb|EDR39098.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989633|gb|EDR41934.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205089|gb|EDR49569.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962896|gb|EDR58917.1| DNA repair protein RadC [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048488|gb|EDR59896.1| DNA repair protein RadC [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054365|gb|EDR64182.1| DNA repair protein RadC [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752896|gb|ACA70414.1| DNA repair protein RadC [Yersinia pseudotuberculosis YPIII]
 gi|186696418|gb|ACC87047.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
 gi|229678609|gb|EEO74714.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis Nepal516]
 gi|229690290|gb|EEO82344.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696264|gb|EEO86311.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706610|gb|EEO92616.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis Pestoides A]
 gi|262360235|gb|ACY56956.1| DNA repair protein RadC [Yersinia pestis D106004]
 gi|262364182|gb|ACY60739.1| DNA repair protein RadC [Yersinia pestis D182038]
 gi|270336994|gb|EFA47771.1| DNA repair protein RadC [Yersinia pestis KIM D27]
 gi|294352615|gb|ADE62956.1| DNA repair protein RadC [Yersinia pestis Z176003]
 gi|320013403|gb|ADV96974.1| protein associated with replication fork, possible DNA repair
           protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 222

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 126 VFLDNQHRVIRHEEMFTGTISSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I   + L+I V DH+++G+   VSF     +
Sbjct: 186 LITTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 222


>gi|289671096|ref|ZP_06492171.1| DNA repair protein RadC [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 225

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VS      +
Sbjct: 188 AVTKRLLESLELVDIRLLDHFVIGDGRPVSLAERGWL 224


>gi|52081286|ref|YP_080077.1| DNA repair protein RadC [Bacillus licheniformis ATCC 14580]
 gi|52786665|ref|YP_092494.1| DNA repair protein RadC [Bacillus licheniformis ATCC 14580]
 gi|81690952|sp|Q65GL3|Y2933_BACLD RecName: Full=UPF0758 protein BLi02933/BL00636
 gi|52004497|gb|AAU24439.1| DNA repair protein [Bacillus licheniformis ATCC 14580]
 gi|52349167|gb|AAU41801.1| RadC [Bacillus licheniformis ATCC 14580]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I       G+++   V+ RE+ +  L+ SA S I VHNHPSG+P PS  DI
Sbjct: 128 VYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEALKRSAASFICVHNHPSGDPAPSREDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +  +   L I + DHIIIG   FVS K    +
Sbjct: 188 EVTQRLHESGQLLGIELLDHIIIGDQKFVSLKEKGYL 224


>gi|330909700|gb|EGH38214.1| DNA repair protein RadC [Escherichia coli AA86]
          Length = 226

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 130 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 190 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 226


>gi|212712581|ref|ZP_03320709.1| hypothetical protein PROVALCAL_03676 [Providencia alcalifaciens DSM
           30120]
 gi|212684797|gb|EEB44325.1| hypothetical protein PROVALCAL_03676 [Providencia alcalifaciens DSM
           30120]
          Length = 221

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + +I  E   +GTI+ V V+ REI++  + ++A++I+L HNHPSGNP PS AD 
Sbjct: 125 LFLNNQHQVICHEEMFKGTINRVEVHPREILRFAMRMNASAIVLAHNHPSGNPEPSMADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I    + + I + DH ++G  + +SF     +
Sbjct: 185 YVTEQIQGACDVMGIKLLDHFVVGHKSCISFAERGWL 221


>gi|194431265|ref|ZP_03063558.1| DNA repair protein RadC [Shigella dysenteriae 1012]
 gi|194420720|gb|EDX36796.1| DNA repair protein RadC [Shigella dysenteriae 1012]
 gi|332084498|gb|EGI89693.1| DNA repair protein radC [Shigella dysenteriae 155-74]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|82546001|ref|YP_409948.1| DNA repair protein RadC [Shigella boydii Sb227]
 gi|293463962|ref|ZP_06664376.1| DNA repair protein RadC [Escherichia coli B088]
 gi|300822408|ref|ZP_07102548.1| DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|301325320|ref|ZP_07218827.1| DNA repair protein RadC [Escherichia coli MS 78-1]
 gi|301644304|ref|ZP_07244306.1| DNA repair protein RadC [Escherichia coli MS 146-1]
 gi|331644356|ref|ZP_08345485.1| DNA repair protein RadC [Escherichia coli H736]
 gi|331655270|ref|ZP_08356269.1| DNA repair protein RadC [Escherichia coli M718]
 gi|331675118|ref|ZP_08375875.1| DNA repair protein RadC [Escherichia coli TA280]
 gi|331679729|ref|ZP_08380399.1| DNA repair protein RadC [Escherichia coli H591]
 gi|81247412|gb|ABB68120.1| DNA repair protein [Shigella boydii Sb227]
 gi|291321594|gb|EFE61030.1| DNA repair protein RadC [Escherichia coli B088]
 gi|300525055|gb|EFK46124.1| DNA repair protein RadC [Escherichia coli MS 119-7]
 gi|300847847|gb|EFK75607.1| DNA repair protein RadC [Escherichia coli MS 78-1]
 gi|301077342|gb|EFK92148.1| DNA repair protein RadC [Escherichia coli MS 146-1]
 gi|315618659|gb|EFU99245.1| DNA repair protein radC [Escherichia coli 3431]
 gi|323160754|gb|EFZ46690.1| DNA repair protein radC [Escherichia coli E128010]
 gi|331036650|gb|EGI08876.1| DNA repair protein RadC [Escherichia coli H736]
 gi|331047285|gb|EGI19363.1| DNA repair protein RadC [Escherichia coli M718]
 gi|331068027|gb|EGI39425.1| DNA repair protein RadC [Escherichia coli TA280]
 gi|331072901|gb|EGI44226.1| DNA repair protein RadC [Escherichia coli H591]
 gi|332089352|gb|EGI94456.1| DNA repair protein radC [Shigella boydii 3594-74]
 gi|332104944|gb|EGJ08290.1| DNA repair protein RadC [Shigella sp. D9]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|159046109|ref|YP_001534903.1| DNA repair protein RadC [Dinoroseobacter shibae DFL 12]
 gi|157913869|gb|ABV95302.1| DNA repair protein RadC [Dinoroseobacter shibae DFL 12]
          Length = 254

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N+LIADE Q+RGT+DHVPVY REI +R LEL+A+++ILVHNHPSG+P PS+ DI
Sbjct: 158 LYLDNKNVLIADEAQARGTVDHVPVYPREIAKRALELNASALILVHNHPSGDPTPSEQDI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L + +HDH++IGK   VSF+    +
Sbjct: 218 TMTYAIRDAAEVLGLRLHDHLVIGKSREVSFRAEGYL 254


>gi|332084818|gb|EGI90001.1| DNA repair protein radC [Shigella boydii 5216-82]
          Length = 188

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 92  IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 151

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 152 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 188


>gi|323944091|gb|EGB40171.1| DNA repair protein RadC [Escherichia coli H120]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|15804179|ref|NP_290218.1| DNA repair protein RadC [Escherichia coli O157:H7 EDL933]
 gi|15833767|ref|NP_312540.1| DNA repair protein RadC [Escherichia coli O157:H7 str. Sakai]
 gi|26250284|ref|NP_756324.1| DNA repair protein RadC [Escherichia coli CFT073]
 gi|91213155|ref|YP_543141.1| DNA repair protein RadC [Escherichia coli UTI89]
 gi|117625910|ref|YP_859233.1| DNA repair protein RadC [Escherichia coli APEC O1]
 gi|161485825|ref|NP_709417.3| DNA repair protein RadC [Shigella flexneri 2a str. 301]
 gi|161486390|ref|NP_839257.2| DNA repair protein RadC [Shigella flexneri 2a str. 2457T]
 gi|227883806|ref|ZP_04001611.1| DNA repair protein RadC [Escherichia coli 83972]
 gi|237703409|ref|ZP_04533890.1| DNA repair protein radC [Escherichia sp. 3_2_53FAA]
 gi|254038838|ref|ZP_04872890.1| DNA repair protein radC [Escherichia sp. 1_1_43]
 gi|291285009|ref|YP_003501827.1| DNA repair protein [Escherichia coli O55:H7 str. CB9615]
 gi|300898572|ref|ZP_07116903.1| DNA repair protein RadC [Escherichia coli MS 198-1]
 gi|300907679|ref|ZP_07125307.1| DNA repair protein RadC [Escherichia coli MS 84-1]
 gi|300939237|ref|ZP_07153917.1| DNA repair protein RadC [Escherichia coli MS 21-1]
 gi|300983482|ref|ZP_07176629.1| DNA repair protein RadC [Escherichia coli MS 200-1]
 gi|300984962|ref|ZP_07177214.1| DNA repair protein RadC [Escherichia coli MS 45-1]
 gi|301018967|ref|ZP_07183190.1| DNA repair protein RadC [Escherichia coli MS 69-1]
 gi|301047427|ref|ZP_07194507.1| DNA repair protein RadC [Escherichia coli MS 185-1]
 gi|301303871|ref|ZP_07209990.1| DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|309797621|ref|ZP_07692009.1| DNA repair protein RadC [Escherichia coli MS 145-7]
 gi|312972077|ref|ZP_07786251.1| DNA repair protein radC [Escherichia coli 1827-70]
 gi|331649453|ref|ZP_08350539.1| DNA repair protein RadC [Escherichia coli M605]
 gi|12518394|gb|AAG58782.1|AE005591_6 DNA repair protein [Escherichia coli O157:H7 str. EDL933]
 gi|26110714|gb|AAN82898.1|AE016769_13 DNA repair protein radC [Escherichia coli CFT073]
 gi|13363988|dbj|BAB37936.1| DNA repair protein [Escherichia coli O157:H7 str. Sakai]
 gi|91074729|gb|ABE09610.1| DNA repair protein [Escherichia coli UTI89]
 gi|115515034|gb|ABJ03109.1| DNA repair protein RadC [Escherichia coli APEC O1]
 gi|209754638|gb|ACI75631.1| DNA repair protein [Escherichia coli]
 gi|209754640|gb|ACI75632.1| DNA repair protein [Escherichia coli]
 gi|209754642|gb|ACI75633.1| DNA repair protein [Escherichia coli]
 gi|209754644|gb|ACI75634.1| DNA repair protein [Escherichia coli]
 gi|209754646|gb|ACI75635.1| DNA repair protein [Escherichia coli]
 gi|226838803|gb|EEH70830.1| DNA repair protein radC [Escherichia sp. 1_1_43]
 gi|226902673|gb|EEH88932.1| DNA repair protein radC [Escherichia sp. 3_2_53FAA]
 gi|227839084|gb|EEJ49550.1| DNA repair protein RadC [Escherichia coli 83972]
 gi|281603001|gb|ADA75985.1| DNA repair protein [Shigella flexneri 2002017]
 gi|290764882|gb|ADD58843.1| DNA repair protein [Escherichia coli O55:H7 str. CB9615]
 gi|300300701|gb|EFJ57086.1| DNA repair protein RadC [Escherichia coli MS 185-1]
 gi|300306946|gb|EFJ61466.1| DNA repair protein RadC [Escherichia coli MS 200-1]
 gi|300357758|gb|EFJ73628.1| DNA repair protein RadC [Escherichia coli MS 198-1]
 gi|300399461|gb|EFJ82999.1| DNA repair protein RadC [Escherichia coli MS 69-1]
 gi|300400615|gb|EFJ84153.1| DNA repair protein RadC [Escherichia coli MS 84-1]
 gi|300408242|gb|EFJ91780.1| DNA repair protein RadC [Escherichia coli MS 45-1]
 gi|300455879|gb|EFK19372.1| DNA repair protein RadC [Escherichia coli MS 21-1]
 gi|300840834|gb|EFK68594.1| DNA repair protein RadC [Escherichia coli MS 124-1]
 gi|308118808|gb|EFO56070.1| DNA repair protein RadC [Escherichia coli MS 145-7]
 gi|310334454|gb|EFQ00659.1| DNA repair protein radC [Escherichia coli 1827-70]
 gi|315254024|gb|EFU33992.1| DNA repair protein RadC [Escherichia coli MS 85-1]
 gi|315285375|gb|EFU44820.1| DNA repair protein RadC [Escherichia coli MS 110-3]
 gi|315292975|gb|EFU52327.1| DNA repair protein RadC [Escherichia coli MS 153-1]
 gi|323189454|gb|EFZ74735.1| DNA repair protein radC [Escherichia coli RN587/1]
 gi|324008143|gb|EGB77362.1| DNA repair protein RadC [Escherichia coli MS 57-2]
 gi|324012728|gb|EGB81947.1| DNA repair protein RadC [Escherichia coli MS 60-1]
 gi|325499444|gb|EGC97303.1| DNA repair protein RadC [Escherichia fergusonii ECD227]
 gi|331041951|gb|EGI14095.1| DNA repair protein RadC [Escherichia coli M605]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|309784385|ref|ZP_07679024.1| DNA repair protein radC [Shigella dysenteriae 1617]
 gi|172046622|sp|Q329L9|YICR_SHIDS RecName: Full=UPF0758 protein yicR
 gi|308927892|gb|EFP73360.1| DNA repair protein radC [Shigella dysenteriae 1617]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRIFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|262191975|ref|ZP_06050141.1| DNA repair protein RadC [Vibrio cholerae CT 5369-93]
 gi|262032150|gb|EEY50722.1| DNA repair protein RadC [Vibrio cholerae CT 5369-93]
 gi|315178489|gb|ADT85403.1| DNA repair protein RadC-related protein [Vibrio furnissii NCTC
           11218]
          Length = 157

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|315645752|ref|ZP_07898876.1| DNA repair protein RadC [Paenibacillus vortex V453]
 gi|315279230|gb|EFU42540.1| DNA repair protein RadC [Paenibacillus vortex V453]
          Length = 229

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +IA E  S G+++   V+ RE+ +  ++ S+ S++  HNHPSG+P PS  DI
Sbjct: 133 VFLNTKNHVIAQETLSMGSLNASIVHPREVFRAAIKCSSASLVCAHNHPSGDPTPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  ++     + I V DH+IIG  +FVS K   ++
Sbjct: 193 SLTTRLVEAGQIVGIEVLDHLIIGDGSFVSLKERGLM 229


>gi|295688455|ref|YP_003592148.1| DNA repair protein RadC [Caulobacter segnis ATCC 21756]
 gi|295430358|gb|ADG09530.1| DNA repair protein RadC [Caulobacter segnis ATCC 21756]
          Length = 256

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEV +RGT+DH PVY RE+++R LELS+++II+VHNHPSG+P PS  DI
Sbjct: 160 LFLDKKNQLIADEVMNRGTVDHAPVYPREVMRRALELSSSNIIIVHNHPSGDPTPSRPDI 219

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ I+     L I VHDH+++G++   SFK L ++
Sbjct: 220 DMTKQIVEAGKALKIAVHDHLVVGREGVASFKALGLM 256


>gi|209549111|ref|YP_002281028.1| DNA repair protein RadC [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226736629|sp|B5ZMI0|Y1511_RHILW RecName: Full=UPF0758 protein Rleg2_1511
 gi|209534867|gb|ACI54802.1| DNA repair protein RadC [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 275

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/97 (69%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ RGT+DH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 179 LFLDKRNVLIADEVQGRGTVDHTPVYPREVVKRALELSATAMILVHNHPSGDPTPSRADI 238

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II     L+I VHDH+IIGKD  VS KGL++I
Sbjct: 239 DMTKVIIEAAKALDITVHDHVIIGKDGHVSLKGLKLI 275


>gi|25014079|sp|Q9PGZ8|Y148_XYLFA RecName: Full=UPF0758 protein XF_0148
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I+ E    GTI+   V+ RE+V+R L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 128 LFLDNRHRAISFEELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ + DH +IG  A VSF     +
Sbjct: 188 MITQRLKNALDLIDVRLVDHFVIGDGAPVSFAEHGWL 224


>gi|120597983|ref|YP_962557.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
 gi|120558076|gb|ABM24003.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
          Length = 165

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   +GT+D   VY RE+ +R LEL+  ++ILVHNHPSG+P PS++D 
Sbjct: 69  LFLDTKHRVIRFEELFKGTLDAASVYPREVTKRALELNVAAVILVHNHPSGDPEPSESDK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I   DH+++  +  VS      +
Sbjct: 129 RITHRLRDALSLVDIRTLDHVVVASEGCVSLAERGYL 165


>gi|302384219|ref|YP_003820042.1| DNA repair protein RadC [Brevundimonas subvibrioides ATCC 15264]
 gi|302194847|gb|ADL02419.1| DNA repair protein RadC [Brevundimonas subvibrioides ATCC 15264]
          Length = 249

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI DEVQ+RGT+DH PVY RE+V+R LE++A ++ILVHNHPSG+P PS ADI
Sbjct: 153 LYLDNRNQLILDEVQNRGTVDHAPVYPREVVRRGLEVNAKAMILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MTQ II    PLN+ VHDH+I+G++   SFK L ++
Sbjct: 213 DMTQQIIRAARPLNVEVHDHLIVGREGVTSFKQLGLM 249


>gi|299531454|ref|ZP_07044862.1| DNA repair protein RadC [Comamonas testosteroni S44]
 gi|298720617|gb|EFI61566.1| DNA repair protein RadC [Comamonas testosteroni S44]
          Length = 230

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A ++IL HNHPSG+  PS AD 
Sbjct: 134 LFLDSQNRLLALEEMFRGTLTQTSVYPREVVLRALHHQAGAVILAHNHPSGSVQPSSADR 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +   L  +++ V DHII+G  A  S     ++
Sbjct: 194 SLTNTLKAALALIDVRVLDHIIVGPGAACSMAEEGLL 230


>gi|293413072|ref|ZP_06655740.1| radC [Escherichia coli B354]
 gi|291468719|gb|EFF11212.1| radC [Escherichia coli B354]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|146309768|ref|YP_001174842.1| DNA repair protein RadC [Enterobacter sp. 638]
 gi|166918667|sp|A4W511|Y101_ENT38 RecName: Full=UPF0758 protein Ent638_0101
 gi|145316644|gb|ABP58791.1| DNA replication and repair protein RadC [Enterobacter sp. 638]
          Length = 221

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT+ HV V+ REIV+  ++++A ++IL HNHPSG   PS AD 
Sbjct: 125 IFLDNQHRVVKHSRMFSGTLRHVEVHPREIVREAIKVNAAAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ II     ++I V DH IIG+  +VSF     I
Sbjct: 185 DITERIIKCCQFMDIHVLDHFIIGRGEYVSFAEQGWI 221


>gi|157163119|ref|YP_001460437.1| DNA repair protein RadC [Escherichia coli HS]
 gi|166918666|sp|A8A6A0|YICR_ECOHS RecName: Full=UPF0758 protein yicR
 gi|157068799|gb|ABV08054.1| DNA repair protein RadC [Escherichia coli HS]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|50119543|ref|YP_048710.1| putative DNA repair protein [Pectobacterium atrosepticum SCRI1043]
 gi|49610069|emb|CAG73509.1| putative DNA repair protein [Pectobacterium atrosepticum SCRI1043]
          Length = 137

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N LIA E    GTI+ V V+  E+V+R + L+A ++I  HNHPSGN  PS+AD 
Sbjct: 41  MFLNNQNRLIACEFLFAGTINSVEVHPHEVVRRAVLLNAAAVIFAHNHPSGNAEPSNADR 100

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ + + V DHII+G    VSF     +
Sbjct: 101 QITEKLTNALSLIEVRVLDHIIVGHGEIVSFAERGWL 137


>gi|259417142|ref|ZP_05741061.1| DNA repair protein RadC [Silicibacter sp. TrichCH4B]
 gi|259346048|gb|EEW57862.1| DNA repair protein RadC [Silicibacter sp. TrichCH4B]
          Length = 271

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/97 (54%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LIADE Q RGT+DHVPVY RE+ +R LEL+++++ILVHNHPSG+P PS ADI
Sbjct: 175 LYLDRKNVLIADEEQGRGTVDHVPVYPREVAKRALELNSSALILVHNHPSGDPTPSQADI 234

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   L+ L I +HDH+IIG    +SF+   ++
Sbjct: 235 AMTRKVEAALDALGITLHDHLIIGASDELSFRSEGLL 271


>gi|193063880|ref|ZP_03044967.1| DNA repair protein RadC [Escherichia coli E22]
 gi|218697359|ref|YP_002405026.1| DNA repair protein RadC [Escherichia coli 55989]
 gi|256021358|ref|ZP_05435223.1| DNA repair protein RadC [Shigella sp. D9]
 gi|256025632|ref|ZP_05439497.1| DNA repair protein RadC [Escherichia sp. 4_1_40B]
 gi|260846597|ref|YP_003224375.1| protein associated with replication fork [Escherichia coli O103:H2
           str. 12009]
 gi|307140336|ref|ZP_07499692.1| DNA repair protein RadC [Escherichia coli H736]
 gi|172046624|sp|Q31UY8|YICR_SHIBS RecName: Full=UPF0758 protein yicR
 gi|254789650|sp|B7L757|YICR_ECO55 RecName: Full=UPF0758 protein yicR
 gi|192930595|gb|EDV83202.1| DNA repair protein RadC [Escherichia coli E22]
 gi|218354091|emb|CAV00643.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli 55989]
 gi|257761744|dbj|BAI33241.1| protein associated with replication fork [Escherichia coli O103:H2
           str. 12009]
 gi|320176303|gb|EFW51363.1| DNA repair protein RadC [Shigella dysenteriae CDC 74-1112]
 gi|320186822|gb|EFW61542.1| DNA repair protein RadC [Shigella flexneri CDC 796-83]
 gi|323182666|gb|EFZ68069.1| DNA repair protein radC [Escherichia coli 1357]
 gi|323934817|gb|EGB31199.1| DNA repair protein RadC [Escherichia coli E1520]
 gi|324116023|gb|EGC09949.1| DNA repair protein RadC [Escherichia coli E1167]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|323179392|gb|EFZ64959.1| DNA repair protein radC [Escherichia coli 1180]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|300919795|ref|ZP_07136270.1| DNA repair protein RadC [Escherichia coli MS 115-1]
 gi|300413148|gb|EFJ96458.1| DNA repair protein RadC [Escherichia coli MS 115-1]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|161505736|ref|YP_001572848.1| DNA repair protein RadC [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189029401|sp|A9MKN7|YICR_SALAR RecName: Full=UPF0758 protein yicR
 gi|160867083|gb|ABX23706.1| hypothetical protein SARI_03912 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 221

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT+ HV V+ REIV+  ++L+A+++IL HNHPSG   PS AD 
Sbjct: 125 IFLDAQHRVLQHSRLFSGTLSHVEVHPREIVREAIKLNASAVILAHNHPSGCAEPSKADK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +I     ++I V DH+IIG+  +VSF     I
Sbjct: 185 HITDRVIKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 221


>gi|3024521|sp|P72255|Y2304_RHOCA RecName: Full=UPF0758 protein
 gi|1658114|gb|AAB18255.1| RadC [Rhodobacter capsulatus]
          Length = 214

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q+RGT+DHVPVY RE+V+R LEL A+++ILVHNHPSG+P PS ADI
Sbjct: 118 LFLDRKNLLIADEEQARGTVDHVPVYPREVVKRALELDASALILVHNHPSGDPTPSQADI 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L +++HDH++IGK   +SF+   ++
Sbjct: 178 AMTDQIRHAAEALGLVLHDHLVIGKGRELSFRAEGLL 214


>gi|260429142|ref|ZP_05783119.1| DNA repair protein RadC [Citreicella sp. SE45]
 gi|260419765|gb|EEX13018.1| DNA repair protein RadC [Citreicella sp. SE45]
          Length = 254

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE+Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 158 LFLDRKNVLIADELQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSQADI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I    + L I +HDH++IGK   +SF+   ++
Sbjct: 218 DMTAQIQVAADALGITLHDHLVIGKSRELSFRSAGLL 254


>gi|255292016|dbj|BAH90499.1| DNA repair protein RadC [uncultured bacterium]
 gi|255292877|dbj|BAH89977.1| DNA repair protein RadC [uncultured bacterium]
 gi|255292945|dbj|BAH90043.1| DNA repair protein RadC [uncultured bacterium]
 gi|255293215|dbj|BAH90305.1| DNA repair protein RadC [uncultured bacterium]
          Length = 169

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  + LI      RGTID   VY RE+V+  L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 73  LFMDTQHRLIEYAEMFRGTIDSASVYPRELVKEALRLNAAAVIISHNHPSGNPEPSQADK 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++   DHII+      SF    +I
Sbjct: 133 VLTRQLKEVLALVDVRTLDHIIVAGTTTTSFAERGLI 169


>gi|193070384|ref|ZP_03051326.1| DNA repair protein RadC [Escherichia coli E110019]
 gi|192956323|gb|EDV86784.1| DNA repair protein RadC [Escherichia coli E110019]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|315297033|gb|EFU56313.1| DNA repair protein RadC [Escherichia coli MS 16-3]
          Length = 224

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|282600469|ref|ZP_05974415.2| DNA repair protein RadC [Providencia rustigianii DSM 4541]
 gi|282565170|gb|EFB70705.1| DNA repair protein RadC [Providencia rustigianii DSM 4541]
          Length = 234

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  E   +GT++ V V+ REI++  ++++A+SIIL HNHPSGNP PS AD 
Sbjct: 138 IFLNNQNQIICHEEMFKGTVNRVEVHPREILRFAMKMNASSIILAHNHPSGNPEPSIADK 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I +  + + I + DH ++G    VSF     +
Sbjct: 198 QVTERIHSACSIMGIKLLDHFVVGHKHCVSFVERGWL 234


>gi|157155076|ref|YP_001465118.1| DNA repair protein RadC [Escherichia coli E24377A]
 gi|168748714|ref|ZP_02773736.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4113]
 gi|168753462|ref|ZP_02778469.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4401]
 gi|168759735|ref|ZP_02784742.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4501]
 gi|168766058|ref|ZP_02791065.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4486]
 gi|168772396|ref|ZP_02797403.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4196]
 gi|168779793|ref|ZP_02804800.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4076]
 gi|168785514|ref|ZP_02810521.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC869]
 gi|168798583|ref|ZP_02823590.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC508]
 gi|170682096|ref|YP_001745938.1| DNA repair protein RadC [Escherichia coli SMS-3-5]
 gi|191167799|ref|ZP_03029605.1| DNA repair protein RadC [Escherichia coli B7A]
 gi|191170534|ref|ZP_03032087.1| DNA repair protein RadC [Escherichia coli F11]
 gi|194435617|ref|ZP_03067720.1| DNA repair protein RadC [Escherichia coli 101-1]
 gi|195936199|ref|ZP_03081581.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4024]
 gi|208807607|ref|ZP_03249944.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4206]
 gi|208814077|ref|ZP_03255406.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4045]
 gi|208819041|ref|ZP_03259361.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4042]
 gi|209399382|ref|YP_002273116.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4115]
 gi|215488917|ref|YP_002331348.1| DNA repair protein RadC [Escherichia coli O127:H6 str. E2348/69]
 gi|217325841|ref|ZP_03441925.1| DNA repair protein RadC [Escherichia coli O157:H7 str. TW14588]
 gi|218551166|ref|YP_002384957.1| DNA repair protein RadC [Escherichia fergusonii ATCC 35469]
 gi|218556201|ref|YP_002389114.1| DNA repair protein RadC [Escherichia coli IAI1]
 gi|218560710|ref|YP_002393623.1| DNA repair protein RadC [Escherichia coli S88]
 gi|218702404|ref|YP_002410033.1| DNA repair protein RadC [Escherichia coli IAI39]
 gi|218707272|ref|YP_002414791.1| DNA repair protein RadC [Escherichia coli UMN026]
 gi|254795593|ref|YP_003080430.1| DNA repair protein RadC [Escherichia coli O157:H7 str. TW14359]
 gi|260857967|ref|YP_003231858.1| protein associated with replication fork [Escherichia coli O26:H11
           str. 11368]
 gi|261224179|ref|ZP_05938460.1| DNA repair protein RadC [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254790|ref|ZP_05947323.1| DNA repair protein RadC [Escherichia coli O157:H7 str. FRIK966]
 gi|293407261|ref|ZP_06651185.1| radC [Escherichia coli FVEC1412]
 gi|298383007|ref|ZP_06992602.1| DNA repair protein RadC [Escherichia coli FVEC1302]
 gi|306816014|ref|ZP_07450152.1| DNA repair protein RadC [Escherichia coli NC101]
 gi|307314277|ref|ZP_07593885.1| DNA repair protein RadC [Escherichia coli W]
 gi|312968021|ref|ZP_07782232.1| DNA repair protein radC [Escherichia coli 2362-75]
 gi|331659958|ref|ZP_08360896.1| DNA repair protein RadC [Escherichia coli TA206]
 gi|331665263|ref|ZP_08366164.1| DNA repair protein RadC [Escherichia coli TA143]
 gi|54039001|sp|P65958|YICR_ECO57 RecName: Full=UPF0758 protein yicR
 gi|54039002|sp|P65959|YICR_SHIFL RecName: Full=UPF0758 protein yicR
 gi|54041783|sp|P65957|YICR_ECOL6 RecName: Full=UPF0758 protein yicR
 gi|166918665|sp|A7ZTI9|YICR_ECO24 RecName: Full=UPF0758 protein yicR
 gi|171704420|sp|A1AHG9|YICR_ECOK1 RecName: Full=UPF0758 protein yicR
 gi|172045688|sp|Q0SYG5|YICR_SHIF8 RecName: Full=UPF0758 protein yicR
 gi|172045855|sp|Q0TBH1|YICR_ECOL5 RecName: Full=UPF0758 protein yicR
 gi|172046244|sp|Q1R4V4|YICR_ECOUT RecName: Full=UPF0758 protein yicR
 gi|226736620|sp|B7MFJ9|YICR_ECO45 RecName: Full=UPF0758 protein yicR
 gi|226736621|sp|B7NPZ9|YICR_ECO7I RecName: Full=UPF0758 protein yicR
 gi|226736622|sp|B7M4C3|YICR_ECO8A RecName: Full=UPF0758 protein yicR
 gi|226736623|sp|B7NEU2|YICR_ECOLU RecName: Full=UPF0758 protein yicR
 gi|226736624|sp|B1LK75|YICR_ECOSM RecName: Full=UPF0758 protein yicR
 gi|226736625|sp|B7LVJ9|YICR_ESCF3 RecName: Full=UPF0758 protein yicR
 gi|238054488|sp|B5YWD6|YICR_ECO5E RecName: Full=UPF0758 protein yicR
 gi|254789649|sp|B7ULJ3|YICR_ECO27 RecName: Full=UPF0758 protein yicR
 gi|30043347|gb|AAP19068.1| DNA repair protein [Shigella flexneri 2a str. 2457T]
 gi|56383942|gb|AAN45124.2| DNA repair protein [Shigella flexneri 2a str. 301]
 gi|157077106|gb|ABV16814.1| DNA repair protein RadC [Escherichia coli E24377A]
 gi|170519814|gb|ACB17992.1| DNA repair protein RadC [Escherichia coli SMS-3-5]
 gi|187771513|gb|EDU35357.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4196]
 gi|188016882|gb|EDU55004.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4113]
 gi|189002388|gb|EDU71374.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4076]
 gi|189359101|gb|EDU77520.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4401]
 gi|189364789|gb|EDU83208.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4486]
 gi|189369603|gb|EDU88019.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4501]
 gi|189374591|gb|EDU93007.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC869]
 gi|189378726|gb|EDU97142.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC508]
 gi|190902142|gb|EDV61885.1| DNA repair protein RadC [Escherichia coli B7A]
 gi|190909342|gb|EDV68928.1| DNA repair protein RadC [Escherichia coli F11]
 gi|194425160|gb|EDX41144.1| DNA repair protein RadC [Escherichia coli 101-1]
 gi|208727408|gb|EDZ77009.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4206]
 gi|208735354|gb|EDZ84041.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4045]
 gi|208739164|gb|EDZ86846.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4042]
 gi|209160782|gb|ACI38215.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC4115]
 gi|215266989|emb|CAS11434.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217322062|gb|EEC30486.1| DNA repair protein RadC [Escherichia coli O157:H7 str. TW14588]
 gi|218358707|emb|CAQ91363.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia fergusonii ATCC 35469]
 gi|218362969|emb|CAR00606.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli IAI1]
 gi|218367479|emb|CAR05261.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli S88]
 gi|218372390|emb|CAR20264.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli IAI39]
 gi|218434369|emb|CAR15294.1| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli UMN026]
 gi|254594993|gb|ACT74354.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli O157:H7 str. TW14359]
 gi|257756616|dbj|BAI28118.1| protein associated with replication fork [Escherichia coli O26:H11
           str. 11368]
 gi|284923671|emb|CBG36768.1| DNA repair protein [Escherichia coli 042]
 gi|291426072|gb|EFE99106.1| radC [Escherichia coli FVEC1412]
 gi|294489934|gb|ADE88690.1| DNA repair protein RadC [Escherichia coli IHE3034]
 gi|298276843|gb|EFI18361.1| DNA repair protein RadC [Escherichia coli FVEC1302]
 gi|305850410|gb|EFM50867.1| DNA repair protein RadC [Escherichia coli NC101]
 gi|306906100|gb|EFN36619.1| DNA repair protein RadC [Escherichia coli W]
 gi|307628711|gb|ADN73015.1| DNA repair protein RadC [Escherichia coli UM146]
 gi|309704040|emb|CBJ03386.1| DNA repair protein [Escherichia coli ETEC H10407]
 gi|312287280|gb|EFR15189.1| DNA repair protein radC [Escherichia coli 2362-75]
 gi|313647488|gb|EFS11938.1| DNA repair protein radC [Shigella flexneri 2a str. 2457T]
 gi|315062926|gb|ADT77253.1| protein associated with replication fork, possible DNA repair
           protein [Escherichia coli W]
 gi|320191311|gb|EFW65961.1| DNA repair protein RadC [Escherichia coli O157:H7 str. EC1212]
 gi|320193855|gb|EFW68488.1| DNA repair protein RadC [Escherichia coli WV_060327]
 gi|320201337|gb|EFW75918.1| DNA repair protein RadC [Escherichia coli EC4100B]
 gi|320639545|gb|EFX09153.1| hypothetical protein ECO5101_20865 [Escherichia coli O157:H7 str.
           G5101]
 gi|320644984|gb|EFX14014.1| hypothetical protein ECO9389_10227 [Escherichia coli O157:H- str.
           493-89]
 gi|320650251|gb|EFX18740.1| hypothetical protein ECO2687_12698 [Escherichia coli O157:H- str. H
           2687]
 gi|320655603|gb|EFX23531.1| hypothetical protein ECO7815_06054 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661337|gb|EFX28761.1| hypothetical protein ECO5905_11396 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|323155289|gb|EFZ41472.1| DNA repair protein radC [Escherichia coli EPECa14]
 gi|323376481|gb|ADX48749.1| DNA repair protein RadC [Escherichia coli KO11]
 gi|323939603|gb|EGB35809.1| DNA repair protein RadC [Escherichia coli E482]
 gi|323949877|gb|EGB45761.1| DNA repair protein RadC [Escherichia coli H252]
 gi|323954822|gb|EGB50602.1| DNA repair protein RadC [Escherichia coli H263]
 gi|323959886|gb|EGB55534.1| DNA repair protein RadC [Escherichia coli H489]
 gi|323965904|gb|EGB61352.1| DNA repair protein RadC [Escherichia coli M863]
 gi|323971280|gb|EGB66525.1| DNA repair protein RadC [Escherichia coli TA007]
 gi|323975142|gb|EGB70247.1| DNA repair protein RadC [Escherichia coli TW10509]
 gi|324111532|gb|EGC05513.1| DNA repair protein RadC [Escherichia fergusonii B253]
 gi|326337363|gb|EGD61198.1| DNA repair protein RadC [Escherichia coli O157:H7 str. 1044]
 gi|326339888|gb|EGD63695.1| DNA repair protein RadC [Escherichia coli O157:H7 str. 1125]
 gi|327250764|gb|EGE62466.1| DNA repair protein radC [Escherichia coli STEC_7v]
 gi|331053173|gb|EGI25206.1| DNA repair protein RadC [Escherichia coli TA206]
 gi|331057773|gb|EGI29759.1| DNA repair protein RadC [Escherichia coli TA143]
          Length = 222

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|301646528|ref|ZP_07246401.1| DNA repair protein RadC domain protein [Escherichia coli MS 146-1]
 gi|301075233|gb|EFK90039.1| DNA repair protein RadC domain protein [Escherichia coli MS 146-1]
          Length = 116

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 20  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 79

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 80  LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL 116


>gi|268325239|emb|CBH38827.1| probable DNA repair protein radC homolog [uncultured archaeon]
          Length = 329

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N  I DE    GT++   VY REIV+  +  +A S+I VHNHPSG+P PS +D 
Sbjct: 214 IFLDSANQTIDDENLFEGTLNASSVYPREIVKSAVNKNAASLIFVHNHPSGDPTPSGSDR 273

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++++   N + I V DHIIIG + + SF    ++
Sbjct: 274 AITEDLVYACNLVQITVLDHIIIGDNVYFSFADEGLL 310


>gi|148260493|ref|YP_001234620.1| DNA repair protein RadC [Acidiphilium cryptum JF-5]
 gi|146402174|gb|ABQ30701.1| DNA repair protein RadC [Acidiphilium cryptum JF-5]
          Length = 255

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/97 (54%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQS GT++H P+Y RE+++R LE  AT+IILVHNHPSG+P PS  D+
Sbjct: 159 LFLDQRNRLIADEVQSVGTVNHTPLYPRELIRRALEHHATAIILVHNHPSGDPTPSPEDV 218

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I    + L+I++HDH+I+G   +VS K L ++
Sbjct: 219 AMTREIKQAASTLSIVLHDHVIVGNGKWVSLKRLGLL 255


>gi|260580042|ref|ZP_05847872.1| DNA repair protein [Haemophilus influenzae RdAW]
 gi|329122974|ref|ZP_08251545.1| DNA repair protein RadC [Haemophilus aegyptius ATCC 11116]
 gi|260093326|gb|EEW77259.1| DNA repair protein [Haemophilus influenzae RdAW]
 gi|327471905|gb|EGF17345.1| DNA repair protein RadC [Haemophilus aegyptius ATCC 11116]
          Length = 234

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 138 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 198 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 234


>gi|301169677|emb|CBW29278.1| protein associated with replication fork, possible DNA repair
           protein [Haemophilus influenzae 10810]
          Length = 234

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 138 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 198 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 234


>gi|260870368|ref|YP_003236770.1| protein associated with replication fork [Escherichia coli O111:H-
           str. 11128]
 gi|257766724|dbj|BAI38219.1| protein associated with replication fork [Escherichia coli O111:H-
           str. 11128]
          Length = 222

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|188495548|ref|ZP_03002818.1| DNA repair protein RadC [Escherichia coli 53638]
 gi|188490747|gb|EDU65850.1| DNA repair protein RadC [Escherichia coli 53638]
          Length = 222

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|237806959|ref|YP_002891399.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
 gi|259551912|sp|C4L814|Y183_TOLAT RecName: Full=UPF0758 protein Tola_0183
 gi|237499220|gb|ACQ91813.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
          Length = 224

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++       GTID   VY REIVQ  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDNQHRVLRFCELFFGTIDAASVYPREIVQTVLKHNAAAVILCHNHPSGVAEPSHADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I   L  +++ V DH +IG    VSF     +
Sbjct: 188 HITERICDALRLIDVRVLDHFVIGDGDPVSFAERGWL 224


>gi|218691922|ref|YP_002400134.1| DNA repair protein RadC [Escherichia coli ED1a]
 gi|254789651|sp|B7N279|YICR_ECO81 RecName: Full=UPF0758 protein yicR
 gi|218429486|emb|CAR10450.2| protein associated with replication fork, putative DNA repair
           protein [Escherichia coli ED1a]
 gi|222035346|emb|CAP78091.1| DNA repair protein radC [Escherichia coli LF82]
 gi|281180684|dbj|BAI57014.1| DNA repair protein [Escherichia coli SE15]
 gi|312948199|gb|ADR29026.1| DNA repair protein RadC [Escherichia coli O83:H1 str. NRG 857C]
          Length = 222

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|308271126|emb|CBX27735.1| DNA repair protein radC homolog [uncultured Desulfobacterium sp.]
          Length = 243

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I  E   +G++    VY RE+ +  L+  A ++I  HNHPSG+P PS  DI
Sbjct: 133 IFLDAKNKVIRTETLFKGSLTSSSVYPREVAKAALDYHAAALIFAHNHPSGDPAPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + +IVH+HIIIG + + SF     I
Sbjct: 193 AVTRQLIFACKVMGVIVHEHIIIGDNKYFSFADHGYI 229


>gi|110643879|ref|YP_671609.1| DNA repair protein RadC [Escherichia coli 536]
 gi|170018132|ref|YP_001723086.1| DNA repair protein RadC [Escherichia coli ATCC 8739]
 gi|110345471|gb|ABG71708.1| DNA repair protein RadC [Escherichia coli 536]
 gi|169753060|gb|ACA75759.1| DNA repair protein RadC [Escherichia coli ATCC 8739]
 gi|307555737|gb|ADN48512.1| DNA repair protein [Escherichia coli ABU 83972]
          Length = 214

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 118 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 178 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 214


>gi|257869998|ref|ZP_05649651.1| DNA repair protein RadC [Enterococcus gallinarum EG2]
 gi|257804162|gb|EEV32984.1| DNA repair protein RadC [Enterococcus gallinarum EG2]
          Length = 226

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++    + REI    +   A  +I VHNHPSG+P PS ADI
Sbjct: 128 LYLNTKNEIIQKKTLFIGSLNQSIAHPREIYHGAVRCCAARVICVHNHPSGSPQPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ ++     + I + DH+IIG ++++S +   +
Sbjct: 188 TFTKRLMKCGELMGIDLLDHLIIGNNSYISLREEGL 223


>gi|325292997|ref|YP_004278861.1| DNA repair protein RadC [Agrobacterium sp. H13-3]
 gi|325060850|gb|ADY64541.1| DNA repair protein RadC [Agrobacterium sp. H13-3]
          Length = 281

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/97 (70%), Positives = 80/97 (82%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N+LIADEVQ +GT+DH PVY RE+V+R LELS+T++IL+HNHPSG+P PS ADI
Sbjct: 185 LFLDKRNVLIADEVQGQGTVDHTPVYPREVVRRALELSSTALILIHNHPSGDPTPSRADI 244

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIGKD   SFKGLR+I
Sbjct: 245 EMTKTIIDTAKPLGIAVHDHIIIGKDGHASFKGLRLI 281


>gi|330447140|ref|ZP_08310790.1| DNA repair RadC family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491331|dbj|GAA05287.1| DNA repair RadC family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 224

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTID   VY RE+V+R LEL+A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVINGETLFEGTIDCASVYPREVVKRSLELNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  +L  ++I V DH +IG    VSF     +
Sbjct: 188 RITRKISDSLALVDIRVLDHFVIGDGEIVSFAERGWL 224


>gi|319644748|ref|ZP_07998981.1| RadC protein [Bacillus sp. BT1B_CT2]
 gi|317392557|gb|EFV73351.1| RadC protein [Bacillus sp. BT1B_CT2]
          Length = 97

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          ++L+  N +I       G+++   V+ RE+ +  L+ SA S I VHNHPSG+P PS  DI
Sbjct: 1  MYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEALKRSAASFICVHNHPSGDPAPSREDI 60

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +TQ +  +   L I + DHIIIG   FVS K    +
Sbjct: 61 EVTQRLHESGQLLGIELLDHIIIGDQKFVSLKEKGYL 97


>gi|322515256|ref|ZP_08068254.1| DNA repair protein RadC [Actinobacillus ureae ATCC 25976]
 gi|322118761|gb|EFX90967.1| DNA repair protein RadC [Actinobacillus ureae ATCC 25976]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 57/94 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI  E    GTI+   VY REI++  L+ +A +II+ HNHPSG+  PS++D 
Sbjct: 124 MFLDNQNRLIKKEKMFYGTINQATVYPREIIKEALKCNAAAIIVAHNHPSGHCTPSESDR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I    + + I   DHI++GK  + SF+  
Sbjct: 184 ILTKKIEMACDLVEIRFVDHIVVGKGDYFSFEEE 217


>gi|259906759|ref|YP_002647115.1| DNA repair protein RadC [Erwinia pyrifoliae Ep1/96]
 gi|224962381|emb|CAX53836.1| DNA repair protein RadC [Erwinia pyrifoliae Ep1/96]
 gi|283476545|emb|CAY72373.1| Glutaredoxin 3 [Erwinia pyrifoliae DSM 12163]
          Length = 223

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F D  + +I       GT++ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 127 IFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALILAHNHPSGLAEPSRADR 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+   + +NI V DH++IG+  +VSF     +
Sbjct: 187 DITQQIVHACSLMNIRVLDHMVIGRGEYVSFAERGWM 223


>gi|324019747|gb|EGB88966.1| DNA repair protein RadC [Escherichia coli MS 117-3]
          Length = 215

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 119 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 178

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 179 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 215


>gi|331685301|ref|ZP_08385887.1| DNA repair protein RadC [Escherichia coli H299]
 gi|331077672|gb|EGI48884.1| DNA repair protein RadC [Escherichia coli H299]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|253995755|ref|YP_003047819.1| DNA repair protein RadC [Methylotenera mobilis JLW8]
 gi|253982434|gb|ACT47292.1| DNA repair protein RadC [Methylotenera mobilis JLW8]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L A E    GT+    VY RE+V+R +  +A S+IL HNHPSG    S AD 
Sbjct: 128 LFLDAQNRLNAAEELFSGTLTQTSVYPREVVKRAMHHNAASVILAHNHPSGVAQQSAADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH I+  +  +SF    ++
Sbjct: 188 LLTQQLKQALALVDVRVLDHFIVAGNQTLSFAERGLL 224


>gi|145301064|ref|YP_001143905.1| DNA repair protein RadC [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853836|gb|ABO92157.1| DNA repair protein RadC [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 327

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I       GT+D   V+ REIVQ  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 231 LLLDNQHRVIQFVELFYGTLDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADR 290

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I+  L  ++I V DH++IG    VSF     +
Sbjct: 291 QITDRILAALALIDIRVLDHLVIGDGITVSFAERGWL 327


>gi|89067385|ref|ZP_01154898.1| DNA repair protein RadC [Oceanicola granulosus HTCC2516]
 gi|89046954|gb|EAR53008.1| DNA repair protein RadC [Oceanicola granulosus HTCC2516]
          Length = 255

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+L+ADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 159 LFLDRKNVLVADEEQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSQADI 218

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I    + L I++HDHI+IG+   +SF+   ++
Sbjct: 219 DMTAQIARAADALGILLHDHIVIGRSRELSFRAEGLL 255


>gi|325277161|ref|ZP_08142806.1| DNA repair protein RadC [Pseudomonas sp. TJI-51]
 gi|324097699|gb|EGB95900.1| DNA repair protein RadC [Pseudomonas sp. TJI-51]
          Length = 165

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +IA E   RGT+D   VY REIV+  LE +A +IILVHNHPSG+P PS AD 
Sbjct: 69  LMLDSRHRVIAFEEVFRGTLDGASVYPREIVKIALEHNAAAIILVHNHPSGDPEPSQADR 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   LN + +   DH+++G++  VS      +
Sbjct: 129 NLTTKLQDALNLVGVRTLDHVVVGQEDCVSLAERGYL 165


>gi|300927932|ref|ZP_07143491.1| DNA repair protein RadC [Escherichia coli MS 187-1]
 gi|300464024|gb|EFK27517.1| DNA repair protein RadC [Escherichia coli MS 187-1]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGKYVSFAERGWI 224


>gi|300948028|ref|ZP_07162169.1| DNA repair protein RadC [Escherichia coli MS 116-1]
 gi|300954468|ref|ZP_07166918.1| DNA repair protein RadC [Escherichia coli MS 175-1]
 gi|300318547|gb|EFJ68331.1| DNA repair protein RadC [Escherichia coli MS 175-1]
 gi|300452423|gb|EFK16043.1| DNA repair protein RadC [Escherichia coli MS 116-1]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHCRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|293417099|ref|ZP_06659726.1| DNA repair protein RadC [Escherichia coli B185]
 gi|291431130|gb|EFF04123.1| DNA repair protein RadC [Escherichia coli B185]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 128 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 188 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 224


>gi|126734464|ref|ZP_01750211.1| DNA repair protein RadC [Roseobacter sp. CCS2]
 gi|126717330|gb|EBA14194.1| DNA repair protein RadC [Roseobacter sp. CCS2]
          Length = 255

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 59/96 (61%), Positives = 74/96 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +IADE Q++GT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PSDADI
Sbjct: 155 LFLDTKNTVIADEEQAKGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSDADI 214

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I      L IIVHDH+IIGK    SF+ L +
Sbjct: 215 QMTRQIDAAAKSLGIIVHDHLIIGKSNETSFRALGL 250


>gi|330505620|ref|YP_004382489.1| DNA repair protein RadC [Pseudomonas mendocina NK-01]
 gi|328919906|gb|AEB60737.1| DNA repair protein RadC [Pseudomonas mendocina NK-01]
          Length = 234

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  RG+ID   VY R++V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 138 LFLDAKHRVLAFEVLFRGSIDSASVYPRQVVKRSLANNAAAVILTHNHPSGVSEPSQADR 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  + + V DH I+G    +S   L  +
Sbjct: 198 VLTQRLKDALALVEVRVLDHFIVGDGEPLSMAELGWM 234


>gi|21243016|ref|NP_642598.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108524|gb|AAM37134.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 164

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +IA E  + GTI+   V+ R +V+R +EL+A ++IL HNHPSG    S AD 
Sbjct: 68  VFLDNKHRVIAFEALALGTINQAIVHPRVVVRRAMELNAAAVILAHNHPSGETQDSTADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L+ ++I V DH+I+GK    SF    ++
Sbjct: 128 MLTERLRSALDFVDIRVLDHVIVGKGTPYSFAQAGLL 164


>gi|326403686|ref|YP_004283768.1| DNA repair protein RadC [Acidiphilium multivorum AIU301]
 gi|325050548|dbj|BAJ80886.1| DNA repair protein RadC [Acidiphilium multivorum AIU301]
          Length = 255

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/97 (54%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQS GT++H P+Y RE+++R LE  AT+IILVHNHPSG+P PS  D+
Sbjct: 159 LFLDQRNRLIADEVQSVGTVNHTPLYPRELIRRALEHHATAIILVHNHPSGDPTPSPEDV 218

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I    + L+I++HDH+I+G   +VS K L ++
Sbjct: 219 AMTREIKQAASTLSIVLHDHVIVGNGKWVSLKRLGLL 255


>gi|308070402|ref|YP_003872007.1| DNA repair protein radC [Paenibacillus polymyxa E681]
 gi|305859681|gb|ADM71469.1| DNA repair protein radC [Paenibacillus polymyxa E681]
          Length = 230

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +IA E  S G+++   V+ RE+ +  ++ S+ SII  HNHPSG+P PS  D+
Sbjct: 134 LFLNTKNHVIAQETLSMGSLNSAIVHPREVFRAAIKCSSASIICAHNHPSGDPKPSPEDV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++   N + I V DHI+IG   FVS K   +I
Sbjct: 194 QLTRRLMEAGNIVGIDVLDHIVIGDGTFVSLKEQGLI 230


>gi|153208645|ref|ZP_01946897.1| DNA repair protein RadC [Coxiella burnetii 'MSU Goat Q177']
 gi|154707167|ref|YP_001425121.1| DNA repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|165919790|ref|ZP_02219533.1| DNA repair protein RadC [Coxiella burnetii RSA 334]
 gi|212218127|ref|YP_002304914.1| DNA repair protein [Coxiella burnetii CbuK_Q154]
 gi|189029394|sp|A9KGS6|Y1789_COXBN RecName: Full=UPF0758 protein CBUD_1789
 gi|238054487|sp|B6J5S7|Y488_COXB1 RecName: Full=UPF0758 protein CbuK_0488
 gi|120575831|gb|EAX32455.1| DNA repair protein RadC [Coxiella burnetii 'MSU Goat Q177']
 gi|154356453|gb|ABS77915.1| DNA repair protein [Coxiella burnetii Dugway 5J108-111]
 gi|165916873|gb|EDR35477.1| DNA repair protein RadC [Coxiella burnetii RSA 334]
 gi|212012389|gb|ACJ19769.1| DNA repair protein [Coxiella burnetii CbuK_Q154]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    G+I+   V+ REI++R L  ++ ++I+ HNHPSG P+PS AD 
Sbjct: 128 LFLDNRHRIIQFEKLFYGSINQASVHPREIIKRALYHNSAALIVAHNHPSGVPDPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T ++   L  +++ + DHIIIG     SF    ++
Sbjct: 188 AATTHLKEALALIDVRLLDHIIIGDRNSFSFAESGLL 224


>gi|86136816|ref|ZP_01055394.1| DNA repair protein RadC [Roseobacter sp. MED193]
 gi|85826140|gb|EAQ46337.1| DNA repair protein RadC [Roseobacter sp. MED193]
          Length = 258

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADE Q+RGT+DHVPVY RE+ +R L+L+A+++ILVHNHPSG+P PS +DI
Sbjct: 162 LFLDRKNCLIADEEQARGTVDHVPVYPREVAKRALDLNASALILVHNHPSGDPTPSASDI 221

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I   L PL + +HDH+IIG DA +SF+   ++
Sbjct: 222 DMTGRINQALTPLGVTLHDHLIIGSDAELSFRSEGLL 258


>gi|310643582|ref|YP_003948340.1| DNA repair protein radc [Paenibacillus polymyxa SC2]
 gi|309248532|gb|ADO58099.1| DNA repair protein RadC [Paenibacillus polymyxa SC2]
          Length = 230

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +IA E  S G+++   V+ RE+ +  ++ S+ SII  HNHPSG+P PS  D+
Sbjct: 134 LFLNTKNHVIAQETLSMGSLNSAIVHPREVFRAAIKCSSASIICAHNHPSGDPKPSPEDV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++   N + I V DHI+IG   FVS K   +I
Sbjct: 194 QLTRRLMEAGNIVGIDVLDHIVIGDGTFVSLKEQGLI 230


>gi|297581793|ref|ZP_06943714.1| DNA repair protein RadC family protein [Vibrio cholerae RC385]
 gi|297533887|gb|EFH72727.1| DNA repair protein RadC family protein [Vibrio cholerae RC385]
          Length = 157

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEINAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|310765969|gb|ADP10919.1| DNA repair protein RadC [Erwinia sp. Ejp617]
          Length = 223

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F D  + +I       GT++ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 127 IFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALILAHNHPSGLAEPSRADR 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+   + +NI V DH++IG+  +VSF     +
Sbjct: 187 DITQQIVHACSLMNIRVLDHMVIGRGEYVSFAERGWM 223


>gi|26248376|ref|NP_754416.1| putative radC-like protein yeeS [Escherichia coli CFT073]
 gi|26108780|gb|AAN80983.1|AE016762_236 Putative radC-like protein yeeS [Escherichia coli CFT073]
          Length = 148

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++  L  +A +++L HNHPSG   PS AD 
Sbjct: 52  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKCALYHNAAAVVLAHNHPSGEVTPSKADR 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 112 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 148


>gi|70733334|ref|YP_263109.1| DNA repair protein RadC [Pseudomonas fluorescens Pf-5]
 gi|123652038|sp|Q4K3S4|Y6051_PSEF5 RecName: Full=UPF0758 protein PFL_6051
 gi|68347633|gb|AAY95239.1| DNA repair protein RadC [Pseudomonas fluorescens Pf-5]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  EV  +G+ID   VY R++++R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDTRHRVLTFEVLFQGSIDSTTVYPRQVIKRALAHNAAAVILCHNHPSGICEPSPADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+G+   +S      I
Sbjct: 188 VVTRRLQEALELIDVRVLDHFIVGEGDPLSMAEYGWI 224


>gi|301028397|ref|ZP_07191643.1| DNA repair protein RadC [Escherichia coli MS 196-1]
 gi|299878508|gb|EFI86719.1| DNA repair protein RadC [Escherichia coli MS 196-1]
          Length = 222

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHCRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|91774671|ref|YP_544427.1| DNA repair protein RadC [Methylobacillus flagellatus KT]
 gi|122985645|sp|Q1H4K1|Y315_METFK RecName: Full=UPF0758 protein Mfla_0315
 gi|91708658|gb|ABE48586.1| DNA replication and repair protein RadC [Methylobacillus
           flagellatus KT]
          Length = 224

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E    GT+    VY RE+V+  L  +A ++I  HNHPSG P PS AD 
Sbjct: 128 IFLDAQHRVLAVEELFSGTLTQTSVYPREVVKCALRHNAAAMIFAHNHPSGVPEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   LN ++I V DH ++  +  VSF    +I
Sbjct: 188 ALTEALKAALNLIDIRVLDHFVVAGNQLVSFSERGLI 224


>gi|188993439|ref|YP_001905449.1| DNA repair protein RadC [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167735199|emb|CAP53411.1| DNA repair protein radC homolog [Xanthomonas campestris pv.
           campestris]
          Length = 243

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++++ HNHPSGNP PS+AD 
Sbjct: 146 LFLDSRHRAIAFEELFTGTIDAAEIHPREVVRRALLHNAAAVVVGHNHPSGNPEPSEADR 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I + DH +IG    VS      +
Sbjct: 206 AVTQRLLQALGLVDIRLLDHFVIGDGRPVSLAERGWV 242


>gi|226311419|ref|YP_002771313.1| DNA repair protein RadC [Brevibacillus brevis NBRC 100599]
 gi|226094367|dbj|BAH42809.1| probable DNA repair protein RadC [Brevibacillus brevis NBRC 100599]
          Length = 232

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G++D   V+ RE+ +  +  S+ S+I +HNHPSG+P PS  DI
Sbjct: 136 LFLNTKNHVIGKQTIFVGSLDASIVHPREVFKEAIRRSSASVICLHNHPSGDPTPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DH+IIG+  +VS K    +
Sbjct: 196 AITHTLRDAGELVGISLLDHVIIGEGKYVSLKEQGYL 232


>gi|261418366|ref|YP_003252048.1| DNA repair protein RadC [Geobacillus sp. Y412MC61]
 gi|319767675|ref|YP_004133176.1| DNA repair protein RadC [Geobacillus sp. Y412MC52]
 gi|261374823|gb|ACX77566.1| DNA repair protein RadC [Geobacillus sp. Y412MC61]
 gi|317112541|gb|ADU95033.1| DNA repair protein RadC [Geobacillus sp. Y412MC52]
          Length = 226

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA S+I VHNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIYRKTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   FVS K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFVSLKEKGYV 226


>gi|110642215|ref|YP_669945.1| putative radC-like protein YeeS [Escherichia coli 536]
 gi|110343807|gb|ABG70044.1| putative radC-like protein YeeS [Escherichia coli 536]
          Length = 158

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+  E+++  L  +A +++L HNHPSG   PS AD 
Sbjct: 62  LYLNNQNQLIAGETLFTGTINRTEVHPWEVIKCALYHNAAAVVLAHNHPSGEVTPSKADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 122 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 158


>gi|227821958|ref|YP_002825929.1| DNA repair protein RadC [Sinorhizobium fredii NGR234]
 gi|254789656|sp|C3MBW4|Y1397_RHISN RecName: Full=UPF0758 protein NGR_c13970
 gi|227340958|gb|ACP25176.1| DNA repair protein RadC [Sinorhizobium fredii NGR234]
          Length = 263

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 66/96 (68%), Positives = 75/96 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ +GTIDH PVY RE+V+R LELSAT++IL HNHPSG+P PS ADI
Sbjct: 167 LFLDKRNALIADEVQQQGTIDHTPVYPREVVKRALELSATALILAHNHPSGDPTPSRADI 226

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I     PL I VHDH+IIGKD  VS KGLR+
Sbjct: 227 EMTKLIAEAAKPLGITVHDHVIIGKDGHVSMKGLRL 262


>gi|253771521|ref|YP_003034352.1| DNA repair protein RadC [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254163566|ref|YP_003046674.1| DNA repair protein RadC [Escherichia coli B str. REL606]
 gi|297521446|ref|ZP_06939832.1| DNA repair protein RadC [Escherichia coli OP50]
 gi|242379162|emb|CAQ33964.1| hypothetical protein B21_03447 [Escherichia coli BL21(DE3)]
 gi|253322565|gb|ACT27167.1| DNA repair protein RadC [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975467|gb|ACT41138.1| DNA repair protein RadC [Escherichia coli B str. REL606]
 gi|253979623|gb|ACT45293.1| DNA repair protein RadC [Escherichia coli BL21(DE3)]
          Length = 222

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGKYVSFAERGWI 222


>gi|160947462|ref|ZP_02094629.1| hypothetical protein PEPMIC_01396 [Parvimonas micra ATCC 33270]
 gi|158446596|gb|EDP23591.1| hypothetical protein PEPMIC_01396 [Parvimonas micra ATCC 33270]
          Length = 287

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I+ +  S+G ++   V+ RE+ +  L  SA SII +HNHPSG+P PS  DI
Sbjct: 190 LLLDTKNKIISWDEISKGDLNSSIVHPREVFKYALRYSANSIICLHNHPSGDPTPSSQDI 249

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +    + + I + DHIIIG + +VS K   ++
Sbjct: 250 DITKRLEEVGDLVGIRLLDHIIIGYNKYVSLKEKGLM 286


>gi|229846012|ref|ZP_04466124.1| DNA repair protein RadC [Haemophilus influenzae 7P49H1]
 gi|229811016|gb|EEP46733.1| DNA repair protein RadC [Haemophilus influenzae 7P49H1]
          Length = 214

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 118 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 178 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 214


>gi|222110476|ref|YP_002552740.1| DNA repair protein Radc [Acidovorax ebreus TPSY]
 gi|221729920|gb|ACM32740.1| DNA repair protein RadC [Acidovorax ebreus TPSY]
          Length = 168

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI      RGTID   VY RE+V+  L L+A +++  HNHPSG+P PS AD 
Sbjct: 72  LFLDSQHRLIEYVELFRGTIDQASVYPREVVKEALRLNAAAVVFSHNHPSGSPEPSQADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++   DHI++G     SF    ++
Sbjct: 132 VLTQRLKEALALVDVRTLDHIVVGGAVTTSFAECGLL 168


>gi|257888395|ref|ZP_05668048.1| DNA repair protein RadC [Enterococcus faecium 1,141,733]
 gi|257824449|gb|EEV51381.1| DNA repair protein RadC [Enterococcus faecium 1,141,733]
          Length = 230

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 131 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 191 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGLM 227


>gi|254513496|ref|ZP_05125561.1| DNA repair protein RadC [Rhodobacteraceae bacterium KLH11]
 gi|221532500|gb|EEE35496.1| DNA repair protein RadC [Rhodobacteraceae bacterium KLH11]
          Length = 312

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+LI+DE Q++GT+DHVPVY REIV+R LEL+A+S+ILVHNHPSG+P PS +DI
Sbjct: 213 LYLDRKNVLISDEEQAKGTVDHVPVYPREIVKRALELNASSLILVHNHPSGDPTPSRSDI 272

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  ++   + L I++HDH+IIGK    SF     +
Sbjct: 273 EMTDRVLDACDTLGILIHDHVIIGKKEEYSFSANGFL 309


>gi|285017189|ref|YP_003374900.1| DNA repair protein radc [Xanthomonas albilineans GPE PC73]
 gi|283472407|emb|CBA14912.1| probable dna repair protein radc [Xanthomonas albilineans]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E   +GT+D   V+ RE+V+R L L+A +II+ HNHPSGNP PS AD 
Sbjct: 128 LFLDTRHRWLAFEELFQGTVDWTEVHPREVVRRALTLNAAAIIIGHNHPSGNPEPSSADF 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ +++ + DH IIG    +S      I
Sbjct: 188 AVTERLRKALDLIDVRLLDHFIIGDGMPISLASRGWI 224


>gi|308174501|ref|YP_003921206.1| DNA repair protein [Bacillus amyloliquefaciens DSM 7]
 gi|307607365|emb|CBI43736.1| putative DNA repair protein [Bacillus amyloliquefaciens DSM 7]
 gi|328554420|gb|AEB24912.1| hypothetical protein BAMTA208_13755 [Bacillus amyloliquefaciens
           TA208]
 gi|328912824|gb|AEB64420.1| putative DNA repair protein [Bacillus amyloliquefaciens LL3]
          Length = 231

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I VHNHPSG+P PS  DI
Sbjct: 135 LYLNTKNQVIHKRTIFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|85859097|ref|YP_461299.1| DNA repair protein [Syntrophus aciditrophicus SB]
 gi|85722188|gb|ABC77131.1| DNA repair protein [Syntrophus aciditrophicus SB]
          Length = 308

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N +IA E   +G ++   VY R++++R L   ++++ILVHNHPSG   PSDADI
Sbjct: 210 LYLDTQNRIIAFETIQKGIVNQAVVYPRQVIERALSHKSSALILVHNHPSGFVKPSDADI 269

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  T   L+I+VHDH+IIG++ F SF+   I+
Sbjct: 270 RLTRTITDTAKLLDIMVHDHLIIGENRFFSFREEGIM 306


>gi|268325704|emb|CBH39292.1| probable DNA repair protein radC homolog [uncultured archaeon]
          Length = 330

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N  I DE    GT++   VY REIV+  +  +A S+I VHNHPSG+P PS +D 
Sbjct: 215 IFLDSANQTIDDENLFEGTLNASSVYPREIVKSAVNKNAASLIFVHNHPSGDPTPSGSDR 274

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++I   N + I V DHIIIG + + SF    ++
Sbjct: 275 AITEDLIYACNLVQITVLDHIIIGDNVYFSFADEGLL 311


>gi|153834271|ref|ZP_01986938.1| DNA repair protein RadC [Vibrio harveyi HY01]
 gi|148869373|gb|EDL68382.1| DNA repair protein RadC [Vibrio harveyi HY01]
          Length = 305

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + + + E    GT++   VY RE+V++ L  +A+++I  HNHPSG   PS AD 
Sbjct: 209 IFLDNQHRVRSSEELFTGTVNAASVYPREVVKKALAENASAVIFYHNHPSGVAEPSQADR 268

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  +++ V DH ++  +  VSF     I
Sbjct: 269 RITRRLIDALALIDVRVLDHFVVSFEDTVSFAERGWI 305


>gi|145640620|ref|ZP_01796203.1| DNA repair protein RadC [Haemophilus influenzae R3021]
 gi|145274546|gb|EDK14409.1| DNA repair protein RadC [Haemophilus influenzae 22.4-21]
          Length = 221

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 221


>gi|68249540|ref|YP_248652.1| DNA repair protein RadC [Haemophilus influenzae 86-028NP]
 gi|68057739|gb|AAX87992.1| DNA repair protein RadC homolog [Haemophilus influenzae 86-028NP]
          Length = 234

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 138 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 198 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 234


>gi|21233283|ref|NP_639200.1| DNA repair protein RadC [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66770241|ref|YP_245003.1| DNA repair protein RadC [Xanthomonas campestris pv. campestris str.
           8004]
 gi|25009021|sp|Q8P456|Y3860_XANCP RecName: Full=UPF0758 protein XCC3860
 gi|81303811|sp|Q4UPP0|Y3944_XANC8 RecName: Full=UPF0758 protein XC_3944
 gi|21115121|gb|AAM43091.1| DNA repair protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66575573|gb|AAY50983.1| DNA repair protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 225

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++++ HNHPSGNP PS+AD 
Sbjct: 128 LFLDSRHRAIAFEELFTGTIDAAEIHPREVVRRALLHNAAAVVVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++  L  ++I + DH +IG    VS      +
Sbjct: 188 AVTQRLLQALGLVDIRLLDHFVIGDGRPVSLAERGWV 224


>gi|197120145|ref|YP_002140572.1| DNA repair protein RadC [Geobacter bemidjiensis Bem]
 gi|197089505|gb|ACH40776.1| protein of unknown function DUF2466 [Geobacter bemidjiensis Bem]
          Length = 231

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I+    S G+++   V+ RE+    +  SA ++IL+HNHP+G+P PS  D+
Sbjct: 135 LLLDGKNRIISRAQISEGSLNQSIVHPREVFNVAVRHSAAAMILLHNHPTGDPAPSPEDM 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I V DHIIIG++ F SF     +
Sbjct: 195 EVTRRLCEAGQLLGIRVLDHIIIGENEFYSFAEHGRL 231


>gi|323166879|gb|EFZ52618.1| DNA repair radC domain protein [Shigella sonnei 53G]
          Length = 171

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 75  IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 134

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 135 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 171


>gi|262273497|ref|ZP_06051311.1| DNA repair protein RadC [Grimontia hollisae CIP 101886]
 gi|262222475|gb|EEY73786.1| DNA repair protein RadC [Grimontia hollisae CIP 101886]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N  IADE+   GTI+   VY RE+V+R LEL A ++IL HNHPSG   PS+AD 
Sbjct: 128 LYLDNQNRPIADEILFEGTINTAGVYPREVVKRSLELGANAVILAHNHPSGIAEPSNADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I   L  ++I + DH++IG    VSF     I
Sbjct: 188 HITHRIGDALALVDIRLLDHMVIGDGDVVSFAERGWI 224


>gi|167035736|ref|YP_001670967.1| DNA repair protein RadC [Pseudomonas putida GB-1]
 gi|166862224|gb|ABZ00632.1| DNA repair protein RadC [Pseudomonas putida GB-1]
          Length = 162

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGT+D   VY RE+V+  LE +A ++I+VHNHPSG+P PS AD 
Sbjct: 66  LLLDSKHRVIGFRELFRGTLDGASVYPREVVKIALEHNAAAVIMVHNHPSGDPEPSQADR 125

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   LN +   + DH+++G +  VS      +
Sbjct: 126 TLTTTLKNALNMVGTRILDHVVVGHEGCVSLAEQGYL 162


>gi|320666351|gb|EFX33350.1| hypothetical protein ECOSU61_04303 [Escherichia coli O157:H7 str.
           LSU-61]
          Length = 222

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +N+ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMNLRVLDHIVIGRGEYVSFAERGWI 222


>gi|154686939|ref|YP_001422100.1| DNA repair protein RadC [Bacillus amyloliquefaciens FZB42]
 gi|166218774|sp|A7Z793|Y2509_BACA2 RecName: Full=UPF0758 protein RBAM_025090
 gi|154352790|gb|ABS74869.1| RadC [Bacillus amyloliquefaciens FZB42]
          Length = 231

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I VHNHPSG+P PS  DI
Sbjct: 135 LYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|15640534|ref|NP_230161.1| DNA repair protein RadC-related protein [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|153822183|ref|ZP_01974850.1| DNA repair protein RadC family protein [Vibrio cholerae B33]
 gi|229509016|ref|ZP_04398504.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229519684|ref|ZP_04409127.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229606200|ref|YP_002876848.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|254850747|ref|ZP_05240097.1| DNA repair protein RadC family protein [Vibrio cholerae MO10]
 gi|13431999|sp|Q9KUK8|Y510_VIBCH RecName: Full=UPF0758 protein VC_0510
 gi|9654937|gb|AAF93680.1| DNA repair protein RadC-related protein [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|126520318|gb|EAZ77541.1| DNA repair protein RadC family protein [Vibrio cholerae B33]
 gi|229344373|gb|EEO09348.1| DNA repair protein RadC [Vibrio cholerae RC9]
 gi|229353941|gb|EEO18875.1| DNA repair protein RadC [Vibrio cholerae B33]
 gi|229368855|gb|ACQ59278.1| DNA repair protein RadC [Vibrio cholerae MJ-1236]
 gi|254846452|gb|EET24866.1| DNA repair protein RadC family protein [Vibrio cholerae MO10]
          Length = 157

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  TL  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDTLALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|227354791|ref|ZP_03839208.1| DNA repair protein [Proteus mirabilis ATCC 29906]
 gi|227165109|gb|EEI49940.1| DNA repair protein [Proteus mirabilis ATCC 29906]
          Length = 165

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I  E   +GT+D V V+ REI+++ ++ +A SIIL HNHPSG   PS AD 
Sbjct: 69  LFLDNQNQMIDCEEMFKGTVDRVEVHPREIIRQSIKKNAASIILAHNHPSGLSEPSLADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I T    + I V DH+++G D  VSF     +
Sbjct: 129 QMTEKIFTACQLVGIKVLDHLVVGHDNCVSFAERGWL 165


>gi|161615563|ref|YP_001589528.1| hypothetical protein SPAB_03337 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|200390680|ref|ZP_03217291.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205351604|ref|YP_002225405.1| hypothetical protein SG0271 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|161364927|gb|ABX68695.1| hypothetical protein SPAB_03337 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|199603125|gb|EDZ01671.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205271385|emb|CAR36178.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326626631|gb|EGE32974.1| Putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 159

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E    GTI+H  V+ RE+V+  L+ +A ++I+ H HPSG  +PS AD 
Sbjct: 63  LFLDNQHRLIAHETLFSGTINHTQVHPREVVKSGLKHNAAAVIVAHCHPSGLADPSLADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ ++I + DH+++G    VSF     +
Sbjct: 123 QITERLRQALDLVDIRLLDHLVVGGMEIVSFAERGWL 159


>gi|220936022|ref|YP_002514921.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997332|gb|ACL73934.1| DNA repair protein RadC [Thioalkalivibrio sp. HL-EbGR7]
          Length = 166

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +IA E    GTID   VY R +++R +E + +++I  HNHPSG   PS AD 
Sbjct: 70  VFLDSQHRVIAFEPMFHGTIDGASVYPRAVLKRAIEHNCSAVIFAHNHPSGVTEPSHADK 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  +++ V DH I+G++   SF    ++
Sbjct: 130 AITTRLKSVLELVDVRVLDHFIVGEETPFSFAEAGLL 166


>gi|254448902|ref|ZP_05062357.1| DNA repair protein RadC [gamma proteobacterium HTCC5015]
 gi|198261439|gb|EDY85729.1| DNA repair protein RadC [gamma proteobacterium HTCC5015]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + +I  E   RGT+D   VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LWLDTRHRVILYEELFRGTLDGASVYPREVVKAALKHNAAAVIFAHNHPSGIAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DHI+IG     S     ++
Sbjct: 188 HITRRLKDALGLVDIRVLDHIVIGDGEHSSLANRGLL 224


>gi|300024876|ref|YP_003757487.1| DNA repair protein RadC [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526697|gb|ADJ25166.1| DNA repair protein RadC [Hyphomicrobium denitrificans ATCC 51888]
          Length = 254

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY+RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 158 LFLDKKNALIADEVQGRGTVDHTPVYVREVVKRALELSATAIILVHNHPSGDPTPSRADI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ II    PL + VHDH+I+G+    S K LR+I
Sbjct: 218 DVTKQIIDAAKPLGVTVHDHVIVGRHGHASLKALRLI 254


>gi|297537568|ref|YP_003673337.1| DNA repair protein RadC [Methylotenera sp. 301]
 gi|297256915|gb|ADI28760.1| DNA repair protein RadC [Methylotenera sp. 301]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N ++  E    GT+    VY RE+V+R L  +A S+I  HNHPSG    S AD 
Sbjct: 128 LFLDAQNRVVTTEEMFSGTLTQTSVYPREVVKRALHHNAASVIFAHNHPSGLAQQSQADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  +  +SF    ++
Sbjct: 188 LITKQLKEALALVDVRVLDHFIVAGNTTLSFVERGLL 224


>gi|319775112|ref|YP_004137600.1| DNA repair protein RadC-like protein [Haemophilus influenzae F3047]
 gi|309973545|gb|ADO96746.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
 gi|317449703|emb|CBY85910.1| DNA repair protein RadC homolog [Haemophilus influenzae F3047]
          Length = 221

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 221


>gi|260847121|ref|YP_003224899.1| putative DNA repair protein [Escherichia coli O103:H2 str. 12009]
 gi|257762268|dbj|BAI33765.1| predicted DNA repair protein [Escherichia coli O103:H2 str. 12009]
          Length = 180

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+++HV V+ RE+V+  L  +A +++L HNHPSG+P PS  D 
Sbjct: 84  LYLDNQHRLLESETLFAGSVNHVQVHSREVVKSALRFNAAAVVLAHNHPSGDPEPSQCDR 143

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   L  +++   DH+++G+D  VSF     +
Sbjct: 144 NITGRLKEALELVDVKTLDHLVVGRDGIVSFAERGWL 180


>gi|257897231|ref|ZP_05676884.1| DNA repair protein RadC [Enterococcus faecium Com12]
 gi|293378003|ref|ZP_06624181.1| DNA repair protein RadC [Enterococcus faecium PC4.1]
 gi|293570378|ref|ZP_06681435.1| DNA repair protein RadC [Enterococcus faecium E980]
 gi|257833796|gb|EEV60217.1| DNA repair protein RadC [Enterococcus faecium Com12]
 gi|291609556|gb|EFF38821.1| DNA repair protein RadC [Enterococcus faecium E980]
 gi|292643368|gb|EFF61500.1| DNA repair protein RadC [Enterococcus faecium PC4.1]
          Length = 230

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 131 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 191 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGLM 227


>gi|83592071|ref|YP_425823.1| DNA repair protein RadC [Rhodospirillum rubrum ATCC 11170]
 gi|83574985|gb|ABC21536.1| DNA repair protein RadC [Rhodospirillum rubrum ATCC 11170]
          Length = 243

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 66/96 (68%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIADE+Q  GTI+H PVY RE+ +R LEL A +II+VHNHPSG+P PS AD 
Sbjct: 147 LFLDNRNRLIADELQQTGTINHTPVYPREVARRALELHAAAIIMVHNHPSGDPAPSAADQ 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           +MT  +   L  + + +HDHI++ +   VSF+   +
Sbjct: 207 DMTLQVRDALRAVGVGLHDHIVVARGGHVSFRSQGL 242


>gi|28198053|ref|NP_778367.1| DNA repair protein RadC [Xylella fastidiosa Temecula1]
 gi|32129952|sp|Q87F21|Y117_XYLFT RecName: Full=UPF0758 protein PD_0117
 gi|28056113|gb|AAO28016.1| DNA repair protein [Xylella fastidiosa Temecula1]
 gi|307579143|gb|ADN63112.1| DNA repair protein RadC [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 224

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I+ E    GTI+   V+ RE+V+R L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 128 LFLDNRHRAISFEELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ + DH +IG  A VSF     +
Sbjct: 188 MITQRLKNALDLIDVRLVDHFVIGDGAPVSFAEHGWL 224


>gi|191165826|ref|ZP_03027664.1| DNA repair protein RadC [Escherichia coli B7A]
 gi|190904150|gb|EDV63861.1| DNA repair protein RadC [Escherichia coli B7A]
          Length = 157

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+  E    GTI+   V+ REIV+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQNRLLEHETLFLGTINSTEVHPREIVKSALRHNAAAVILAHNHPSGVAEPSRADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T NI+ TL+ +N+ V DH IIG    +SF     +
Sbjct: 121 LITTNIVKTLDLVNVRVLDHFIIGAGDVLSFAERGWL 157


>gi|293557235|ref|ZP_06675783.1| DNA repair protein RadC [Enterococcus faecium E1039]
 gi|291600599|gb|EFF30903.1| DNA repair protein RadC [Enterococcus faecium E1039]
          Length = 230

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 131 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 191 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGMM 227


>gi|229918383|ref|YP_002887029.1| DNA repair protein RadC [Exiguobacterium sp. AT1b]
 gi|229469812|gb|ACQ71584.1| DNA repair protein RadC [Exiguobacterium sp. AT1b]
          Length = 209

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA +    G ++   V+ R++ +  L+LSA   I VHNHPSG+  PS  DI
Sbjct: 111 LYLNTKNQLIARKTLFVGGLNSSIVHPRDVFREALKLSAACFIAVHNHPSGDATPSREDI 170

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +++ ++   N + I   DH+IIG+D +VS K    +
Sbjct: 171 EVSERLVEAGNIVGIACLDHVIIGEDHYVSMKQRGYM 207


>gi|262191336|ref|ZP_06049528.1| DNA repair protein RadC [Vibrio cholerae CT 5369-93]
 gi|262032791|gb|EEY51337.1| DNA repair protein RadC [Vibrio cholerae CT 5369-93]
          Length = 157

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|169831623|ref|YP_001717605.1| DNA repair protein RadC [Candidatus Desulforudis audaxviator
           MP104C]
 gi|229485551|sp|B1I4S0|Y1467_DESAP RecName: Full=UPF0758 protein Daud_1467
 gi|169638467|gb|ACA59973.1| DNA repair protein RadC [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 230

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N ++A E  S GT++   V+ RE+ +  +  SA ++ILVHNHPSG+P PS  DI
Sbjct: 134 LVLNTKNRVLAVEKVSVGTLNSSSVHPRELFKNAIRRSAAALILVHNHPSGDPAPSPQDI 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ +      + I V DHIIIG + F S K   +
Sbjct: 194 ELTQRLFEAGEIVGIKVLDHIIIGDNKFTSLKLEGL 229


>gi|145632338|ref|ZP_01788073.1| DNA repair protein RadC [Haemophilus influenzae 3655]
 gi|145634128|ref|ZP_01789839.1| DNA repair protein RadC [Haemophilus influenzae PittAA]
 gi|145637257|ref|ZP_01792918.1| DNA repair protein RadC [Haemophilus influenzae PittHH]
 gi|229843987|ref|ZP_04464128.1| DNA repair protein RadC [Haemophilus influenzae 6P18H1]
 gi|144987245|gb|EDJ93775.1| DNA repair protein RadC [Haemophilus influenzae 3655]
 gi|145268572|gb|EDK08565.1| DNA repair protein RadC [Haemophilus influenzae PittAA]
 gi|145269509|gb|EDK09451.1| DNA repair protein RadC [Haemophilus influenzae PittHH]
 gi|229812981|gb|EEP48669.1| DNA repair protein RadC [Haemophilus influenzae 6P18H1]
          Length = 214

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 118 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 178 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 214


>gi|157373074|ref|YP_001481063.1| DNA repair protein RadC [Serratia proteamaculans 568]
 gi|172047792|sp|A8GLE5|Y4842_SERP5 RecName: Full=UPF0758 protein Spro_4842
 gi|157324838|gb|ABV43935.1| DNA repair protein RadC [Serratia proteamaculans 568]
          Length = 227

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI  V VY REIV+  L+ +A +IIL HNHPSG   PS AD 
Sbjct: 131 LFLDNQHRVIRHQEMFAGTISSVVVYPREIVREALKANAAAIILAHNHPSGKAEPSHADR 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DH++IG+   VSF     +
Sbjct: 191 LITEQVVNACLLLEIRVLDHLVIGRGECVSFAERGWL 227


>gi|264679954|ref|YP_003279863.1| DNA repair protein RadC [Comamonas testosteroni CNB-2]
 gi|262210469|gb|ACY34567.1| DNA repair protein RadC [Comamonas testosteroni CNB-2]
          Length = 230

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A ++IL HNHPSGN  PS AD 
Sbjct: 134 LFLDSQNRLLALEEMFRGTLTQTSVYPREVVLRALHHQAGAVILAHNHPSGNVQPSSADS 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHII+G  A  S     ++
Sbjct: 194 ALTATLKAALALIDVRVLDHIIVGPGAACSMAEEGLL 230


>gi|148560082|ref|YP_001259197.1| DNA repair protein RadC [Brucella ovis ATCC 25840]
 gi|254706546|ref|ZP_05168374.1| DNA repair protein RadC [Brucella pinnipedialis M163/99/10]
 gi|256160029|ref|ZP_05457727.1| DNA repair protein RadC [Brucella ceti M490/95/1]
 gi|256255238|ref|ZP_05460774.1| DNA repair protein RadC [Brucella ceti B1/94]
 gi|261222434|ref|ZP_05936715.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314006|ref|ZP_05953203.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|265998402|ref|ZP_06110959.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|148371339|gb|ABQ61318.1| DNA repair protein RadC [Brucella ovis ATCC 25840]
 gi|260921018|gb|EEX87671.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261303032|gb|EEY06529.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553009|gb|EEZ08860.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 246

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 71/92 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 153 LFLDKKNKLIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
           +MT+ ++     LNI VHDH+IIGK    S +
Sbjct: 213 DMTKQLVNAAKALNITVHDHVIIGKHGHASLR 244


>gi|110807685|ref|YP_691205.1| DNA repair protein RadC [Shigella flexneri 5 str. 8401]
 gi|110617233|gb|ABF05900.1| DNA repair protein [Shigella flexneri 5 str. 8401]
          Length = 209

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 113 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 172

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 173 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 209


>gi|312963850|ref|ZP_07778321.1| hypothetical protein PFWH6_5769 [Pseudomonas fluorescens WH6]
 gi|311281885|gb|EFQ60495.1| hypothetical protein PFWH6_5769 [Pseudomonas fluorescens WH6]
          Length = 224

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E  S+GTID   VY R++V+R L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDSRHRVLGFEALSQGTIDTALVYPRQVVKRALAYNAAALILCHNHPSGVAQPSAADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   L  +++ V DHII+G    +S      +
Sbjct: 188 KMTKTLQKALEVVDVRVLDHIIVGDGDPLSMAEYGWM 224


>gi|292486566|ref|YP_003529434.1| glutaredoxin 3 [Erwinia amylovora CFBP1430]
 gi|292897804|ref|YP_003537173.1| DNA repair protein [Erwinia amylovora ATCC 49946]
 gi|291197652|emb|CBJ44747.1| DNA repair protein [Erwinia amylovora ATCC 49946]
 gi|291551981|emb|CBA19018.1| Glutaredoxin 3 [Erwinia amylovora CFBP1430]
 gi|312170627|emb|CBX78890.1| Glutaredoxin 3 [Erwinia amylovora ATCC BAA-2158]
          Length = 223

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F D  + +I       GT++ V V+ REIV+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 127 IFFDNQHRVIHTSEMFSGTLNSVEVHPREIVREALKRNAAALILAHNHPSGLAEPSRADR 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I+   + +NI V DH++IG+  +VSF     +
Sbjct: 187 DITLQIVRACSLMNIRVLDHMVIGRGEYVSFAERGWM 223


>gi|311069296|ref|YP_003974219.1| DNA repair protein RadC [Bacillus atrophaeus 1942]
 gi|310869813|gb|ADP33288.1| DNA repair protein RadC [Bacillus atrophaeus 1942]
          Length = 231

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I +HNHPSG+P PS  DI
Sbjct: 135 LYLNTKNEVIHKRTIFIGSLNSSIVHPREVFKEAFKRSAASFICIHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|209917488|ref|YP_002291572.1| hypothetical protein ECSE_0297 [Escherichia coli SE11]
 gi|209910747|dbj|BAG75821.1| hypothetical phage protein [Escherichia coli SE11]
          Length = 180

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+I+HV V+ RE+V+  L  +A +++L HNHPSG+P PS  D 
Sbjct: 84  LYLDNQHRLLESETLFAGSINHVQVHPREVVKSALRFNAAAVVLAHNHPSGDPEPSQCDR 143

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   L  +++   DH++IG D  VSF     I
Sbjct: 144 NITGRLKEALALVDVNTLDHLVIGSDGIVSFAERGWI 180


>gi|317494719|ref|ZP_07953131.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917321|gb|EFV38668.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 228

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI+ V VY REIV+  L+++A ++IL HNHPSG   PS AD 
Sbjct: 132 LFLDNQHRVIRSEEMFSGTINCVDVYPREIVRGALKVNAVALILAHNHPSGIAEPSAADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L+I V DH++IG    VSF     +
Sbjct: 192 VLTERVVKACALLDIRVLDHMVIGHGQSVSFAERGWL 228


>gi|28867326|ref|NP_789945.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213970685|ref|ZP_03398810.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato T1]
 gi|301382572|ref|ZP_07230990.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato Max13]
 gi|302063061|ref|ZP_07254602.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato K40]
 gi|302133591|ref|ZP_07259581.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|37999601|sp|Q88BD1|Y086_PSESM RecName: Full=UPF0758 protein PSPTO_0086
 gi|28850560|gb|AAO53640.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213924519|gb|EEB58089.1| DNA repair protein RadC [Pseudomonas syringae pv. tomato T1]
 gi|331018553|gb|EGH98609.1| hypothetical protein PLA106_21168 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 224

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R L  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRALAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALKLVDVHVLDHVIVGDGEPLSMVEKGLM 224


>gi|227550362|ref|ZP_03980411.1| DNA repair protein RadC [Enterococcus faecium TX1330]
 gi|227180501|gb|EEI61473.1| DNA repair protein RadC [Enterococcus faecium TX1330]
          Length = 225

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 126 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 186 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGLM 222


>gi|166713831|ref|ZP_02245038.1| DNA repair protein RadC [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 225

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LFMDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++ +L  ++I + DH +IG    VS      +
Sbjct: 188 AVTKRLLDSLELVDIRLLDHFVIGDGRPVSLAERGWL 224


>gi|260576196|ref|ZP_05844189.1| DNA repair protein RadC [Rhodobacter sp. SW2]
 gi|259021676|gb|EEW24979.1| DNA repair protein RadC [Rhodobacter sp. SW2]
          Length = 256

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q++GT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS+ADI
Sbjct: 160 LFLDRKNVLIADEAQAKGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSEADI 219

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I      L I ++DH+IIGKD  +SF+    +
Sbjct: 220 SVTMQIQDAAATLGITLYDHLIIGKDRELSFRAQGYL 256


>gi|257885023|ref|ZP_05664676.1| DNA repair protein RadC [Enterococcus faecium 1,231,501]
 gi|257890249|ref|ZP_05669902.1| DNA repair protein RadC [Enterococcus faecium 1,231,410]
 gi|258616808|ref|ZP_05714578.1| DNA repair protein RadC [Enterococcus faecium DO]
 gi|260559754|ref|ZP_05831934.1| DNA repair protein RadC [Enterococcus faecium C68]
 gi|293559749|ref|ZP_06676270.1| DNA repair protein RadC [Enterococcus faecium E1162]
 gi|293567615|ref|ZP_06678959.1| DNA repair protein RadC [Enterococcus faecium E1071]
 gi|257820875|gb|EEV48009.1| DNA repair protein RadC [Enterococcus faecium 1,231,501]
 gi|257826609|gb|EEV53235.1| DNA repair protein RadC [Enterococcus faecium 1,231,410]
 gi|260074422|gb|EEW62744.1| DNA repair protein RadC [Enterococcus faecium C68]
 gi|291589716|gb|EFF21520.1| DNA repair protein RadC [Enterococcus faecium E1071]
 gi|291606297|gb|EFF35710.1| DNA repair protein RadC [Enterococcus faecium E1162]
          Length = 230

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 131 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 191 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGMM 227


>gi|261210081|ref|ZP_05924379.1| DNA repair protein RadC [Vibrio sp. RC341]
 gi|260840846|gb|EEX67388.1| DNA repair protein RadC [Vibrio sp. RC341]
          Length = 157

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|325917528|ref|ZP_08179731.1| DNA replication and repair protein RadC [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536244|gb|EGD08037.1| DNA replication and repair protein RadC [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 243

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  IA E    GTID   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 146 LFLDNRHRAIAFEELFTGTIDGADIHPREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L+ ++I + DH +IG    VS      +
Sbjct: 206 AVTRRLLQGLDLVDIRLLDHFVIGDGRPVSLAERGWL 242


>gi|85708932|ref|ZP_01039998.1| DNA repair protein RadC [Erythrobacter sp. NAP1]
 gi|85690466|gb|EAQ30469.1| DNA repair protein RadC [Erythrobacter sp. NAP1]
          Length = 272

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 64/97 (65%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI D     G+ID   ++ RE+++R +++ A+++ILVHNHPSG+P PS AD+
Sbjct: 176 LYLDAKNRLIDDHHVGDGSIDEAAIHPREVIRRAMDVGASALILVHNHPSGSPEPSRADV 235

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I      L + +HDH+I+G++  VS +   +I
Sbjct: 236 QITQKIAEAGRLLGVTLHDHVIVGREGHVSLRAKGLI 272


>gi|118577341|ref|YP_899581.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
 gi|118504846|gb|ABL01328.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
          Length = 168

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  +  S G+++   V+ RE+ +  L  +A +II VH HPSG+PNPS  D+
Sbjct: 72  LHLDGKNRIMCMDRVSIGSLNQSIVHPREVFKTALLSNAAAIICVHQHPSGDPNPSSEDL 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I V DHI++G + ++SF    ++
Sbjct: 132 SITKRLKEAGEIMGIRVLDHIVVGHEDYISFVEKGLM 168


>gi|71899272|ref|ZP_00681434.1| DNA repair protein RadC [Xylella fastidiosa Ann-1]
 gi|71731005|gb|EAO33074.1| DNA repair protein RadC [Xylella fastidiosa Ann-1]
          Length = 242

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I+ E    GTI+   V+ RE+V+R L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 146 LFLDNRHRAISFEELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQ 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ + DH +IG  A VSF     +
Sbjct: 206 MITQRLKNALDLIDVRLVDHFVIGDGAPVSFAEHGWL 242


>gi|261820014|ref|YP_003258120.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
 gi|261604027|gb|ACX86513.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
          Length = 158

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N LI+ E    GTI+ V V+  E+ ++ + L+A ++I  HNHPSGN  PS+AD 
Sbjct: 62  LFLNNQNRLISCEFLFAGTINSVEVHPGEVARQAIRLNAAAVIFAHNHPSGNAEPSNADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L+ + I V DH+++G    VSF     +
Sbjct: 122 KITEKLVNALSLIEIRVLDHVVVGHGEIVSFAERGWL 158


>gi|261405382|ref|YP_003241623.1| DNA repair protein RadC [Paenibacillus sp. Y412MC10]
 gi|329928472|ref|ZP_08282340.1| DNA repair protein RadC [Paenibacillus sp. HGF5]
 gi|261281845|gb|ACX63816.1| DNA repair protein RadC [Paenibacillus sp. Y412MC10]
 gi|328937731|gb|EGG34139.1| DNA repair protein RadC [Paenibacillus sp. HGF5]
          Length = 229

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +IA E  S G+++   V+ RE+ +  ++ S+ S++  HNHPSG+P PS  DI
Sbjct: 133 VFLNTKNHVIAQETLSMGSLNASIVHPREVFRAAIKCSSASLVCAHNHPSGDPTPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  ++     + I V DH+IIG  +FVS K   ++
Sbjct: 193 SLTARLVEAGQIVGIDVLDHLIIGDGSFVSLKERGLM 229


>gi|257899232|ref|ZP_05678885.1| DNA repair protein RadC [Enterococcus faecium Com15]
 gi|257837144|gb|EEV62218.1| DNA repair protein RadC [Enterococcus faecium Com15]
          Length = 230

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 131 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 191 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGLM 227


>gi|134093935|ref|YP_001099010.1| putative DNA repair protein; putative CP4-6 prophage [Herminiimonas
           arsenicoxydans]
 gi|133737838|emb|CAL60883.1| putative DNA repair protein RadC [Herminiimonas arsenicoxydans]
          Length = 175

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  N +IA E    GTI    VY R IVQR + L+A S+IL HNHPSG+  PSDAD 
Sbjct: 78  VFMDTQNRVIAYEPLFFGTIHQTSVYPRVIVQRAMSLNAASMILAHNHPSGSTQPSDADK 137

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  +++ V DH IIG++   SF    ++
Sbjct: 138 QLTNRLKSLLESIDVRVLDHFIIGEEGTFSFAEHGLL 174


>gi|238796699|ref|ZP_04640205.1| DNA repair protein RadC [Yersinia mollaretii ATCC 43969]
 gi|238719430|gb|EEQ11240.1| DNA repair protein RadC [Yersinia mollaretii ATCC 43969]
          Length = 161

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+A E    G+I    V+ RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 63  LYLDNQHRLLACETLFTGSIRSTEVHPREVVKAALRHNAAAVILAHNHPSGEAEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  L  +++ V DH+I+G    VSF     +
Sbjct: 123 QITDRLVNALALVDVKVLDHLIVGGLDIVSFTERGWL 159


>gi|229512565|ref|ZP_04402036.1| DNA repair protein RadC [Vibrio cholerae TMA 21]
 gi|229350458|gb|EEO15407.1| DNA repair protein RadC [Vibrio cholerae TMA 21]
          Length = 157

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFQGTVDAASVYPREVVKTVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDICTSFAERGWL 157


>gi|163733013|ref|ZP_02140457.1| DNA repair protein RadC [Roseobacter litoralis Och 149]
 gi|161393548|gb|EDQ17873.1| DNA repair protein RadC [Roseobacter litoralis Och 149]
          Length = 253

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N +IADE Q++GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS +DI
Sbjct: 157 LFLDRKNTVIADEEQAKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQSDI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I      L + +HDH+IIGK   +SF+    +
Sbjct: 217 SMTDQINAACQTLGLTLHDHLIIGKSTELSFRAEGYL 253


>gi|315641420|ref|ZP_07896493.1| DNA repair protein RadC [Enterococcus italicus DSM 15952]
 gi|315482807|gb|EFU73330.1| DNA repair protein RadC [Enterococcus italicus DSM 15952]
          Length = 226

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 52/96 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G+++    + REI +  + +SA  IIL HNHPSGNP PS  D+
Sbjct: 129 LYLNTKNEIIKKETLFIGSLNQSVAHPREIFKGAVRVSAARIILTHNHPSGNPKPSSHDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I V DH+IIG   +VS +    
Sbjct: 189 QFTKRVKECGEMMGIEVLDHLIIGTRRYVSLREEGF 224


>gi|253998052|ref|YP_003050115.1| DNA repair protein RadC [Methylovorus sp. SIP3-4]
 gi|253984731|gb|ACT49588.1| DNA repair protein RadC [Methylovorus sp. SIP3-4]
          Length = 224

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++A E    GT+    V+ REIV+R L  +A ++IL HNHPSG   PS +D 
Sbjct: 128 IFLDAQNRVLAHEEMFAGTLTQTSVHPREIVKRALYYNAGAVILAHNHPSGVAEPSRSDE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + T L+ +++ V DH ++  +  +SF    ++
Sbjct: 188 MITAQLKTALDLVDVRVLDHFVVAGNTTLSFAERGLL 224


>gi|260220445|emb|CBA27989.1| DNA repair protein radC homolog [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 239

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 143 LFLDSQNKLLAMEELFRGTLTQTSVYPREVVIRALHHGAAAVVLAHNHPSGSVQPSRADE 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G    +S     +I
Sbjct: 203 ALTQTLKAALALVDVRVLDHIIVGPGQALSMAETGLI 239


>gi|296136107|ref|YP_003643349.1| DNA repair protein RadC [Thiomonas intermedia K12]
 gi|295796229|gb|ADG31019.1| DNA repair protein RadC [Thiomonas intermedia K12]
          Length = 226

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E  SRGT+    VY RE+V+  L L+A ++IL HNHPSG   PS AD 
Sbjct: 130 LFLDNQHQLIASEELSRGTLASTSVYPREVVKAALRLNAGALILAHNHPSGLAEPSAADR 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+++ +   VSF    ++
Sbjct: 190 ALTQTLKAALALVDVRVLDHLVVTRHNVVSFAERGLL 226


>gi|71275890|ref|ZP_00652173.1| DNA repair protein RadC [Xylella fastidiosa Dixon]
 gi|71901383|ref|ZP_00683476.1| DNA repair protein RadC [Xylella fastidiosa Ann-1]
 gi|170729361|ref|YP_001774794.1| DNA repair protein RadC [Xylella fastidiosa M12]
 gi|182680681|ref|YP_001828841.1| DNA repair protein RadC [Xylella fastidiosa M23]
 gi|71163267|gb|EAO12986.1| DNA repair protein RadC [Xylella fastidiosa Dixon]
 gi|71728842|gb|EAO30980.1| DNA repair protein RadC [Xylella fastidiosa Ann-1]
 gi|167964154|gb|ACA11164.1| DNA repair protein [Xylella fastidiosa M12]
 gi|182630791|gb|ACB91567.1| DNA repair protein RadC [Xylella fastidiosa M23]
          Length = 242

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I+ E    GTI+   V+ RE+V+R L L+A ++I+ HNHPSGN  PS AD 
Sbjct: 146 LFLDNRHRAISFEELFHGTINGAEVHPREVVRRALTLNAAAVIVGHNHPSGNREPSPADQ 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ + DH +IG  A VSF     +
Sbjct: 206 MITQRLKNALDLIDVRLVDHFVIGDGAPVSFAEHGWL 242


>gi|269103917|ref|ZP_06156614.1| DNA repair protein RadC [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163815|gb|EEZ42311.1| DNA repair protein RadC [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 224

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTID   VY REIV+R LEL+A + IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVICGEALFFGTIDSASVYPREIVKRSLELNAAAAILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I   L  ++I V DH +IG    VSF     +
Sbjct: 188 RITQKISDALALVDIRVLDHFVIGDGELVSFAERGWL 224


>gi|117619575|ref|YP_854693.1| DNA repair protein RadC [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|166218772|sp|A0KEM8|Y160_AERHH RecName: Full=UPF0758 protein AHA_0160
 gi|117560982|gb|ABK37930.1| DNA repair protein RadC [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 224

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I       GT+D   V+ REIVQ  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDNQHRVIQFVELFYGTLDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  ++I V DH++IG    VSF     +
Sbjct: 188 QITDRITAALALIDIRVLDHLVIGDGITVSFAERGWL 224


>gi|69246244|ref|ZP_00603857.1| DNA repair protein RadC [Enterococcus faecium DO]
 gi|68195345|gb|EAN09794.1| DNA repair protein RadC [Enterococcus faecium DO]
          Length = 226

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 127 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 187 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGMM 223


>gi|260774791|ref|ZP_05883693.1| DNA repair protein RadC [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609216|gb|EEX35371.1| DNA repair protein RadC [Vibrio coralliilyticus ATCC BAA-450]
          Length = 157

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  + + V DH I+  D+  SF     +
Sbjct: 122 RITERLKDALALVEVRVLDH-IVTGDSCTSFAERGWL 157


>gi|149184792|ref|ZP_01863110.1| hypothetical protein ED21_28778 [Erythrobacter sp. SD-21]
 gi|148832112|gb|EDL50545.1| hypothetical protein ED21_28778 [Erythrobacter sp. SD-21]
          Length = 232

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 65/97 (67%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI D + + G+ID   ++ RE+++R  ++ A+++ILVHNHPSG+P PS ADI
Sbjct: 136 LYLDTRNRLIDDHLAAEGSIDEAAIHPREVIRRAFDVGASALILVHNHPSGDPEPSRADI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      LNI VHDH+I+G+ + VS +   +I
Sbjct: 196 QITARIAEAGRLLNITVHDHVIVGRGSHVSLRAKGLI 232


>gi|95931398|ref|ZP_01314108.1| DNA repair protein RadC [Desulfuromonas acetoxidans DSM 684]
 gi|95132554|gb|EAT14243.1| DNA repair protein RadC [Desulfuromonas acetoxidans DSM 684]
          Length = 233

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N L+ D   S G++    V+ RE+    +  SA +++ VHNHPSG+P PS  DI
Sbjct: 134 LLLDAKNRLLKDVRISEGSLTASIVHPREVFTAVVRESAAAVLFVHNHPSGDPTPSREDI 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +    + L + V DHIIIG D++ S     ++
Sbjct: 194 SITQRLKEAGDLLGVRVLDHIIIGHDSYTSLAEQGLM 230


>gi|323955396|gb|EGB51165.1| DNA repair protein RadC [Escherichia coli H263]
          Length = 98

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 2  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALHHNAAAVVLAHNHPSGEVTPSKADR 61

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 62 LITERLVQALGLVDIRVPDHLIVGGSQVFSFAEHGLL 98


>gi|254466524|ref|ZP_05079935.1| DNA repair protein RadC [Rhodobacterales bacterium Y4I]
 gi|206687432|gb|EDZ47914.1| DNA repair protein RadC [Rhodobacterales bacterium Y4I]
          Length = 254

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q+RGT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PSD+DI
Sbjct: 158 LFLDRKNVLIADEEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSDSDI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I+  L  L I +HDH+IIGK   +SF+   ++
Sbjct: 218 GMTDQILAALTALGITLHDHLIIGKSTELSFRAQGLL 254


>gi|323173231|gb|EFZ58860.1| DNA repair protein radC [Escherichia coli LT-68]
          Length = 214

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 118 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   + + V DHI+IG+  +VSF     I
Sbjct: 178 LITERIIKSCQFMELRVLDHIVIGRGEYVSFAERGWI 214


>gi|323486933|ref|ZP_08092249.1| DNA repair protein RadC [Clostridium symbiosum WAL-14163]
 gi|323691981|ref|ZP_08106230.1| DNA repair protein RadC [Clostridium symbiosum WAL-14673]
 gi|323399796|gb|EGA92178.1| DNA repair protein RadC [Clostridium symbiosum WAL-14163]
 gi|323503990|gb|EGB19803.1| DNA repair protein RadC [Clostridium symbiosum WAL-14673]
          Length = 230

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N+LI D +  RGT++      RE+    L   A  IILVHNHPSG+P+PS  D 
Sbjct: 134 MMLNTKNVLIKDSLIFRGTVNMSVASPREMFIEALRYHAVHIILVHNHPSGDPSPSSEDK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      L I + DHIIIG +++ SFK   II
Sbjct: 194 KLTAQVKEAGALLGIRLLDHIIIGDNSYFSFKERGII 230


>gi|16079856|ref|NP_390682.1| DNA repair protein RadC [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221310744|ref|ZP_03592591.1| DNA repair protein RadC [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315069|ref|ZP_03596874.1| DNA repair protein RadC [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319988|ref|ZP_03601282.1| DNA repair protein RadC [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324270|ref|ZP_03605564.1| DNA repair protein RadC [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|321312335|ref|YP_004204622.1| hypothetical protein BSn5_04835 [Bacillus subtilis BSn5]
 gi|400964|sp|Q02170|YSXA_BACSU RecName: Full=UPF0758 protein ysxA
 gi|142854|gb|AAA22396.1| homologous to E. coli radC gene product and to unidentified protein
           from Staphylococcus aureus [Bacillus subtilis]
 gi|143162|gb|AAA22583.1| orfB [Bacillus subtilis]
 gi|2635269|emb|CAB14764.1| putative DNA repair protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320018609|gb|ADV93595.1| hypothetical protein BSn5_04835 [Bacillus subtilis BSn5]
          Length = 231

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I VHNHPSG+P PS  DI
Sbjct: 135 LYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|325577760|ref|ZP_08148035.1| DNA repair protein RadC [Haemophilus parainfluenzae ATCC 33392]
 gi|325160505|gb|EGC72631.1| DNA repair protein RadC [Haemophilus parainfluenzae ATCC 33392]
          Length = 221

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVTNVYPREIIKESLSCNAAALILAHNHPSGLAEPSYSDK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ II     ++I + DH I+GK    SF    ++
Sbjct: 185 MITQKIIEAAELMDIRILDHFIVGKGTCYSFAEHNLL 221


>gi|84387383|ref|ZP_00990403.1| DNA repair protein [Vibrio splendidus 12B01]
 gi|84377832|gb|EAP94695.1| DNA repair protein [Vibrio splendidus 12B01]
          Length = 156

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI  E   +GTID   VY RE+V+  L+ +A ++I  HNHPSG+  PS AD 
Sbjct: 61  MLLDNQHRLIEFEELFQGTIDAASVYPREVVKTALKANAAAVIFAHNHPSGDSAPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHI++G +   SF     +
Sbjct: 121 RITTRLQDALALIDVRVLDHIVVG-EQCTSFAERGWL 156


>gi|170766630|ref|ZP_02901083.1| DNA repair protein RadC [Escherichia albertii TW07627]
 gi|170124068|gb|EDS92999.1| DNA repair protein RadC [Escherichia albertii TW07627]
          Length = 250

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++       GT++HV V+ REIV+  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVLTHSRLFSGTLNHVEVHPREIVREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   + + V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMELRVLDHIVIGRGEYVSFAERGWI 222


>gi|325919704|ref|ZP_08181706.1| DNA replication and repair protein RadC [Xanthomonas gardneri ATCC
           19865]
 gi|325549812|gb|EGD20664.1| DNA replication and repair protein RadC [Xanthomonas gardneri ATCC
           19865]
          Length = 225

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  +  IA E    GT+D   ++ RE+V+R L  +A ++I+ HNHPSGNP PS+AD 
Sbjct: 128 LYLDTKHHAIAFEELFTGTLDGADIHTREVVRRALLHNAAAVIVGHNHPSGNPEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L+ + I + DH +IG    VS      +
Sbjct: 188 AVTKRLLEALDLVEIRLLDHFVIGDGRPVSLAERGWL 224


>gi|254516157|ref|ZP_05128217.1| DNA repair protein RadC [gamma proteobacterium NOR5-3]
 gi|219675879|gb|EED32245.1| DNA repair protein RadC [gamma proteobacterium NOR5-3]
          Length = 132

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGTID   VY R +V+R LEL+A ++IL HNHPSG PNPS AD 
Sbjct: 36  LFLDSQHRLIAFERLFRGTIDGASVYPRVVVKRALELNAAALILTHNHPSGLPNPSSADS 95

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DHI++G +   S     ++
Sbjct: 96  KITQRLQDALALVDIRVLDHIVVGVEGTQSMAERGLL 132


>gi|156936681|ref|YP_001436032.1| DNA repair protein RadC [Vibrio harveyi ATCC BAA-1116]
 gi|156529928|gb|ABU75012.1| hypothetical protein VIBHAR_p08165 [Vibrio harveyi ATCC BAA-1116]
          Length = 305

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + + + E    GT++   VY RE+V++ L  +A+++I  HNHPSG   PS AD 
Sbjct: 209 IFLDNQHRVRSSEDLFTGTVNAASVYPREVVKKALAENASAVIFYHNHPSGVAEPSQADR 268

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  +++ V DH ++  +  VSF     I
Sbjct: 269 RITRRLIDALALIDVKVLDHFVVSFEGTVSFAERGWI 305


>gi|229032108|ref|ZP_04188086.1| DNA repair protein radC [Bacillus cereus AH1271]
 gi|228729198|gb|EEL80196.1| DNA repair protein radC [Bacillus cereus AH1271]
          Length = 240

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 144 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 203

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 204 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 240


>gi|138896185|ref|YP_001126638.1| DNA repair protein RadC [Geobacillus thermodenitrificans NG80-2]
 gi|196250140|ref|ZP_03148834.1| DNA repair protein RadC [Geobacillus sp. G11MC16]
 gi|166218780|sp|A4IRD9|Y2548_GEOTN RecName: Full=UPF0758 protein GTNG_2548
 gi|134267698|gb|ABO67893.1| DNA repair protein [Geobacillus thermodenitrificans NG80-2]
 gi|196210324|gb|EDY05089.1| DNA repair protein RadC [Geobacillus sp. G11MC16]
          Length = 226

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA S+I VHNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIHRKTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   F+S K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFISLKEKGYV 226


>gi|82776320|ref|YP_402669.1| putative radC-like protein yeeS [Shigella dysenteriae Sd197]
 gi|309786791|ref|ZP_07681411.1| DNA repair RadC family protein [Shigella dysenteriae 1617]
 gi|81240468|gb|ABB61178.1| Putative radC-like protein yeeS [Shigella dysenteriae Sd197]
 gi|308925484|gb|EFP70971.1| DNA repair RadC family protein [Shigella dysenteriae 1617]
          Length = 150

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 54  LYLNNQNQLIAGEPLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVIPSKADR 113

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  ++I V DH+I+G     SF    ++
Sbjct: 114 LITERLVQALGLVDIRVPDHLIVGSSQVFSFAEHGLL 150


>gi|148261604|ref|YP_001235731.1| DNA repair protein RadC [Acidiphilium cryptum JF-5]
 gi|146403285|gb|ABQ31812.1| DNA repair protein RadC [Acidiphilium cryptum JF-5]
          Length = 246

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N L+ADEV SRGT++H  VY+RE+V+R +E  AT++ILVHNHPSG+P+PS  D+
Sbjct: 145 IYLDNRNRLLADEVASRGTVNHTQVYVREVVRRAIETRATALILVHNHPSGDPSPSRDDV 204

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   +  L+I +HDH+IIGK  ++SF+    +
Sbjct: 205 EMTREVQRAVALLDITLHDHVIIGKAGWLSFRREGFL 241


>gi|238853957|ref|ZP_04644314.1| DNA repair protein [Lactobacillus gasseri 202-4]
 gi|282851637|ref|ZP_06261002.1| DNA repair protein RadC [Lactobacillus gasseri 224-1]
 gi|238833402|gb|EEQ25682.1| DNA repair protein [Lactobacillus gasseri 202-4]
 gi|282557605|gb|EFB63202.1| DNA repair protein RadC [Lactobacillus gasseri 224-1]
          Length = 203

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 107 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 166

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+ + ++
Sbjct: 167 RFTKKLVEASKCMGIDFLDHFIVTDNTYLSFREMELL 203


>gi|114704379|ref|ZP_01437287.1| DNA repair protein RadC [Fulvimarina pelagi HTCC2506]
 gi|114539164|gb|EAU42284.1| DNA repair protein RadC [Fulvimarina pelagi HTCC2506]
          Length = 252

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 78/97 (80%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+V+R LEL+AT++ILVHNHPSG+P PS ADI
Sbjct: 156 LFLDKKNALIADEVQGRGTVDHTPVYPREVVRRALELNATALILVHNHPSGDPTPSRADI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I TT  PL I +HDH+I+GK+   S +GL++I
Sbjct: 216 EMTRMIETTAKPLGISLHDHVIVGKNGHASLRGLKLI 252


>gi|323339483|ref|ZP_08079762.1| DNA repair protein RadC [Lactobacillus ruminis ATCC 25644]
 gi|323093097|gb|EFZ35690.1| DNA repair protein RadC [Lactobacillus ruminis ATCC 25644]
          Length = 224

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 59/96 (61%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           FLD  N ++  +   +GT++   V+ REI +  L LS   II+VHNHPSG+  PS+ D++
Sbjct: 128 FLDTKNQVLEQKKIFKGTLNSATVHPREIFKEALRLSTARIIVVHNHPSGDTTPSENDLS 187

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ +    + L I + DHII+G  +++S +   II
Sbjct: 188 LTKRLEECGHLLGIELLDHIIVGNSSYLSMREENII 223


>gi|158425828|ref|YP_001527120.1| DNA repair protein RadC [Azorhizobium caulinodans ORS 571]
 gi|158332717|dbj|BAF90202.1| DNA repair protein [Azorhizobium caulinodans ORS 571]
          Length = 234

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEV   GT+DH PVY RE+V+R LELSA+++IL HNHPSG+P PS ADI
Sbjct: 138 LFLDKRNQLIADEVVQTGTVDHAPVYPREVVKRALELSASALILCHNHPSGDPTPSRADI 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ II    PL I +HDHII+GK+   S KGLR+I
Sbjct: 198 DMTRKIIDVAKPLGIELHDHIIVGKEGHASLKGLRLI 234


>gi|56421153|ref|YP_148471.1| DNA repair protein RadC [Geobacillus kaustophilus HTA426]
 gi|73913735|sp|Q5KWN3|Y2618_GEOKA RecName: Full=UPF0758 protein GK2618
 gi|56380995|dbj|BAD76903.1| DNA repair protein [Geobacillus kaustophilus HTA426]
          Length = 226

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA S+I VHNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIYRKTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   F+S K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFISLKEKGYV 226


>gi|319897558|ref|YP_004135755.1| DNA repair protein radc homolog [Haemophilus influenzae F3031]
 gi|88930441|sp|Q4QLV5|Y1125_HAEI8 RecName: Full=UPF0758 protein NTHI1125
 gi|317433064|emb|CBY81438.1| DNA repair protein RadC homolog [Haemophilus influenzae F3031]
          Length = 221

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 221


>gi|301021305|ref|ZP_07185334.1| putative DNA repair protein RadC [Escherichia coli MS 69-1]
 gi|300398156|gb|EFJ81694.1| putative DNA repair protein RadC [Escherichia coli MS 69-1]
          Length = 157

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+  E    GTI+   V+ REIV+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQNRLLEHETLFLGTINSTEVHPREIVKSALRHNAAAVILAHNHPSGVTEPSRADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T NI+ TL+ + + V DH IIG    +SF     +
Sbjct: 121 LITTNIVKTLDLVKVRVLDHFIIGAGDVLSFAERGWL 157


>gi|206969519|ref|ZP_03230473.1| DNA repair protein RadC [Bacillus cereus AH1134]
 gi|228941621|ref|ZP_04104168.1| DNA repair protein radC [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228954737|ref|ZP_04116759.1| DNA repair protein radC [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228974550|ref|ZP_04135116.1| DNA repair protein radC [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981145|ref|ZP_04141445.1| DNA repair protein radC [Bacillus thuringiensis Bt407]
 gi|229071963|ref|ZP_04205173.1| DNA repair protein radC [Bacillus cereus F65185]
 gi|229081719|ref|ZP_04214212.1| DNA repair protein radC [Bacillus cereus Rock4-2]
 gi|229180730|ref|ZP_04308068.1| DNA repair protein radC [Bacillus cereus 172560W]
 gi|229192665|ref|ZP_04319624.1| DNA repair protein radC [Bacillus cereus ATCC 10876]
 gi|206735207|gb|EDZ52375.1| DNA repair protein RadC [Bacillus cereus AH1134]
 gi|228590755|gb|EEK48615.1| DNA repair protein radC [Bacillus cereus ATCC 10876]
 gi|228602708|gb|EEK60191.1| DNA repair protein radC [Bacillus cereus 172560W]
 gi|228701564|gb|EEL54057.1| DNA repair protein radC [Bacillus cereus Rock4-2]
 gi|228711122|gb|EEL63087.1| DNA repair protein radC [Bacillus cereus F65185]
 gi|228778345|gb|EEM26612.1| DNA repair protein radC [Bacillus thuringiensis Bt407]
 gi|228784953|gb|EEM32966.1| DNA repair protein radC [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228804935|gb|EEM51532.1| DNA repair protein radC [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228817833|gb|EEM63911.1| DNA repair protein radC [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|326942233|gb|AEA18129.1| DNA repair protein radC [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 225

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|301631360|ref|XP_002944759.1| PREDICTED: UPF0758 protein Veis_1654-like [Xenopus (Silurana)
           tropicalis]
          Length = 225

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+VQR L   AT+++L HNHPSG+  PS AD 
Sbjct: 129 LFLDSQNRLLAMEELFRGTLTQTSVYPREVVQRALHHQATAVVLAHNHPSGSVQPSRADE 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+     +S     ++
Sbjct: 189 ALTQTLKAALALIDVRVLDHVIVAPGQALSMAEQGLV 225


>gi|34498534|ref|NP_902749.1| DNA repair protein RadC [Chromobacterium violaceum ATCC 12472]
 gi|81654991|sp|Q7NTH5|Y3079_CHRVO RecName: Full=UPF0758 protein CV_3079
 gi|34104390|gb|AAQ60748.1| DNA repair protein RadC [Chromobacterium violaceum ATCC 12472]
          Length = 224

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL   N LI  E   +GT+    VY RE+++R L  +A ++I+ HNHPSG   PS AD 
Sbjct: 128 IFLSAQNRLIEVEEVFKGTLTETRVYPREVLRRALRHNAAALIIAHNHPSGVSEPSSADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I + DH ++      SF     +
Sbjct: 188 VLTDTLKRALELVDIRLLDHFVVTGGHAESFAERGWL 224


>gi|331650414|ref|ZP_08351486.1| putative DNA repair protein [Escherichia coli M605]
 gi|331040808|gb|EGI12966.1| putative DNA repair protein [Escherichia coli M605]
          Length = 157

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+  E    GTI+   V+ REIV+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQNRLLKHETLFLGTINSTEVHPREIVKSALRHNAAAVILAHNHPSGVAEPSRADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T NI+ TL+ + + V DH IIG    +SF     +
Sbjct: 121 LITTNIVKTLDLVKVRVLDHFIIGAGDVLSFAERGWL 157


>gi|253702454|ref|YP_003023643.1| DNA repair protein RadC [Geobacter sp. M21]
 gi|251777304|gb|ACT19885.1| DNA repair protein RadC [Geobacter sp. M21]
          Length = 231

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I+    S G+++   V+ RE+    +  SA ++IL+HNHP+G+P PS  D+
Sbjct: 135 LLLDGKNRIISRAQISEGSLNQSIVHPREVFNVAVRNSAAAMILLHNHPTGDPAPSPEDM 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I V DHIIIG++ F SF     +
Sbjct: 195 EVTRRLCEAGQLLGIRVLDHIIIGENEFYSFAEHGRL 231


>gi|291485217|dbj|BAI86292.1| DNA repair protein RadC [Bacillus subtilis subsp. natto BEST195]
          Length = 231

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I VHNHPSG+P PS  DI
Sbjct: 135 LYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|296331651|ref|ZP_06874120.1| DNA repair protein RadC [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675390|ref|YP_003867062.1| putative DNA repair protein [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296151246|gb|EFG92126.1| DNA repair protein RadC [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413634|gb|ADM38753.1| putative DNA repair protein [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 231

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +   + SA S I VHNHPSG+P PS  DI
Sbjct: 135 LYLNTKNQVIHKRTVFIGSLNSSIVHPREVFKEAFKRSAASFICVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DH++IG   FVS K    +
Sbjct: 195 EVTRRLFECGNLIGIELLDHLVIGDKKFVSLKEKGYL 231


>gi|317050107|ref|YP_004117755.1| DNA repair protein RadC [Pantoea sp. At-9b]
 gi|316951724|gb|ADU71199.1| DNA repair protein RadC [Pantoea sp. At-9b]
          Length = 218

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  +    G+I+ V V+ REIV+  L+L+A ++IL HNHPSG   PS AD 
Sbjct: 122 LFLDNQHHVLQAQKMFSGSINSVEVHPREIVREALKLNAAAVILAHNHPSGVAEPSRADR 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I    + +NI + DH++IG   F SF     +
Sbjct: 182 EITDKISKACSLMNIRLLDHLVIGHGEFTSFAERGWL 218


>gi|319783917|ref|YP_004143393.1| DNA repair protein RadC [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169805|gb|ADV13343.1| DNA repair protein RadC [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 253

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+++R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 157 LFLDKKNALIADEVQQTGTVDHTPVYPREVIKRALELSATAIILVHNHPSGDPTPSRADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II     L I VHDHIIIG+  + S KGL +I
Sbjct: 217 EMTKEIIDAGKRLGIAVHDHIIIGRKGYASMKGLLLI 253


>gi|110680841|ref|YP_683848.1| DNA repair protein RadC [Roseobacter denitrificans OCh 114]
 gi|109456957|gb|ABG33162.1| DNA repair protein RadC [Roseobacter denitrificans OCh 114]
          Length = 301

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N++IADE Q++GT+DHVPVY RE+ +R LEL+A++IILVHNHPSG+P+PS  DI
Sbjct: 204 LFLDRKNVIIADEEQAKGTVDHVPVYPREVAKRALELNASAIILVHNHPSGDPSPSTQDI 263

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  + +    + + +HDH+IIGK+   SFK    +
Sbjct: 264 TMTDQVSSACLAIGVTIHDHVIIGKEREFSFKEGGYL 300


>gi|294501407|ref|YP_003565107.1| DNA repair protein RadC [Bacillus megaterium QM B1551]
 gi|295706755|ref|YP_003599830.1| DNA repair protein RadC [Bacillus megaterium DSM 319]
 gi|294351344|gb|ADE71673.1| DNA repair protein RadC [Bacillus megaterium QM B1551]
 gi|294804414|gb|ADF41480.1| DNA repair protein RadC [Bacillus megaterium DSM 319]
          Length = 228

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     SA S+I +HNHPSG+P PS  DI
Sbjct: 132 LYLNTKNQVLHKQTIFIGSLNSSIVHPREVFKEAFRRSAASLICIHNHPSGDPTPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I + DH+IIG   ++S K    +
Sbjct: 192 EVTKRLKECGFIIGIELLDHLIIGDRKYISLKEKGYM 228


>gi|294340312|emb|CAZ88693.1| DNA repair protein radC [Thiomonas sp. 3As]
          Length = 226

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E  SRGT+    VY RE+V+  L L+A ++IL HNHPSG   PS AD 
Sbjct: 130 LFLDSQHQLIASEELSRGTLASTSVYPREVVKAALRLNAGALILAHNHPSGLAEPSAADR 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + + L  +++ V DH+++ + + VSF    ++
Sbjct: 190 ALTQTLKSALALVDVRVLDHLVVTRHSVVSFAERGLL 226


>gi|83941929|ref|ZP_00954391.1| DNA repair protein RadC [Sulfitobacter sp. EE-36]
 gi|83847749|gb|EAP85624.1| DNA repair protein RadC [Sulfitobacter sp. EE-36]
          Length = 253

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD+ N++I DE Q +GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 157 IYLDRKNVVIGDEEQGKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MTQ I    + L + +HDH+IIGK   +SF+    +
Sbjct: 217 DMTQQIFAACSALGLTLHDHLIIGKSRELSFRSEGYL 253


>gi|330824402|ref|YP_004387705.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
 gi|329309774|gb|AEB84189.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
          Length = 164

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSGN  PS AD 
Sbjct: 68  VFLDNQHQVLAFEPLFKGTVDQTSVYPRVVVQRALALNASALILAHQHPSGNTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  ++  V DH I+GK +  SF    ++
Sbjct: 128 AITERLKSALATVDARVLDHFIVGKGSPYSFAEAGLL 164


>gi|218709645|ref|YP_002417266.1| putative DNA repair protein; prophage protein [Vibrio splendidus
           LGP32]
 gi|218322664|emb|CAV18840.1| putative DNA repair protein; prophage protein [Vibrio splendidus
           LGP32]
          Length = 156

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI  E   +GTID   VY RE+V+  L+ +A ++I  HNHPSG+  PS AD 
Sbjct: 61  MLLDNQHRLIEFEELFQGTIDAASVYPREVVKTALKANAAAVIFAHNHPSGDSAPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH+++G +   SF     +
Sbjct: 121 RITTRLQDALALIDVRVLDHVVVG-EQCTSFAERGWL 156


>gi|188025517|ref|ZP_02997537.1| hypothetical protein PROSTU_00686 [Providencia stuartii ATCC 25827]
 gi|188025584|ref|ZP_02997572.1| hypothetical protein PROSTU_00936 [Providencia stuartii ATCC 25827]
 gi|282600132|ref|ZP_05973133.2| DNA repair protein RadC [Providencia rustigianii DSM 4541]
 gi|188022915|gb|EDU60955.1| hypothetical protein PROSTU_00936 [Providencia stuartii ATCC 25827]
 gi|188023263|gb|EDU61303.1| hypothetical protein PROSTU_00686 [Providencia stuartii ATCC 25827]
 gi|282566538|gb|EFB72073.1| DNA repair protein RadC [Providencia rustigianii DSM 4541]
          Length = 166

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LI+ E    G+I    VY RE+V+R L  +A ++I  HNHPSG+  PS AD 
Sbjct: 70  LYLNQQNQLISSETLFAGSISSTQVYPREVVKRALHFNAAAVIFAHNHPSGDITPSQADK 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +I  L  + + V DH+IIG     SF    ++
Sbjct: 130 SITQQLIKALQLIEVRVLDHLIIGGQQIFSFAEHGLV 166


>gi|262151185|ref|ZP_06028323.1| DNA repair protein RadC [Vibrio cholerae INDRE 91/1]
 gi|220897838|dbj|BAH11100.1| DNA repair protein RadC-related protein [Vibrio cholerae O1 biovar
           El tor]
 gi|262031016|gb|EEY49642.1| DNA repair protein RadC [Vibrio cholerae INDRE 91/1]
          Length = 157

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|329891298|ref|ZP_08269641.1| DNA repair protein RadC family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846599|gb|EGF96163.1| DNA repair protein RadC family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 243

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LDK N LI DE+Q+RGT+DH PVY RE+V+R LELSA+++I+VHNHPSG+P PS ADI
Sbjct: 147 LYLDKKNQLILDEIQNRGTVDHAPVYPREVVRRALELSASAMIIVHNHPSGDPTPSRADI 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ +I     L++ VHDH+I+G++   SFK L ++
Sbjct: 207 DMTKQVIEAARALSVQVHDHLIVGREGVASFKQLGLM 243


>gi|160914215|ref|ZP_02076436.1| hypothetical protein EUBDOL_00225 [Eubacterium dolichum DSM 3991]
 gi|158433842|gb|EDP12131.1| hypothetical protein EUBDOL_00225 [Eubacterium dolichum DSM 3991]
          Length = 227

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL++ N ++A +    GT+    V+ REI +  + +    II  HNHPSGNP  SDADI
Sbjct: 128 VFLNQRNQILAYKTLFVGTLTSANVHPREIFKEAMRIGCAKIICAHNHPSGNPQVSDADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I+     ++I + DHI++G + +VS +    +
Sbjct: 188 AITQQIMECGQLVSIPLLDHIVVGGNRYVSLREEGYM 224


>gi|327395780|dbj|BAK13202.1| DNA repair protein RadC RadC [Pantoea ananatis AJ13355]
          Length = 228

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       G+I+ V V+ REIV+  L+++A ++I+ HNHPSG   PS AD 
Sbjct: 132 MFLDNQHRVITARQMFSGSINSVEVHPREIVREALKINAAALIIAHNHPSGRAEPSQADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I      +NI V DH++IG+   VSF     +
Sbjct: 192 DITVKICEACRLVNIRVLDHLVIGRGESVSFTERGWL 228


>gi|300361445|ref|ZP_07057622.1| DNA repair protein RadC [Lactobacillus gasseri JV-V03]
 gi|300354064|gb|EFJ69935.1| DNA repair protein RadC [Lactobacillus gasseri JV-V03]
          Length = 206

 Score =  130 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 110 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 169

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+ + ++
Sbjct: 170 RFTKKLVEASKCMGIDFLDHFIVTDNTYLSFREMELL 206


>gi|42783591|ref|NP_980838.1| DNA repair protein RadC [Bacillus cereus ATCC 10987]
 gi|54036227|sp|Q72ZX2|Y4545_BACC1 RecName: Full=UPF0758 protein BCE_4545
 gi|42739520|gb|AAS43446.1| DNA repair protein RadC [Bacillus cereus ATCC 10987]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|258514688|ref|YP_003190910.1| DNA repair protein RadC [Desulfotomaculum acetoxidans DSM 771]
 gi|257778393|gb|ACV62287.1| DNA repair protein RadC [Desulfotomaculum acetoxidans DSM 771]
          Length = 227

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I+ E  S GT++   V+ RE+ +  ++ SA +IIL+HNHPSG+P PS  DI
Sbjct: 131 LLLNTKNRVISLEAISVGTLNSSNVHPRELFKVAIKRSAAAIILIHNHPSGDPTPSREDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ +      + I V DHI+IG   FVS K   +
Sbjct: 191 DVTERLGEAGKIVGIDVLDHIVIGDGKFVSLKAKGL 226


>gi|84514871|ref|ZP_01002234.1| DNA repair protein RadC [Loktanella vestfoldensis SKA53]
 gi|84511030|gb|EAQ07484.1| DNA repair protein RadC [Loktanella vestfoldensis SKA53]
          Length = 220

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 71/96 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N+LIADE Q++GT+DHVPVY RE+V+R LEL+A S+ILVHNHPSG+P PS ADI
Sbjct: 124 LFLDTKNVLIADEEQAKGTLDHVPVYPREVVKRALELNAASMILVHNHPSGDPTPSQADI 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I      + I VHDH+IIGK   +S +   +
Sbjct: 184 TMTRQISDAAGTMGITVHDHLIIGKSCEISLRAQGL 219


>gi|251771587|gb|EES52163.1| DNA repair protein RadC [Leptospirillum ferrodiazotrophum]
          Length = 232

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 53/95 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + L   E  S GT+   PV+ RE     +  SA+++I VHNHPSG+P PS  D 
Sbjct: 133 LLLDTRHRLRRMEKISEGTLAMTPVHPREAFSPAVRESASAVIFVHNHPSGDPEPSPEDW 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           ++T  ++     L I V DHI+IG  A+VS +   
Sbjct: 193 SLTTRLVECGTLLGIRVLDHIVIGDHAYVSLRERG 227


>gi|330807440|ref|YP_004351902.1| Putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375548|gb|AEA66898.1| Putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 165

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGT+D   VY RE+V+  LE +A ++ILVHNHPSG+P PS AD 
Sbjct: 69  LMLDAKHRVIGFRELFRGTLDGASVYPREVVKIALEHNAAAVILVHNHPSGDPEPSQADY 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   LN +   + DH+++G D  VS      +
Sbjct: 129 ALTTTLKNALNMVGTRILDHVVVGHDGCVSLAERGYL 165


>gi|297529218|ref|YP_003670493.1| DNA repair protein RadC [Geobacillus sp. C56-T3]
 gi|297252470|gb|ADI25916.1| DNA repair protein RadC [Geobacillus sp. C56-T3]
          Length = 226

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA S+I VHNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIYRKTVFIGSLNASIVHPREVFKEAIKRSAASVICVHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   F+S K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFISLKEKGYV 226


>gi|238798215|ref|ZP_04641701.1| DNA repair protein, RadC family [Yersinia mollaretii ATCC 43969]
 gi|238717952|gb|EEQ09782.1| DNA repair protein, RadC family [Yersinia mollaretii ATCC 43969]
          Length = 157

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+A E  S GT +   VY RE+V R L     ++++ HNHP+G+P PS AD 
Sbjct: 59  LFLDNRHRLMASETVSVGTFNATTVYPREVVIRALHHRCAAVVIAHNHPAGDPTPSQADR 118

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  LN ++I V DH+IIG+   VS   L  +
Sbjct: 119 TLTARLVNALNMVDIRVLDHLIIGESEPVSLAELGWL 155


>gi|229163410|ref|ZP_04291361.1| DNA repair protein radC [Bacillus cereus R309803]
 gi|228619979|gb|EEK76854.1| DNA repair protein radC [Bacillus cereus R309803]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|152984586|ref|YP_001351411.1| DNA repair protein RadC [Pseudomonas aeruginosa PA7]
 gi|166218788|sp|A6VEC6|Y6095_PSEA7 RecName: Full=UPF0758 protein PSPA7_6095
 gi|150959744|gb|ABR81769.1| DNA repair protein RadC [Pseudomonas aeruginosa PA7]
          Length = 224

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  +G+ID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRALAHNAAALILTHNHPSGDARPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH IIG    +S      +
Sbjct: 188 QLTARLKEALALIDVRVLDHFIIGDGEPLSLAEYGWM 224


>gi|331005821|ref|ZP_08329177.1| DNA repair protein [gamma proteobacterium IMCC1989]
 gi|330420360|gb|EGG94670.1| DNA repair protein [gamma proteobacterium IMCC1989]
          Length = 169

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + +I  E+   GTID   VY RE+V+  L+ +A +IIL HNHPSG+P PS AD 
Sbjct: 73  IYLDSQHGIIDFEILFHGTIDAASVYPREVVKSALKYNAAAIILAHNHPSGSPEPSSADK 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  IIT L  ++I V DH+I+G    +SF  L ++
Sbjct: 133 RITDQIITALKTVDIRVLDHLIVGGTQSISFAELGLL 169


>gi|324328357|gb|ADY23617.1| hypothetical protein YBT020_21945 [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|227883870|ref|ZP_04001675.1| DNA repair protein RadC [Escherichia coli 83972]
 gi|300984866|ref|ZP_07177154.1| putative DNA repair protein RadC [Escherichia coli MS 45-1]
 gi|307312940|ref|ZP_07592568.1| DNA repair protein RadC [Escherichia coli W]
 gi|227839148|gb|EEJ49614.1| DNA repair protein RadC [Escherichia coli 83972]
 gi|300408295|gb|EFJ91833.1| putative DNA repair protein RadC [Escherichia coli MS 45-1]
 gi|306907108|gb|EFN37615.1| DNA repair protein RadC [Escherichia coli W]
 gi|307555795|gb|ADN48570.1| conserved phage-associated protein [Escherichia coli ABU 83972]
 gi|315063591|gb|ADT77918.1| DNA Repair Protein [Escherichia coli W]
 gi|315292951|gb|EFU52303.1| putative DNA repair protein RadC [Escherichia coli MS 153-1]
 gi|323380328|gb|ADX52596.1| DNA repair protein RadC [Escherichia coli KO11]
          Length = 157

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+  E    GTI+   V+ REIV+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQNRLLEHETLFLGTINSTEVHPREIVKSALRHNAAAVILAHNHPSGVAEPSRADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T NI+ TL+ + + V DH IIG    +SF     +
Sbjct: 121 LITTNIVKTLDLVKVRVLDHFIIGAGDVLSFAERGWL 157


>gi|116050520|ref|YP_790661.1| RadC-like protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115585741|gb|ABJ11756.1| RadC-like protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 168

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GTID   V+ RE+V++ L L+A ++I+ HNHPSGNP PS AD 
Sbjct: 72  LFLDTRHRLIDYVEMFHGTIDAAEVHPREVVKQALRLNAAAVIVSHNHPSGNPEPSAADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  +++   DHII+      SF    +I
Sbjct: 132 AMTAQLRQALALVDVRTLDHIIVAGTRTTSFAECGLI 168


>gi|304320238|ref|YP_003853881.1| DNA repair protein RadC [Parvularcula bermudensis HTCC2503]
 gi|303299140|gb|ADM08739.1| DNA repair protein RadC [Parvularcula bermudensis HTCC2503]
          Length = 245

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 69/97 (71%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N+LIADEV   GT++  PVY RE+V+R L L A+++IL+HNHPSG+P PS ADI
Sbjct: 149 LYLNAKNVLIADEVHGSGTVNQTPVYPREVVKRALHLDASALILIHNHPSGDPTPSTADI 208

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     + + VHDH++IG++   SFK L ++
Sbjct: 209 KVTAQLVAAAATVGVTVHDHLVIGREGHASFKSLGLL 245


>gi|30264522|ref|NP_846899.1| DNA repair protein RadC [Bacillus anthracis str. Ames]
 gi|47529985|ref|YP_021333.1| DNA repair protein RadC [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187346|ref|YP_030598.1| DNA repair protein RadC [Bacillus anthracis str. Sterne]
 gi|49478639|ref|YP_038504.1| DNA repair protein RadC [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|65321823|ref|ZP_00394782.1| COG2003: DNA repair proteins [Bacillus anthracis str. A2012]
 gi|165872011|ref|ZP_02216652.1| DNA repair protein RadC [Bacillus anthracis str. A0488]
 gi|167636192|ref|ZP_02394496.1| DNA repair protein RadC [Bacillus anthracis str. A0442]
 gi|167640700|ref|ZP_02398960.1| DNA repair protein RadC [Bacillus anthracis str. A0193]
 gi|170688713|ref|ZP_02879918.1| DNA repair protein RadC [Bacillus anthracis str. A0465]
 gi|170708383|ref|ZP_02898827.1| DNA repair protein RadC [Bacillus anthracis str. A0389]
 gi|177653967|ref|ZP_02936008.1| DNA repair protein RadC [Bacillus anthracis str. A0174]
 gi|190566980|ref|ZP_03019896.1| DNA repair protein RadC [Bacillus anthracis Tsiankovskii-I]
 gi|225866435|ref|YP_002751813.1| DNA repair protein RadC [Bacillus cereus 03BB102]
 gi|227817234|ref|YP_002817243.1| DNA repair protein RadC [Bacillus anthracis str. CDC 684]
 gi|228917092|ref|ZP_04080650.1| DNA repair protein radC [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228948168|ref|ZP_04110452.1| DNA repair protein radC [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229123994|ref|ZP_04253186.1| DNA repair protein radC [Bacillus cereus 95/8201]
 gi|229601494|ref|YP_002868738.1| DNA repair protein RadC [Bacillus anthracis str. A0248]
 gi|254687056|ref|ZP_05150914.1| DNA repair protein RadC [Bacillus anthracis str. CNEVA-9066]
 gi|254724618|ref|ZP_05186401.1| DNA repair protein RadC [Bacillus anthracis str. A1055]
 gi|254736558|ref|ZP_05194264.1| DNA repair protein RadC [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741596|ref|ZP_05199283.1| DNA repair protein RadC [Bacillus anthracis str. Kruger B]
 gi|254754806|ref|ZP_05206841.1| DNA repair protein RadC [Bacillus anthracis str. Vollum]
 gi|254757638|ref|ZP_05209665.1| DNA repair protein RadC [Bacillus anthracis str. Australia 94]
 gi|301055961|ref|YP_003794172.1| DNA repair protein [Bacillus anthracis CI]
 gi|33301484|sp|Q81LD7|Y4685_BACAN RecName: Full=UPF0758 protein BA_4685/GBAA_4685/BAS4351
 gi|54036223|sp|Q6HD72|Y4187_BACHK RecName: Full=UPF0758 protein BT9727_4187
 gi|254764425|sp|C3P9D9|Y4704_BACAA RecName: Full=UPF0758 protein BAA_4704
 gi|254764426|sp|C3L6Y5|Y4721_BACAC RecName: Full=UPF0758 protein BAMEG_4721
 gi|254764427|sp|C1ETQ0|Y4566_BACC3 RecName: Full=UPF0758 protein BCA_4566
 gi|30259180|gb|AAP28385.1| DNA repair protein RadC [Bacillus anthracis str. Ames]
 gi|47505133|gb|AAT33809.1| DNA repair protein RadC [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181273|gb|AAT56649.1| DNA repair protein RadC [Bacillus anthracis str. Sterne]
 gi|49330195|gb|AAT60841.1| DNA repair protein [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|164712301|gb|EDR17837.1| DNA repair protein RadC [Bacillus anthracis str. A0488]
 gi|167511272|gb|EDR86658.1| DNA repair protein RadC [Bacillus anthracis str. A0193]
 gi|167528413|gb|EDR91181.1| DNA repair protein RadC [Bacillus anthracis str. A0442]
 gi|170126758|gb|EDS95641.1| DNA repair protein RadC [Bacillus anthracis str. A0389]
 gi|170667399|gb|EDT18157.1| DNA repair protein RadC [Bacillus anthracis str. A0465]
 gi|172081022|gb|EDT66100.1| DNA repair protein RadC [Bacillus anthracis str. A0174]
 gi|190561971|gb|EDV15940.1| DNA repair protein RadC [Bacillus anthracis Tsiankovskii-I]
 gi|225786937|gb|ACO27154.1| DNA repair protein RadC [Bacillus cereus 03BB102]
 gi|227003430|gb|ACP13173.1| DNA repair protein RadC [Bacillus anthracis str. CDC 684]
 gi|228659296|gb|EEL14944.1| DNA repair protein radC [Bacillus cereus 95/8201]
 gi|228811526|gb|EEM57863.1| DNA repair protein radC [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228842510|gb|EEM87600.1| DNA repair protein radC [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|229265902|gb|ACQ47539.1| DNA repair protein RadC [Bacillus anthracis str. A0248]
 gi|300378130|gb|ADK07034.1| DNA repair protein [Bacillus cereus biovar anthracis str. CI]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|307129553|ref|YP_003881569.1| DNA repair protein RadC [Dickeya dadantii 3937]
 gi|306527082|gb|ADM97012.1| DNA repair protein RadC [Dickeya dadantii 3937]
          Length = 203

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   + LI       GT+    VY REIV++ L  +A ++IL HNHPSGN  PS AD+
Sbjct: 107 LFLTTRHRLIEYAELFYGTLATTAVYPREIVRKALSCNAAAVILAHNHPSGNTEPSQADL 166

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DHII+G +  +SF    ++
Sbjct: 167 MLTRRVSAALALVDVRVLDHIIVGGNDTLSFAERALL 203


>gi|90023318|ref|YP_529145.1| DEAD/DEAH box helicase-like protein [Saccharophagus degradans 2-40]
 gi|122995779|sp|Q21EE6|Y3678_SACD2 RecName: Full=UPF0758 protein Sde_3678
 gi|89952918|gb|ABD82933.1| DNA repair protein RadC [Saccharophagus degradans 2-40]
          Length = 224

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N LI       GTID   VY RE+V+  L  +A ++IL HNHPSG   PS+ D 
Sbjct: 128 ILLNTQNQLIKFVELFNGTIDSASVYPREVVKTALSHNAAAVILAHNHPSGIAEPSEPDK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I   DH+++G    VSF     I
Sbjct: 188 AITKRLQQALQLVDIRTLDHLVVGDTEAVSFAERGWI 224


>gi|319651725|ref|ZP_08005851.1| DNA repair protein RadC [Bacillus sp. 2_A_57_CT2]
 gi|317396544|gb|EFV77256.1| DNA repair protein RadC [Bacillus sp. 2_A_57_CT2]
          Length = 229

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     SA SII +HNHPSG+P PS  DI
Sbjct: 133 LYLNTKNQVLHKKTIFIGSLNASIVHPREVFKEAFRRSAASIICIHNHPSGDPTPSREDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  +   + I V DH+IIG++ FVS K    +
Sbjct: 193 EVTKRLAESGKIIGIEVLDHLIIGENKFVSLKEKGYL 229


>gi|239827887|ref|YP_002950511.1| DNA repair protein RadC [Geobacillus sp. WCH70]
 gi|259551864|sp|C5D5H7|Y2550_GEOSW RecName: Full=UPF0758 protein GWCH70_2550
 gi|239808180|gb|ACS25245.1| DNA repair protein RadC [Geobacillus sp. WCH70]
          Length = 226

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA SII VHNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIHRKTIFIGSLNASIVHPREVFKEAIKRSAASIICVHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   FVS K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFVSLKEKGYV 226


>gi|312882919|ref|ZP_07742651.1| DNA repair protein RadC [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369438|gb|EFP96958.1| DNA repair protein RadC [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 224

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +++ E    GTID   VY RE+V+R LE++A +IIL HNHPSG   PS +D 
Sbjct: 128 IFLDSQHRVLSCESLFFGTIDCASVYPREVVKRSLEMNAAAIILAHNHPSGVAEPSQSDR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+  +  ++I V DH ++G   FVSF     I
Sbjct: 188 RITRKIVDAMGLVDIRVLDHFVVGDGEFVSFAERGWI 224


>gi|229105092|ref|ZP_04235743.1| DNA repair protein radC [Bacillus cereus Rock3-28]
 gi|228678273|gb|EEL32499.1| DNA repair protein radC [Bacillus cereus Rock3-28]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|90415484|ref|ZP_01223418.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2207]
 gi|90332807|gb|EAS47977.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2207]
          Length = 217

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI      +GT+D   V+ RE+V R L  +A ++I+ HNHPSG   PS ADI
Sbjct: 121 LLLDSKHQLIDTHELFQGTVDAASVHPREVVARALRKNAAAVIVAHNHPSGLAEPSQADI 180

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   LN + I + DH+IIG+   VS      +
Sbjct: 181 DITRRLKQALNLVEIRLLDHLIIGRGEVVSLAQRGKL 217


>gi|91786850|ref|YP_547802.1| DNA repair protein RadC [Polaromonas sp. JS666]
 gi|91696075|gb|ABE42904.1| DNA replication and repair protein RadC [Polaromonas sp. JS666]
          Length = 244

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+V R L L+A S++L HNHPSG   PS AD 
Sbjct: 148 LFLDSQHRLIALEELFRGTLTQTSVYPREVVVRALALNAASVVLAHNHPSGAATPSRADE 207

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + + L  +++ V DH ++     VS   L ++
Sbjct: 208 ALTQTLKSALALVDVRVLDHFVVTSTQAVSMAELGLL 244


>gi|312598047|gb|ADQ89981.1| DNA-repair protein [Proteus mirabilis]
          Length = 223

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I  E   +GT+D V V+ REI+++ ++ +A SIIL HNHPSG   PS AD 
Sbjct: 127 LFLDNQNQMIDCEEMFKGTVDRVEVHPREIIRQSIKKNAASIILAHNHPSGLSEPSLADK 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I T    + I V DH+++G D+ VSF     +
Sbjct: 187 QITEKIFTACQLVGIKVLDHLVVGHDSCVSFAERGWL 223


>gi|229198583|ref|ZP_04325285.1| DNA repair protein radC [Bacillus cereus m1293]
 gi|228584865|gb|EEK42981.1| DNA repair protein radC [Bacillus cereus m1293]
          Length = 225

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|84390134|ref|ZP_00991396.1| DNA repair protein [Vibrio splendidus 12B01]
 gi|84376788|gb|EAP93663.1| DNA repair protein [Vibrio splendidus 12B01]
          Length = 157

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I+ HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIMAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  +   SF     +
Sbjct: 122 RITERLKGALALVDVRVLDH-IVTGETCTSFAERGWL 157


>gi|238790651|ref|ZP_04634415.1| DNA repair protein, RadC family [Yersinia frederiksenii ATCC 33641]
 gi|238721256|gb|EEQ12932.1| DNA repair protein, RadC family [Yersinia frederiksenii ATCC 33641]
          Length = 157

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+A E  S GT +   VY RE+V R L     ++++ HNHP+G+P PS AD 
Sbjct: 59  LYLDNRHRLMASETMSIGTFNATTVYPREVVIRALHHHCAAVVIAHNHPAGDPTPSQADR 118

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  LN ++I V DH+IIG+   VS   L  +
Sbjct: 119 TLTTRLVNALNMVDIRVLDHLIIGESEPVSLAELGWL 155


>gi|121534093|ref|ZP_01665918.1| DNA repair protein RadC [Thermosinus carboxydivorans Nor1]
 gi|121307196|gb|EAX48113.1| DNA repair protein RadC [Thermosinus carboxydivorans Nor1]
          Length = 232

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L   N ++A  V S G+++   V+ RE+ +  +  SA ++ILVHNHPSG+P PS  DI
Sbjct: 136 LLLSTKNHVLAMPVISVGSLNASLVHPRELFREAINHSAAAVILVHNHPSGDPTPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L I V DH+IIG   +VS K   II
Sbjct: 196 EITGKMVQAGEILGIAVLDHVIIGDGKYVSLKEKGII 232


>gi|269137424|ref|YP_003294124.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|267983084|gb|ACY82913.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|304557498|gb|ADM40162.1| DNA repair protein RadC [Edwardsiella tarda FL6-60]
          Length = 228

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI+ V VY REIV+  L+L+A ++IL HNHPSGNP PS AD 
Sbjct: 132 LFLDNQHRVIRSEQMFSGTINCVDVYPREIVREALKLNAVALILAHNHPSGNPEPSVADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      ++I V DH++IG    VSF     I
Sbjct: 192 LLTERVAKACALVDIQVLDHMVIGHGQRVSFAERGWI 228


>gi|153801495|ref|ZP_01956081.1| DNA repair protein RadC family protein [Vibrio cholerae MZO-3]
 gi|124122986|gb|EAY41729.1| DNA repair protein RadC family protein [Vibrio cholerae MZO-3]
          Length = 157

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNRLIEFKDLFHGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|116629851|ref|YP_815023.1| DNA repair protein [Lactobacillus gasseri ATCC 33323]
 gi|311110510|ref|ZP_07711907.1| DNA repair protein RadC [Lactobacillus gasseri MV-22]
 gi|116095433|gb|ABJ60585.1| DNA repair protein [Lactobacillus gasseri ATCC 33323]
 gi|311065664|gb|EFQ46004.1| DNA repair protein RadC [Lactobacillus gasseri MV-22]
          Length = 206

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 110 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 169

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+ + ++
Sbjct: 170 RFTKKLVEASKCMGIDFLDHFIVTDNTYLSFREMELL 206


>gi|54307423|ref|YP_128443.1| DNA repair protein RadC [Photobacterium profundum SS9]
 gi|54036225|sp|Q6LVN4|Y202_PHOPR RecName: Full=UPF0758 protein PBPRA0202
 gi|46911843|emb|CAG18641.1| putative DNA repair protein RadC [Photobacterium profundum SS9]
          Length = 224

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA EV   GTI+   VY REIV+R LE +A ++IL HNHPSG   PS +D+
Sbjct: 128 LFLDNQHRVIAGEVLFEGTINSAAVYPREIVKRSLEFNAVALILAHNHPSGVAEPSQSDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   L  ++I V DH I+G    VSF     +
Sbjct: 188 RITRTISDALALVDIRVLDHFIVGDGEIVSFSEQGWL 224


>gi|52141051|ref|YP_085777.1| DNA repair protein RadC [Bacillus cereus E33L]
 gi|81686057|sp|Q633Z0|Y4198_BACCZ RecName: Full=UPF0758 protein BCE33L4198
 gi|51974520|gb|AAU16070.1| DNA repair protein [Bacillus cereus E33L]
          Length = 225

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|270265228|ref|ZP_06193490.1| DNA repair protein RadC [Serratia odorifera 4Rx13]
 gi|270040862|gb|EFA13964.1| DNA repair protein RadC [Serratia odorifera 4Rx13]
          Length = 228

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  +    GTI  V V+ REIV+  L+ +A +IIL HNHPSG   PS AD 
Sbjct: 132 LFLDNQHRVIRHQEMFAGTISSVVVHPREIVREALKANAAAIILAHNHPSGKAEPSHADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++++     L I V DH++IG+   VSF     +
Sbjct: 192 LITEHVVNACLLLEIRVLDHLVIGRGECVSFAERGWL 228


>gi|193063615|ref|ZP_03044703.1| DNA repair protein RadC [Escherichia coli E22]
 gi|192930602|gb|EDV83208.1| DNA repair protein RadC [Escherichia coli E22]
          Length = 161

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+++HV V+ RE+V+  L  +A +++L HNHPSG+P PS  D 
Sbjct: 65  LYLDNQHRLLESETLFAGSVNHVQVHSREVVKSALRFNAAAVVLAHNHPSGDPEPSQCDR 124

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   L  +++   DH+++G+D  VSF     +
Sbjct: 125 NITGRLKEALELVDVKTLDHLVVGRDGIVSFAERGWL 161


>gi|301154718|emb|CBW14181.1| protein associated with replication fork, possible DNA repair
           protein [Haemophilus parainfluenzae T3T1]
          Length = 221

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVTNVYPREIIKESLYCNAAALILAHNHPSGIAEPSYSDK 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ II     + I + DH I+GK    SF    ++
Sbjct: 185 MITQKIIEAAELMEIRILDHFIVGKGTCYSFAEHNLL 221


>gi|238756176|ref|ZP_04617495.1| DNA repair protein, RadC family [Yersinia ruckeri ATCC 29473]
 gi|238705591|gb|EEP97989.1| DNA repair protein, RadC family [Yersinia ruckeri ATCC 29473]
          Length = 157

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+A E  S GT +   VY RE+V R L     ++++ HNHP+G+P PS AD 
Sbjct: 59  LFLDNRHRLMASETVSVGTFNATTVYPREVVIRALHHRCAAVVIAHNHPAGDPTPSQADR 118

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  LN ++I V DH+IIG+   VS   L  +
Sbjct: 119 TLTARLVNALNMVDIRVLDHLIIGESEPVSLAELGWL 155


>gi|228935773|ref|ZP_04098585.1| DNA repair protein radC [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228823830|gb|EEM69650.1| DNA repair protein radC [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|229186695|ref|ZP_04313854.1| DNA repair protein radC [Bacillus cereus BGSC 6E1]
 gi|228596798|gb|EEK54459.1| DNA repair protein radC [Bacillus cereus BGSC 6E1]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|291619457|ref|YP_003522199.1| RadC [Pantoea ananatis LMG 20103]
 gi|291154487|gb|ADD79071.1| RadC [Pantoea ananatis LMG 20103]
          Length = 228

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       G+I+ V V+ REIV+  L+++A ++I+ HNHPSG   PS AD 
Sbjct: 132 MFLDNQHRVITARQMFSGSINSVEVHPREIVREALKINAAALIIAHNHPSGRAEPSQADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I      +NI V DH++IG+   VSF     +
Sbjct: 192 DITVKICEACRLVNIRVLDHLVIGRGESVSFTERGWL 228


>gi|254429147|ref|ZP_05042854.1| DNA repair protein RadC [Alcanivorax sp. DG881]
 gi|196195316|gb|EDX90275.1| DNA repair protein RadC [Alcanivorax sp. DG881]
          Length = 164

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + +++ E    GTID   VY R +VQ+ L  +A ++I  HNHPSG   PS AD 
Sbjct: 68  IFLNNKHKVLSFEPLFSGTIDGAAVYPRVVVQQALACNAAAVIFAHNHPSGCCEPSQADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH ++ +  +VS      +
Sbjct: 128 TITTRLKDALALIDVRVLDHFVVSRSEWVSLAERGWL 164


>gi|330964261|gb|EGH64521.1| hypothetical protein PSYAC_06345 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 224

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R L  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRALAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVEKGLM 224


>gi|206975949|ref|ZP_03236859.1| DNA repair protein RadC [Bacillus cereus H3081.97]
 gi|217961943|ref|YP_002340513.1| DNA repair protein RadC [Bacillus cereus AH187]
 gi|222097900|ref|YP_002531957.1| DNA repair protein radc [Bacillus cereus Q1]
 gi|229141192|ref|ZP_04269731.1| DNA repair protein radC [Bacillus cereus BDRD-ST26]
 gi|226736618|sp|B7HQL1|Y4587_BACC7 RecName: Full=UPF0758 protein BCAH187_A4587
 gi|254764428|sp|B9IZ29|Y4241_BACCQ RecName: Full=UPF0758 protein BCQ_4241
 gi|206745701|gb|EDZ57098.1| DNA repair protein RadC [Bacillus cereus H3081.97]
 gi|217065490|gb|ACJ79740.1| DNA repair protein RadC [Bacillus cereus AH187]
 gi|221241958|gb|ACM14668.1| DNA repair protein [Bacillus cereus Q1]
 gi|228642233|gb|EEK98525.1| DNA repair protein radC [Bacillus cereus BDRD-ST26]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|229062148|ref|ZP_04199472.1| DNA repair protein radC [Bacillus cereus AH603]
 gi|228717131|gb|EEL68807.1| DNA repair protein radC [Bacillus cereus AH603]
          Length = 240

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 144 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 203

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 204 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 240


>gi|229013669|ref|ZP_04170798.1| DNA repair protein radC [Bacillus mycoides DSM 2048]
 gi|228747591|gb|EEL97465.1| DNA repair protein radC [Bacillus mycoides DSM 2048]
          Length = 241

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 145 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 204

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 205 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 241


>gi|189423594|ref|YP_001950771.1| DNA repair protein RadC [Geobacter lovleyi SZ]
 gi|254789653|sp|B3E339|Y523_GEOLS RecName: Full=UPF0758 protein Glov_0523
 gi|189419853|gb|ACD94251.1| DNA repair protein RadC [Geobacter lovleyi SZ]
          Length = 230

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +      S G+++   V+ RE+    +  SA ++I +HNHPSG+P PS  D 
Sbjct: 134 LLLDGKNRITRKVQVSEGSLNQSIVHPREVFAPAVRESAAAVIFIHNHPSGDPAPSREDH 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I V DHIIIG  A+ SF    ++
Sbjct: 194 EITRRLNEAGEILGIKVLDHIIIGDGAYFSFVESGLL 230


>gi|294637895|ref|ZP_06716164.1| DNA repair protein RadC [Edwardsiella tarda ATCC 23685]
 gi|291088921|gb|EFE21482.1| DNA repair protein RadC [Edwardsiella tarda ATCC 23685]
          Length = 227

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI+ V VY REIV+  L+L+A ++IL HNHPSGNP PS AD 
Sbjct: 131 LFLDNQHRVIRSEQMFSGTINCVDVYPREIVREALKLNAVALILAHNHPSGNPEPSVADR 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      ++I V DH++IG    VSF     I
Sbjct: 191 LLTARVAKACALVDIQVLDHMVIGCGQRVSFAERGWI 227


>gi|254482762|ref|ZP_05096000.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2148]
 gi|214037121|gb|EEB77790.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2148]
          Length = 193

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++  E    GT+D   VY RE+  R L+  A ++I  HNHPSG   PS AD 
Sbjct: 97  IFLDNQHRIMRCEDLFLGTLDGAAVYPREVAVRALQYRAAAVIFAHNHPSGVAEPSSADK 156

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++  L  L+I V DHII+G     SF    ++
Sbjct: 157 RITERLVAALGLLDIRVLDHIIVGSGCEFSFAEQGLL 193


>gi|91974634|ref|YP_567293.1| DNA repair protein RadC [Rhodopseudomonas palustris BisB5]
 gi|91681090|gb|ABE37392.1| DNA repair protein RadC [Rhodopseudomonas palustris BisB5]
          Length = 239

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY REIV+R LELSAT++I+VHNHPSG+P PS ADI
Sbjct: 143 LFLDKRNQLIADELQQVGTVDHTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADI 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+    PL + VHDHII+GK+   S KGL++I
Sbjct: 203 QMTRTIVAIAEPLGVSVHDHIIVGKNGHASLKGLKLI 239


>gi|152998927|ref|YP_001364608.1| DNA repair protein RadC [Shewanella baltica OS185]
 gi|166218794|sp|A6WIA6|Y376_SHEB8 RecName: Full=UPF0758 protein Shew185_0376
 gi|151363545|gb|ABS06545.1| DNA repair protein RadC [Shewanella baltica OS185]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSGN  PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGNAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|47566644|ref|ZP_00237466.1| DNA repair protein RadC [Bacillus cereus G9241]
 gi|228987706|ref|ZP_04147817.1| DNA repair protein radC [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|47556674|gb|EAL15006.1| DNA repair protein RadC [Bacillus cereus G9241]
 gi|228771980|gb|EEM20435.1| DNA repair protein radC [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|326318501|ref|YP_004236173.1| DNA repair protein RadC [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375337|gb|ADX47606.1| DNA repair protein RadC [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 237

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+    VY RE+V R L   A +++LVHNHPSG   PS AD 
Sbjct: 141 LFLDSQNGLIAMEEMFRGTLSQASVYPREVVVRALHHHAAAVVLVHNHPSGQVQPSRADE 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++   L  ++I V DHII+   A +S     ++
Sbjct: 201 TLTRSLTDALRLVDIRVLDHIIVAPGASLSMAEEGLL 237


>gi|254477756|ref|ZP_05091142.1| DNA repair protein RadC [Ruegeria sp. R11]
 gi|214031999|gb|EEB72834.1| DNA repair protein RadC [Ruegeria sp. R11]
          Length = 251

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADE Q++GT+DHVPVY REI ++ LEL+A+++ILVHNHPSG+P+PS +DI
Sbjct: 155 LFLDRKNCLIADEEQAKGTVDHVPVYPREIAKQALELNASALILVHNHPSGDPSPSASDI 214

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I+  L+ L I +HDH+IIGK + +SF+    +
Sbjct: 215 AMTDRILQALDALGITLHDHLIIGKSSELSFRSSGYL 251


>gi|330876490|gb|EGH10639.1| hypothetical protein PSYMP_14329 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 224

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R L  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRALAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVEKGLM 224


>gi|196034552|ref|ZP_03101961.1| DNA repair protein RadC [Bacillus cereus W]
 gi|228929500|ref|ZP_04092520.1| DNA repair protein radC [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|195993094|gb|EDX57053.1| DNA repair protein RadC [Bacillus cereus W]
 gi|228830180|gb|EEM75797.1| DNA repair protein radC [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 225

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNSSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|84386431|ref|ZP_00989459.1| DNA repair protein [Vibrio splendidus 12B01]
 gi|84378855|gb|EAP95710.1| DNA repair protein [Vibrio splendidus 12B01]
          Length = 158

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +    GT+D   VY RE+V+  LE++A ++I+ HNHPSG   PS AD 
Sbjct: 63  LLLDNQNRLIEFKELFHGTVDAASVYPREVVKAVLEVNAAAVIMAHNHPSGYSTPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  +   SF     +
Sbjct: 123 RITERLKDALALVDVRVLDH-IVTGETCTSFAERGWL 158


>gi|314938909|ref|ZP_07846176.1| DNA repair protein RadC [Enterococcus faecium TX0133a04]
 gi|314943095|ref|ZP_07849896.1| DNA repair protein RadC [Enterococcus faecium TX0133C]
 gi|314948108|ref|ZP_07851509.1| DNA repair protein RadC [Enterococcus faecium TX0082]
 gi|314951626|ref|ZP_07854671.1| DNA repair protein RadC [Enterococcus faecium TX0133A]
 gi|314993869|ref|ZP_07859203.1| DNA repair protein RadC [Enterococcus faecium TX0133B]
 gi|314996710|ref|ZP_07861733.1| DNA repair protein RadC [Enterococcus faecium TX0133a01]
 gi|313589148|gb|EFR67993.1| DNA repair protein RadC [Enterococcus faecium TX0133a01]
 gi|313591679|gb|EFR70524.1| DNA repair protein RadC [Enterococcus faecium TX0133B]
 gi|313596222|gb|EFR75067.1| DNA repair protein RadC [Enterococcus faecium TX0133A]
 gi|313598197|gb|EFR77042.1| DNA repair protein RadC [Enterococcus faecium TX0133C]
 gi|313641783|gb|EFS06363.1| DNA repair protein RadC [Enterococcus faecium TX0133a04]
 gi|313645444|gb|EFS10024.1| DNA repair protein RadC [Enterococcus faecium TX0082]
          Length = 212

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G+++    + REI    +   A  I+L HNHPSGN  PS  D+
Sbjct: 113 IYLDTKNQVILKKTVFIGSLNQSVAHPREIFHYAVRYCAARIVLAHNHPSGNVIPSQQDM 172

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I      + I V DH+IIG+  + S +   ++
Sbjct: 173 NFTKRIQKCGEMMGITVLDHLIIGRKRYFSLREEGMM 209


>gi|297616876|ref|YP_003702035.1| DNA repair protein RadC [Syntrophothermus lipocalidus DSM 12680]
 gi|297144713|gb|ADI01470.1| DNA repair protein RadC [Syntrophothermus lipocalidus DSM 12680]
          Length = 229

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD+ N +I+ E  S G +    V+ RE+ +  ++ SA  IILVHNHPSG+P+PS  DI
Sbjct: 133 VYLDRKNQIISIETISIGGLASSIVHPREVFKPAVKKSAAGIILVHNHPSGDPSPSQEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I + DHIIIG   ++S +G  II
Sbjct: 193 EVTRRLVEAGRIIGIEIVDHIIIGDRDYLSMRGRGII 229


>gi|197286970|ref|YP_002152842.1| DNA repair protein [Proteus mirabilis HI4320]
 gi|194684457|emb|CAR46202.1| DNA repair protein [Proteus mirabilis HI4320]
 gi|301072223|gb|ADK56077.1| RadC [Proteus mirabilis]
 gi|301072245|gb|ADK56098.1| RadC [Proteus mirabilis]
 gi|312598063|gb|ADQ89996.1| DNA-repair protein [Proteus mirabilis]
          Length = 223

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I  E   +GT+D V V+ REI+++ ++ +A SIIL HNHPSG   PS AD 
Sbjct: 127 LFLDNQNQMIDCEEMFKGTVDRVEVHPREIIRQSIKKNAASIILAHNHPSGLSEPSLADK 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I T    + I V DH+++G D  VSF     +
Sbjct: 187 QITEKIFTACQLVGIKVLDHLVVGHDNCVSFAERGWL 223


>gi|295399379|ref|ZP_06809361.1| DNA repair protein RadC [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110061|ref|YP_003988377.1| DNA repair protein RadC [Geobacillus sp. Y4.1MC1]
 gi|294978845|gb|EFG54441.1| DNA repair protein RadC [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215162|gb|ADP73766.1| DNA repair protein RadC [Geobacillus sp. Y4.1MC1]
          Length = 226

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++   V+ RE+ +  ++ SA SII  HNHPSG+P PS  DI
Sbjct: 130 IYLNTKNQVIYRKTIFIGSLNASIVHPREVFKEAIKRSAASIICAHNHPSGDPTPSREDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   FVS K    +
Sbjct: 190 DVTKRLAECGRIIGIELLDHLIIGDQKFVSLKEKGYM 226


>gi|330831605|ref|YP_004394557.1| DNA repair protein RadC [Aeromonas veronii B565]
 gi|328806741|gb|AEB51940.1| DNA repair protein RadC [Aeromonas veronii B565]
          Length = 224

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I       GTID   V+ REIVQ  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDNQHRVIQFVELFFGTIDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  ++I V DH++IG    VSF     +
Sbjct: 188 QITDRITAALALIDIRVLDHLVIGDGITVSFAERGWL 224


>gi|229098927|ref|ZP_04229862.1| DNA repair protein radC [Bacillus cereus Rock3-29]
 gi|228684425|gb|EEL38368.1| DNA repair protein radC [Bacillus cereus Rock3-29]
          Length = 225

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|256823436|ref|YP_003147399.1| DNA repair protein RadC [Kangiella koreensis DSM 16069]
 gi|256796975|gb|ACV27631.1| DNA repair protein RadC [Kangiella koreensis DSM 16069]
          Length = 224

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + L+A E   +GTI+   V+ R +V++ L   A ++IL HNHPSG+  PS +D 
Sbjct: 128 LFLNNQHQLLASETLFQGTINSSEVHPRVVVEKALTYHAAAVILAHNHPSGSLEPSPSDR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I   L  L+I   DHII+ +    SF    ++
Sbjct: 188 HITDKIQEALGLLDIRTLDHIIVAQGGSYSFAEHGLL 224


>gi|37528674|ref|NP_932019.1| DNA repair protein RadC [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|54036232|sp|Q7MY28|Y4865_PHOLL RecName: Full=UPF0758 protein plu4865
 gi|36788113|emb|CAE17237.1| DNA repair protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 230

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  E   +GTI+ V V+ REIV+  ++++A+S+IL HNHPSG+  PS AD 
Sbjct: 134 LFLNNQNRVICHEEMFKGTINKVEVHPREIVRSAIKVNASSVILAHNHPSGHAEPSLADK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I   N + + V DH++IG+   VSF     I
Sbjct: 194 IVTDKVIDACNLVGVKVLDHLVIGRQCCVSFAERGWI 230


>gi|86747826|ref|YP_484322.1| DNA repair protein RadC [Rhodopseudomonas palustris HaA2]
 gi|123004659|sp|Q2J299|Y700_RHOP2 RecName: Full=UPF0758 protein RPB_0700
 gi|86570854|gb|ABD05411.1| DNA repair protein RadC [Rhodopseudomonas palustris HaA2]
          Length = 250

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 61/96 (63%), Positives = 75/96 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY REIV+R LELSAT++I+VHNHPSG+P PS ADI
Sbjct: 154 LFLDKRNQLIADELQQVGTVDHTPVYPREIVKRALELSATAVIMVHNHPSGDPTPSQADI 213

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I+    PL + VHDHII+GK+   S KGL++
Sbjct: 214 QMTKTIVAIAEPLGVAVHDHIIVGKNGHASLKGLKL 249


>gi|134095642|ref|YP_001100717.1| DNA repair protein RadC [Herminiimonas arsenicoxydans]
 gi|166218782|sp|A4G7V9|Y2468_HERAR RecName: Full=UPF0758 protein HEAR2468
 gi|133739545|emb|CAL62596.1| DNA repair protein RadC homolog [Herminiimonas arsenicoxydans]
          Length = 224

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  +   RGT+ H  VY REIV+  L  +A S+IL HNHPSG P PS AD 
Sbjct: 128 LFLDVKNRLIVCDEMFRGTLTHTSVYPREIVKAALGHNAASVILAHNHPSGTPEPSAADQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH ++      SF     +
Sbjct: 188 TLTQALKQALMLIDVRVLDHFVVAGKQVYSFAEQGQL 224


>gi|83855405|ref|ZP_00948935.1| DNA repair protein RadC [Sulfitobacter sp. NAS-14.1]
 gi|83843248|gb|EAP82415.1| DNA repair protein RadC [Sulfitobacter sp. NAS-14.1]
          Length = 253

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD+ N++I DE Q +GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 157 IYLDRKNVVIGDEEQGKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MTQ I    + L + +HDH+IIGK   +SF+    +
Sbjct: 217 GMTQQIFAACSALGLTLHDHLIIGKSRELSFRSEGYL 253


>gi|218233414|ref|YP_002369261.1| DNA repair protein RadC [Bacillus cereus B4264]
 gi|228923207|ref|ZP_04086497.1| DNA repair protein radC [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228960730|ref|ZP_04122369.1| DNA repair protein radC [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229111925|ref|ZP_04241469.1| DNA repair protein radC [Bacillus cereus Rock1-15]
 gi|229147024|ref|ZP_04275384.1| DNA repair protein radC [Bacillus cereus BDRD-ST24]
 gi|229152656|ref|ZP_04280844.1| DNA repair protein radC [Bacillus cereus m1550]
 gi|296504945|ref|YP_003666645.1| DNA repair protein radC [Bacillus thuringiensis BMB171]
 gi|226736617|sp|B7HE86|Y4572_BACC4 RecName: Full=UPF0758 protein BCB4264_A4572
 gi|218161371|gb|ACK61363.1| DNA repair protein RadC [Bacillus cereus B4264]
 gi|228630802|gb|EEK87443.1| DNA repair protein radC [Bacillus cereus m1550]
 gi|228636412|gb|EEK92882.1| DNA repair protein radC [Bacillus cereus BDRD-ST24]
 gi|228671489|gb|EEL26789.1| DNA repair protein radC [Bacillus cereus Rock1-15]
 gi|228798946|gb|EEM45921.1| DNA repair protein radC [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228836413|gb|EEM81764.1| DNA repair protein radC [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296325997|gb|ADH08925.1| DNA repair protein radC [Bacillus thuringiensis BMB171]
          Length = 225

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 AVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|149908601|ref|ZP_01897263.1| DNA repair protein RadC [Moritella sp. PE36]
 gi|149808435|gb|EDM68372.1| DNA repair protein RadC [Moritella sp. PE36]
          Length = 224

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTID   VY R +V++ LE +A+++I  HNHPSG   PS AD 
Sbjct: 128 LFLDNKHRVIRFEELFYGTIDSASVYPRVVVKKALERNASAVIFAHNHPSGIAEPSHADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I+ L  +++ V DH +IG     SF     +
Sbjct: 188 MITDKLISALQLIDVKVLDHFVIGDSEIASFAERGWV 224


>gi|114567770|ref|YP_754924.1| DNA repair proteins [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338705|gb|ABI69553.1| DNA repair proteins [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 206

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L++ N +++ E  S GT+    V+ RE+ +  +  +A S+ILVHNHPSG+P PS  DI
Sbjct: 110 ILLNRKNGILSVETISIGTLTSSMVHPREVFKPAIRKNAASVILVHNHPSGDPTPSREDI 169

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +      L I V DHIIIG  ++ S K   +
Sbjct: 170 EITKRLSECGQLLGIEVLDHIIIGDGSWNSLKTSGL 205


>gi|148826397|ref|YP_001291150.1| DNA repair protein RadC [Haemophilus influenzae PittEE]
 gi|148716557|gb|ABQ98767.1| DNA repair protein RadC [Haemophilus influenzae PittEE]
          Length = 214

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 118 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGVTEPSYSDQ 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 178 LITKKIQDAAELMEICVLDHLIVGKSDCYSFAENCLL 214


>gi|90580921|ref|ZP_01236723.1| DNA repair protein RadC [Vibrio angustum S14]
 gi|90437992|gb|EAS63181.1| DNA repair protein RadC [Vibrio angustum S14]
          Length = 224

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  EV   GTID   VY RE+V+R LEL+A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVITGEVLFEGTIDCASVYPREVVKRSLELNAAALILAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  +L  ++I V DH ++G    +SF     +
Sbjct: 188 RITRKISDSLALVDIRVLDHFVVGDGEIISFTERGWL 224


>gi|172044490|sp|A4STD5|Y4229_AERS4 RecName: Full=UPF0758 protein ASA_4229
          Length = 220

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I       GT+D   V+ REIVQ  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 124 LLLDNQHRVIQFVELFYGTLDSASVWPREIVQIALKHNAAAVILAHNHPSGVAEPSRADR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I+  L  ++I V DH++IG    VSF     +
Sbjct: 184 QITDRILAALALIDIRVLDHLVIGDGITVSFAERGWL 220


>gi|319764035|ref|YP_004127972.1| DNA repair protein radc [Alicycliphilus denitrificans BC]
 gi|330823690|ref|YP_004386993.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
 gi|317118596|gb|ADV01085.1| DNA repair protein RadC [Alicycliphilus denitrificans BC]
 gi|329309062|gb|AEB83477.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
          Length = 237

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 141 LFLDGQNRLIAMEELFRGTLTQTSVYPREVVLRALHHHAAAVVLAHNHPSGSVQPSRADE 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+   A +S     ++
Sbjct: 201 ALTQTLKAALALVDVRVLDHVIVAPGAALSMAEQGLV 237


>gi|297580642|ref|ZP_06942568.1| DNA repair protein RadC family protein [Vibrio cholerae RC385]
 gi|297535058|gb|EFH73893.1| DNA repair protein RadC family protein [Vibrio cholerae RC385]
          Length = 157

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG+  PS AD 
Sbjct: 62  LLLDNQNCLIEFKELFQGTVDAASVYPREVVKAVLEINAAAVIFAHNHPSGDSTPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+  D   SF     +
Sbjct: 122 RITERLKDALALVDVRVLDH-IVTGDTCTSFAERGWL 157


>gi|226945653|ref|YP_002800726.1| DNA repair protein RadC-like protein [Azotobacter vinelandii DJ]
 gi|226720580|gb|ACO79751.1| DNA repair protein RadC-like protein [Azotobacter vinelandii DJ]
          Length = 168

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GTID   V+ RE+V++ L ++A ++I+ HNHPSGNP PS AD 
Sbjct: 72  LFLDTRHRLIDYVEMFHGTIDAAEVHPREVVKQALRVNAAAVIVSHNHPSGNPEPSGADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+      SF    ++
Sbjct: 132 ALTQQLKQVLALVDVRVLDHVIVAGAVATSFAERGLL 168


>gi|289674414|ref|ZP_06495304.1| DNA repair protein RadC [Pseudomonas syringae pv. syringae FF5]
 gi|330977334|gb|EGH77287.1| hypothetical protein PSYAP_11500 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 224

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|121608622|ref|YP_996429.1| DNA repair protein RadC [Verminephrobacter eiseniae EF01-2]
 gi|171769486|sp|A1WIF4|Y1654_VEREI RecName: Full=UPF0758 protein Veis_1654
 gi|121553262|gb|ABM57411.1| DNA repair protein RadC [Verminephrobacter eiseniae EF01-2]
          Length = 237

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V   L   A +++L HNHPSG+  PS AD 
Sbjct: 141 LFLDNQNRLLAMEELFRGTLTQTSVYPREVVLHALHHRAAAVVLAHNHPSGSVQPSRADE 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + +TL  +++ V DH+I+     +S   + ++
Sbjct: 201 ALTQTLKSTLALVDVRVLDHVIVAPGQALSMAEMGLL 237


>gi|153948236|ref|YP_001399737.1| RadC family DNA repair protein [Yersinia pseudotuberculosis IP
           31758]
 gi|152959731|gb|ABS47192.1| DNA repair protein, RadC family [Yersinia pseudotuberculosis IP
           31758]
          Length = 162

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+A E  S GT +   VY RE+V R L     ++++ HNHP+G+P PS AD 
Sbjct: 64  LFLDNRHRLMASETVSVGTFNATTVYPREVVIRALHHRCAAVVIAHNHPAGDPTPSQADR 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  LN ++I V DH+IIG+   VS   L  +
Sbjct: 124 TLTAQLVNALNMVDIRVLDHLIIGESEPVSLAELGWL 160


>gi|225174937|ref|ZP_03728934.1| DNA repair protein RadC [Dethiobacter alkaliphilus AHT 1]
 gi|225169577|gb|EEG78374.1| DNA repair protein RadC [Dethiobacter alkaliphilus AHT 1]
          Length = 189

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++     S+GT++   ++ RE+    + +   S++++HNHPSG+P PS  DI
Sbjct: 93  LFLNTKNKILQHTTISKGTLNTSLIHPREVFAPAIRIKCASVVILHNHPSGDPTPSREDI 152

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DHI+IG   FVS +   ++
Sbjct: 153 DITKRLKEAGKIIGIELLDHIVIGNKGFVSLREKSLL 189


>gi|291086416|ref|ZP_06571500.1| DNA repair protein RadC [Citrobacter youngae ATCC 29220]
 gi|291068199|gb|EFE06308.1| DNA repair protein RadC [Citrobacter youngae ATCC 29220]
          Length = 215

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + +I       GT+ HV V+ REIV+  ++++A+++IL HNHPSG   PS AD 
Sbjct: 119 IFMDSQHHVIKHSKLFSGTLSHVEVHPREIVREAIKMNASAVILAHNHPSGCAEPSKADK 178

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     ++I V DH+IIG+  +VSF     I
Sbjct: 179 LITERVVKCCQFMDIRVLDHLIIGRGEYVSFAERGWI 215


>gi|218899622|ref|YP_002448033.1| DNA repair protein RadC [Bacillus cereus G9842]
 gi|228902983|ref|ZP_04067123.1| DNA repair protein radC [Bacillus thuringiensis IBL 4222]
 gi|228910289|ref|ZP_04074106.1| DNA repair protein radC [Bacillus thuringiensis IBL 200]
 gi|226736616|sp|B7IIW5|Y662_BACC2 RecName: Full=UPF0758 protein BCG9842_B0662
 gi|218542904|gb|ACK95298.1| DNA repair protein RadC [Bacillus cereus G9842]
 gi|228849349|gb|EEM94186.1| DNA repair protein radC [Bacillus thuringiensis IBL 200]
 gi|228856659|gb|EEN01179.1| DNA repair protein radC [Bacillus thuringiensis IBL 4222]
          Length = 225

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVLHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|323702262|ref|ZP_08113928.1| DNA repair protein RadC [Desulfotomaculum nigrificans DSM 574]
 gi|323532752|gb|EGB22625.1| DNA repair protein RadC [Desulfotomaculum nigrificans DSM 574]
          Length = 241

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA EV S GT++   V+ RE+ +R +  SA SIILVHNHPSG+P PS  DI
Sbjct: 145 VLLNIKNQVIAKEVVSIGTLNSSMVHPRELFKRAIRRSAASIILVHNHPSGDPTPSQEDI 204

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + + + DHI+IG + FVS K   +I
Sbjct: 205 TITKRLMEAGEIIGVQILDHIVIGFEQFVSLKAKGLI 241


>gi|172048112|sp|A5UDB6|Y7200_HAEIE RecName: Full=UPF0758 protein CGSHiEE_07200
          Length = 221

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGVTEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQDAAELMEICVLDHLIVGKSDCYSFAENCLL 221


>gi|302184918|ref|ZP_07261591.1| DNA repair protein RadC [Pseudomonas syringae pv. syringae 642]
          Length = 224

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|56476778|ref|YP_158367.1| RadC family DNA repair protein [Aromatoleum aromaticum EbN1]
 gi|56312821|emb|CAI07466.1| DNA repair protein similar to radC-family [Aromatoleum aromaticum
           EbN1]
          Length = 164

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   +G++D   VY R +VQR L L+A+++IL H HPSG   PS AD 
Sbjct: 68  VFLDSQHQVLAYEPLFKGSVDQTSVYPRVVVQRALALNASALILAHQHPSGVTEPSAADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH I+GK A  SF    ++
Sbjct: 128 ALTDRLKDALAMVDVRVVDHFIVGKGAPYSFAEAGLL 164


>gi|124266851|ref|YP_001020855.1| hypothetical protein Mpe_A1658 [Methylibium petroleiphilum PM1]
 gi|124259626|gb|ABM94620.1| conserved hypothetical protein [Methylibium petroleiphilum PM1]
          Length = 169

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA +   RGT+    VY RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 73  LFLDAQHRIIALKQMFRGTVTQTSVYPREVVKEALACNAAAVILAHNHPSGAAEPSRADE 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + T L  +++ V DH+++      SF  L ++
Sbjct: 133 FLTQTLKTALALVDVRVLDHLVVAGAEVRSFAELGLL 169


>gi|163759426|ref|ZP_02166511.1| DNA repair protein RadC [Hoeflea phototrophica DFL-43]
 gi|162283023|gb|EDQ33309.1| DNA repair protein RadC [Hoeflea phototrophica DFL-43]
          Length = 290

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 194 LFLDKKNALIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 253

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIG+D   S KG++++
Sbjct: 254 EMTKLIIETARPLGITVHDHIIIGRDGHASLKGMKLV 290


>gi|88706890|ref|ZP_01104589.1| DNA repair protein RadC [Congregibacter litoralis KT71]
 gi|88698812|gb|EAQ95932.1| DNA repair protein RadC [Congregibacter litoralis KT71]
          Length = 171

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + +I      +GTID   VY R +VQ+ L L+A +++  HNHPSG   PS AD 
Sbjct: 75  MYLDNRHRVIETAELFQGTIDGAAVYPRVVVQQALTLNAAAVMFFHNHPSGVAEPSHADE 134

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH I+     +SF    ++
Sbjct: 135 AITRRLKDALALVDIRVLDHFIVTAGESLSFAERGLL 171


>gi|229019679|ref|ZP_04176486.1| DNA repair protein radC [Bacillus cereus AH1273]
 gi|229025918|ref|ZP_04182310.1| DNA repair protein radC [Bacillus cereus AH1272]
 gi|228735364|gb|EEL85967.1| DNA repair protein radC [Bacillus cereus AH1272]
 gi|228741586|gb|EEL91779.1| DNA repair protein radC [Bacillus cereus AH1273]
          Length = 225

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|163734801|ref|ZP_02142239.1| DNA repair protein RadC [Roseobacter litoralis Och 149]
 gi|161391906|gb|EDQ16237.1| DNA repair protein RadC [Roseobacter litoralis Och 149]
          Length = 314

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N++IADE Q++GT+DHVPVY RE+ +R LEL+A++IILVHNHPSG+P+PS  DI
Sbjct: 217 LFLDRKNVIIADEEQAKGTVDHVPVYPREVAKRALELNASAIILVHNHPSGDPSPSSQDI 276

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  + +    + + +HDH+IIGK+   SFK    +
Sbjct: 277 AMTDQVSSACLAIGVTIHDHVIIGKETEFSFKDGGYL 313


>gi|229543680|ref|ZP_04432740.1| DNA repair protein RadC [Bacillus coagulans 36D1]
 gi|229328100|gb|EEN93775.1| DNA repair protein RadC [Bacillus coagulans 36D1]
          Length = 227

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +  L  SA SII  HNHPSG+P+PS  DI
Sbjct: 131 LYLNIKNQVIHRQTIFIGSLNASIVHPREVFKEALRRSAASIICFHNHPSGDPSPSKEDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I + DH+IIG+  FVS +    +
Sbjct: 191 EVTKRLAECGKIMGIEILDHLIIGEKKFVSLRQKGYL 227


>gi|120612416|ref|YP_972094.1| DNA repair protein RadC [Acidovorax citrulli AAC00-1]
 gi|171769198|sp|A1TTN2|Y3773_ACIAC RecName: Full=UPF0758 protein Aave_3773
 gi|120590880|gb|ABM34320.1| DNA replication and repair protein RadC [Acidovorax citrulli
           AAC00-1]
          Length = 237

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+    VY RE+V R L   A +++LVHNHPSG   PS AD 
Sbjct: 141 LFLDSQNGLIAMEEMFRGTLSQASVYPREVVVRALHHHAAAVVLVHNHPSGQVQPSRADE 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++   L  +++ V DHII+   + +S     +I
Sbjct: 201 TLTRSLTDALRLVDVRVLDHIIVAPGSSLSMAEEGLI 237


>gi|270263658|ref|ZP_06191927.1| 'putative DNA repair protein; CP4-44 prophage' [Serratia odorifera
           4Rx13]
 gi|270042542|gb|EFA15637.1| 'putative DNA repair protein; CP4-44 prophage' [Serratia odorifera
           4Rx13]
          Length = 160

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+I+   V+ REIV+  L+ +A +++L H HPSG+ NPSDAD 
Sbjct: 64  LYLDNQHRLLTHETLFTGSINSTEVHPREIVKSALKHNAAAVLLAHCHPSGHANPSDADR 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  + + V DH I+G     SF    ++
Sbjct: 124 QITCRIQEALMLVEVRVLDHCIVGGMTVYSFAEHGLL 160


>gi|254292990|ref|YP_003059013.1| DNA repair protein RadC [Hirschia baltica ATCC 49814]
 gi|254041521|gb|ACT58316.1| DNA repair protein RadC [Hirschia baltica ATCC 49814]
          Length = 272

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIADE QS+GTI+H PVY RE+ +R LELSA+++ILVHNHPSG+P PS ADI
Sbjct: 176 LFLDHKNQLIADERQSQGTINHAPVYPRELAKRALELSASALILVHNHPSGDPTPSRADI 235

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I+    PL I +HDH+I+GK    S K   +I
Sbjct: 236 DVTREIMDAFEPLEITIHDHLIVGKKGITSLKAKNLI 272


>gi|163942202|ref|YP_001647086.1| DNA repair protein RadC [Bacillus weihenstephanensis KBAB4]
 gi|229169196|ref|ZP_04296910.1| DNA repair protein radC [Bacillus cereus AH621]
 gi|229485544|sp|A9VIS8|Y4299_BACWK RecName: Full=UPF0758 protein BcerKBAB4_4299
 gi|163864399|gb|ABY45458.1| DNA repair protein RadC [Bacillus weihenstephanensis KBAB4]
 gi|228614262|gb|EEK71373.1| DNA repair protein radC [Bacillus cereus AH621]
          Length = 225

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVIHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPAPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|237807914|ref|YP_002892354.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
 gi|237500175|gb|ACQ92768.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
          Length = 165

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E   RGT++   ++ RE+V+R L ++A ++I VHNHPSG P PS+AD 
Sbjct: 69  LFLDNQHRIICFEELFRGTLNVTNIHPREVVKRALAVNAAAVIFVHNHPSGEPEPSEADK 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +  TLN +++ V DHI++G  A +S     ++
Sbjct: 129 KITVQLRETLNLIDVRVLDHIVVGAKACISMAERGLV 165


>gi|163737937|ref|ZP_02145353.1| DNA repair protein RadC [Phaeobacter gallaeciensis BS107]
 gi|161388553|gb|EDQ12906.1| DNA repair protein RadC [Phaeobacter gallaeciensis BS107]
          Length = 254

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N LIADE Q++GT+DHVPVY REI +R LE+SA+++ILVHNHPSG+P PS +DI
Sbjct: 158 LYLDRKNTLIADEEQAKGTVDHVPVYPREIAKRALEISASALILVHNHPSGDPTPSPSDI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  L+I++HDH+IIGK + +SF+    +
Sbjct: 218 EMTDRVARALAALDIVLHDHLIIGKSSELSFRSAGYL 254


>gi|229823990|ref|ZP_04450059.1| hypothetical protein GCWU000282_01294 [Catonella morbi ATCC 51271]
 gi|229786344|gb|EEP22458.1| hypothetical protein GCWU000282_01294 [Catonella morbi ATCC 51271]
          Length = 231

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 55/93 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  ++   G+++    + REI +  ++     +I+ HNHPSG+P PS AD+
Sbjct: 133 LFLNSKNQVIRQQIIFIGSVNASVAHPREIFKEAVKYPTARLIIAHNHPSGDPEPSQADL 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKG 93
           + TQ +I   + + I + DH IIG D +VS + 
Sbjct: 193 HFTQRMIQCGDLMGIELLDHFIIGHDDYVSLRE 225


>gi|163791281|ref|ZP_02185695.1| DNA repair protein RadC [Carnobacterium sp. AT7]
 gi|159873422|gb|EDP67512.1| DNA repair protein RadC [Carnobacterium sp. AT7]
          Length = 230

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 54/95 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G ++    + REI +  +  SA  II+ HNHPSGNP PS+ADI
Sbjct: 134 LYLNTKNEIIKKETIFIGGLNSSVAHPREIFRGAVRYSAARIIVGHNHPSGNPEPSEADI 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
             T+ +      + I + DHIIIG+  F+S K + 
Sbjct: 194 QFTRRMSECGELMGIELLDHIIIGEQEFISLKEIG 228


>gi|85705707|ref|ZP_01036804.1| DNA repair protein RadC [Roseovarius sp. 217]
 gi|85669697|gb|EAQ24561.1| DNA repair protein RadC [Roseovarius sp. 217]
          Length = 251

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 75/96 (78%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ NILIADE Q+RGT+DHVPVY RE+V+R L+L+A+++IL HNHPSG+P PS ADI+
Sbjct: 156 YLDRKNILIADEEQARGTVDHVPVYPREVVKRALQLNASALILAHNHPSGDPTPSAADID 215

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT+ + T    L + +HDHI+IGK A VSF+    +
Sbjct: 216 MTRQLQTAAEALGLALHDHIVIGKSAEVSFRSAGYL 251


>gi|319785772|ref|YP_004145247.1| DNA repair protein RadC [Pseudoxanthomonas suwonensis 11-1]
 gi|317464284|gb|ADV26016.1| DNA repair protein RadC [Pseudoxanthomonas suwonensis 11-1]
          Length = 224

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E    GTID   V+ RE+V+R L  +A ++I+ HNHPSG+P+PS AD 
Sbjct: 128 LFLDNRHRALAFEELFNGTIDGAEVHPREVVRRALAHNAAAVIVGHNHPSGSPDPSAADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + + + DH ++G    VS     ++
Sbjct: 188 AVTARLKQALALVEVRLLDHFVVGDGEPVSMAARGLV 224


>gi|238918036|ref|YP_002931550.1| DNA repair protein RadC [Edwardsiella ictaluri 93-146]
 gi|238867604|gb|ACR67315.1| DNA repair protein RadC [Edwardsiella ictaluri 93-146]
          Length = 228

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI+ V VY REIV+  L+L+A ++IL HNHPSGNP PS AD 
Sbjct: 132 LFLDNQHRVIRSEQMFSGTINCVDVYPREIVREALKLNAVALILAHNHPSGNPEPSVADR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      ++I V DH++IG    VSF     I
Sbjct: 192 LLTDRVAKACALVDIQVLDHMVIGHGQRVSFAERGWI 228


>gi|268318025|ref|YP_003291744.1| DNA repair protein RadC [Rhodothermus marinus DSM 4252]
 gi|262335559|gb|ACY49356.1| DNA repair protein RadC [Rhodothermus marinus DSM 4252]
          Length = 245

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IAD   S G +    V  R + QR +  +A  II +HNHPSGNP PS  DI
Sbjct: 148 VLLNTANYIIADYTISEGGLAASIVEPRAVFQRAILDNAAGIICLHNHPSGNPEPSAEDI 207

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I VHDHIII    + S     ++
Sbjct: 208 RITRQLVEAGRLLGIPVHDHIIIAGTTYTSLAERGLM 244


>gi|1573977|gb|AAC22613.1| DNA repair protein (radC) [Haemophilus influenzae Rd KW20]
          Length = 234

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI    VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 138 LFLDNQHRLIKKERLFLGTIYVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 198 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 234


>gi|227112487|ref|ZP_03826143.1| hypothetical protein PcarbP_05962 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 157

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI  EV + G I+   V+ REI++  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQNRLIEKEVIALGGINSTEVHPREILKASLRHNAAAVILAHNHPSGCAEPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +  +L+ L++ V DH+++G    VSF     +
Sbjct: 121 HITDKLKESLSQLDVRVLDHLVVGGAEVVSFAERGWL 157


>gi|254503230|ref|ZP_05115381.1| DNA repair protein RadC [Labrenzia alexandrii DFL-11]
 gi|222439301|gb|EEE45980.1| DNA repair protein RadC [Labrenzia alexandrii DFL-11]
          Length = 237

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY RE+V+R LE  AT+IILVHNHPSG+P PS ADI
Sbjct: 141 LFLDKKNGLIADELQQTGTVDHTPVYPREVVRRALEHGATAIILVHNHPSGDPTPSRADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++    PL I +HDHII+G  + VSFKGL++I
Sbjct: 201 QMTRQLVDIAKPLGIEIHDHIIVGLRSQVSFKGLQLI 237


>gi|259047287|ref|ZP_05737688.1| DNA repair protein RadC [Granulicatella adiacens ATCC 49175]
 gi|259036063|gb|EEW37318.1| DNA repair protein RadC [Granulicatella adiacens ATCC 49175]
          Length = 227

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  ++   G ++    + REI +  +  SA  +I+ HNHPSGNP PS ADI
Sbjct: 131 LYLNTKNEVIKKKMIFIGGLNSAVAHPREIFREAVRYSAARVIIGHNHPSGNPEPSQADI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + T+ ++     + I + DH I+G + F+S K + ++
Sbjct: 191 DFTKRLMDCGELMGIELLDHFIVGGEHFISLKEIGVL 227


>gi|15965481|ref|NP_385834.1| DNA repair protein RadC [Sinorhizobium meliloti 1021]
 gi|307302602|ref|ZP_07582358.1| DNA repair protein RadC [Sinorhizobium meliloti BL225C]
 gi|307318449|ref|ZP_07597883.1| DNA repair protein RadC [Sinorhizobium meliloti AK83]
 gi|25009036|sp|Q92PL6|Y1728_RHIME RecName: Full=UPF0758 protein R01728
 gi|15074662|emb|CAC46307.1| Probable DNA repair protein [Sinorhizobium meliloti 1021]
 gi|306895789|gb|EFN26541.1| DNA repair protein RadC [Sinorhizobium meliloti AK83]
 gi|306902966|gb|EFN33557.1| DNA repair protein RadC [Sinorhizobium meliloti BL225C]
          Length = 262

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 66/96 (68%), Positives = 77/96 (80%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ +GTIDH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 166 LFLDKRNTLIADEVQQQGTIDHTPVYPREVVKRALELSATALILVHNHPSGDPTPSRADI 225

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           +MT+ I     PL I +HDH+IIGKD  VS KGLR+
Sbjct: 226 DMTKLIAEAAKPLGIALHDHVIIGKDGHVSLKGLRL 261


>gi|99079849|ref|YP_612003.1| DNA repair protein RadC [Ruegeria sp. TM1040]
 gi|99036129|gb|ABF62741.1| DNA repair protein RadC [Ruegeria sp. TM1040]
          Length = 258

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ NILIADE Q+RGT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 162 LYLDRKNILIADEEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQADI 221

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   L  L+I +HDH+IIG    +SF+   ++
Sbjct: 222 GMTRKVGAALGALDITLHDHLIIGASDELSFRSEGLL 258


>gi|77461760|ref|YP_351267.1| DNA repair protein RadC [Pseudomonas fluorescens Pf0-1]
 gi|123602798|sp|Q3K4M8|Y5539_PSEPF RecName: Full=UPF0758 protein Pfl01_5539
 gi|77385763|gb|ABA77276.1| DNA replication and repair protein RadC [Pseudomonas fluorescens
           Pf0-1]
          Length = 224

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E   RG+ID+  V+ RE+V+R L  +A ++IL HNHPSGN +PS AD 
Sbjct: 128 LFLDSKHQVLTFEALFRGSIDNTAVHPREVVKRSLANNAAAVILCHNHPSGNSDPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH I+G    +S      +
Sbjct: 188 LLTKRLQKALELIDVRVLDHFIVGDGEPLSMAECGWM 224


>gi|71734935|ref|YP_272515.1| DNA repair protein RadC [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|289625760|ref|ZP_06458714.1| DNA repair protein RadC [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646363|ref|ZP_06477706.1| DNA repair protein RadC [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298484831|ref|ZP_07002931.1| DNA repair protein RadC [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|123638799|sp|Q48Q04|Y210_PSE14 RecName: Full=UPF0758 protein PSPPH_0210
 gi|71555488|gb|AAZ34699.1| DNA repair protein RadC [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298160685|gb|EFI01706.1| DNA repair protein RadC [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322246|gb|EFW78342.1| DNA repair protein RadC [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331895|gb|EFW87833.1| DNA repair protein RadC [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330866535|gb|EGH01244.1| hypothetical protein PSYAE_04585 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330873142|gb|EGH07291.1| hypothetical protein Pgy4_03892 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330890934|gb|EGH23595.1| hypothetical protein PSYMO_19883 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330986860|gb|EGH84963.1| hypothetical protein PLA107_17667 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009400|gb|EGH89456.1| hypothetical protein PSYTB_06881 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 224

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|163743881|ref|ZP_02151252.1| DNA repair protein RadC [Phaeobacter gallaeciensis 2.10]
 gi|161382822|gb|EDQ07220.1| DNA repair protein RadC [Phaeobacter gallaeciensis 2.10]
          Length = 254

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N LIADE Q++GT+DHVPVY REI +R LE+SA+++ILVHNHPSG+P PS +DI
Sbjct: 158 LYLDRKNTLIADEEQAKGTVDHVPVYPREIAKRALEISASALILVHNHPSGDPTPSPSDI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  L+I++HDH+IIGK + +SF+    +
Sbjct: 218 EMTDRVARALAALDIVLHDHLIIGKSSELSFRSAGYL 254


>gi|197104531|ref|YP_002129908.1| DNA repair protein [Phenylobacterium zucineum HLK1]
 gi|196477951|gb|ACG77479.1| DNA repair protein [Phenylobacterium zucineum HLK1]
          Length = 243

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L+ADEV + GT+DH PVY RE+V+R LELSA+++ILVHNHPSG+P PS AD+
Sbjct: 147 LFLDKKNQLLADEVMNHGTVDHAPVYPREVVRRALELSASALILVHNHPSGDPTPSSADV 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ ++     L I VHDH+++G+D   SFK L ++
Sbjct: 207 DMTRQVVDAARALRIAVHDHLVVGRDGVASFKALGLM 243


>gi|311031478|ref|ZP_07709568.1| DNA repair protein RadC [Bacillus sp. m3-13]
          Length = 232

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     SA S I +HNHPSG+P PS  DI
Sbjct: 136 LYLNTKNQVLHQQTVFIGSLNASIVHPREVFKEAFRRSAASFICIHNHPSGDPAPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DH+IIG   F+S K    +
Sbjct: 196 DVTKRLSECGKLIGIELLDHLIIGDQKFISLKEKGYV 232


>gi|254247438|ref|ZP_04940759.1| DNA repair protein RadC [Burkholderia cenocepacia PC184]
 gi|124872214|gb|EAY63930.1| DNA repair protein RadC [Burkholderia cenocepacia PC184]
          Length = 257

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N LI  E  +RG++  + VY REIV+R ++ +A ++I+ HNHPSG   PS  D 
Sbjct: 161 VYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDR 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G     SF     +
Sbjct: 221 RLTRVLKDALELVDVRLLDHVVVGVSDTFSFARAGWL 257


>gi|307945547|ref|ZP_07660883.1| putative DNA repair RadC-like protein [Roseibium sp. TrichSKD4]
 gi|307771420|gb|EFO30645.1| putative DNA repair RadC-like protein [Roseibium sp. TrichSKD4]
          Length = 237

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+++R LEL +T+++L+HNHPSG+P PS ADI
Sbjct: 141 LFLDKKNGLIADEVQQEGTVDHTPVYPREVIRRALELQSTALVLIHNHPSGDPTPSRADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++    PL I +HDHII+ + A VSF+G++++
Sbjct: 201 QMTRQLVEIAKPLGIEIHDHIIVARGAHVSFRGMQLM 237


>gi|59713705|ref|YP_206480.1| DNA repair protein RadC [Vibrio fischeri ES114]
 gi|59481953|gb|AAW87592.1| DNA repair protein RadC [Vibrio fischeri ES114]
          Length = 157

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI  +   +GT+D   VY RE+V+  LE++A ++I  HNHPSG   PS AD 
Sbjct: 62  LLLDNQHRLIEFKELFQGTVDAASVYPREVVKAVLEVNAAAVIFAHNHPSGESTPSQADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHI++G +  VSF    +I
Sbjct: 122 RITTRLKEALALIDVQVLDHIVVG-ETCVSFAERGLI 157


>gi|317493871|ref|ZP_07952288.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918198|gb|EFV39540.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 159

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N LIA E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 63  LYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSLADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ+++  L  ++I V DH+I+G    +SF    ++
Sbjct: 123 TITQHLVQALQLVDIRVPDHLIVGGAQILSFAEHGLL 159


>gi|300923422|ref|ZP_07139463.1| DNA repair protein RadC domain protein [Escherichia coli MS 182-1]
 gi|300420332|gb|EFK03643.1| DNA repair protein RadC domain protein [Escherichia coli MS 182-1]
          Length = 128

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 32  IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 91

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 92  LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 128


>gi|320179974|gb|EFW54916.1| DNA repair protein RadC [Shigella boydii ATCC 9905]
          Length = 222

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS A  
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKAGK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 222


>gi|260432018|ref|ZP_05785989.1| DNA repair protein RadC [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415846|gb|EEX09105.1| DNA repair protein RadC [Silicibacter lacuscaerulensis ITI-1157]
          Length = 251

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 72/96 (75%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ N+LIADE Q++GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS +DI+
Sbjct: 156 YLDRKNVLIADEEQAKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQSDID 215

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT  I      L + +HDH+IIGK   +SF+    +
Sbjct: 216 MTNRINDACAALGLTLHDHLIIGKSTELSFRSEGYL 251


>gi|254488973|ref|ZP_05102178.1| DNA repair protein RadC [Roseobacter sp. GAI101]
 gi|214045842|gb|EEB86480.1| DNA repair protein RadC [Roseobacter sp. GAI101]
          Length = 252

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N++I DE Q +GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 156 LYLDRKNVIIGDEEQGKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQADI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MTQ I+     L + +HDH+IIGK   +SF+    +
Sbjct: 216 DMTQQILGACTALGLTLHDHLIIGKSRELSFRSEGYL 252


>gi|227889744|ref|ZP_04007549.1| DNA repair protein RadC [Lactobacillus johnsonii ATCC 33200]
 gi|227849608|gb|EEJ59694.1| DNA repair protein RadC [Lactobacillus johnsonii ATCC 33200]
          Length = 203

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 107 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 166

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+   ++
Sbjct: 167 RFTKKLVEASKYMGIDFLDHFIVTDNTYLSFRETELL 203


>gi|28378902|ref|NP_785794.1| DNA repair protein [Lactobacillus plantarum WCFS1]
 gi|254557107|ref|YP_003063524.1| DNA repair protein [Lactobacillus plantarum JDM1]
 gi|300769705|ref|ZP_07079588.1| DNA repair protein [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308181103|ref|YP_003925231.1| DNA repair protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28271739|emb|CAD64645.1| DNA repair protein [Lactobacillus plantarum WCFS1]
 gi|254046034|gb|ACT62827.1| DNA repair protein [Lactobacillus plantarum JDM1]
 gi|300492748|gb|EFK27933.1| DNA repair protein [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308046594|gb|ADN99137.1| DNA repair protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 211

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 50/97 (51%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I  +V  +GT++  P   REI++  L      +++ HNHPSG+  PS  D+
Sbjct: 109 LCLDTKNQVIKRQVVFQGTLNSCPAQPREIIKVALTTPTARVVIAHNHPSGDVTPSKKDV 168

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ +      + + + D  IIG + + SF    ++
Sbjct: 169 EFTKRLQLACELMGLPLLDSFIIGVNDYFSFAEQGVL 205


>gi|268319717|ref|YP_003293373.1| DNA repair protein RadC [Lactobacillus johnsonii FI9785]
 gi|262398092|emb|CAX67106.1| DNA repair protein RadC [Lactobacillus johnsonii FI9785]
          Length = 203

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 107 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 166

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+   ++
Sbjct: 167 RFTKKLVEASKCMGIDFLDHFIVTDNTYLSFRETELL 203


>gi|322835042|ref|YP_004215069.1| DNA repair protein RadC [Rahnella sp. Y9602]
 gi|321170243|gb|ADW75942.1| DNA repair protein RadC [Rahnella sp. Y9602]
          Length = 226

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    GTI HV VY REIV+  ++++A ++IL HNHPSG   PS  D 
Sbjct: 130 LFLDNQHRVIRHEEMFAGTIGHVEVYPREIVRGAMKVNAAALILAHNHPSGRAEPSLMDR 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II     L I V DH+++G    VSF     I
Sbjct: 190 KVTEQIIRACQLLEIRVLDHLVVGHGETVSFAERGWI 226


>gi|254511714|ref|ZP_05123781.1| DNA repair protein RadC [Rhodobacteraceae bacterium KLH11]
 gi|221535425|gb|EEE38413.1| DNA repair protein RadC [Rhodobacteraceae bacterium KLH11]
          Length = 251

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 74/96 (77%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ N+LIADE Q++GT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS +DI+
Sbjct: 156 YLDRKNVLIADEEQAKGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQSDID 215

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT  I    + L + +HDH+IIGK A +SF+    +
Sbjct: 216 MTNRIQDACSALGLTLHDHLIIGKSAELSFRSHGYL 251


>gi|88858999|ref|ZP_01133640.1| associated with replication fork DNA repair protein
           [Pseudoalteromonas tunicata D2]
 gi|88819225|gb|EAR29039.1| associated with replication fork DNA repair protein
           [Pseudoalteromonas tunicata D2]
          Length = 245

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  ++   GTI+   VY RE+V+  L+++A ++I  HNHPSG   PS AD 
Sbjct: 149 LFLDNQNRLICQKILFYGTINAAAVYPREVVKEVLKMNANAVIFAHNHPSGIAEPSQADQ 208

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ +++ V DH+I+G +  VSF    ++
Sbjct: 209 VITRKLTQALSLIDVAVLDHLIVGGNQVVSFAERGLL 245


>gi|118578660|ref|YP_899910.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
 gi|118501370|gb|ABK97852.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
          Length = 163

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  +  S G+++   V+ RE+ +     +A +I+LVHNHP+G+PNPS  DI
Sbjct: 67  LHLDGKNRIVCFDRVSIGSLNQAIVHPREVFKTACLSNAAAILLVHNHPTGDPNPSSEDI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  + + L I V DHII+G D F+SF    ++
Sbjct: 127 AITKRLKESGDILGIRVLDHIIVGDDEFLSFVERGLL 163


>gi|222111947|ref|YP_002554211.1| DNA repair protein Radc [Acidovorax ebreus TPSY]
 gi|254789648|sp|B9MEH2|Y2777_DIAST RecName: Full=UPF0758 protein Dtpsy_2777
 gi|221731391|gb|ACM34211.1| DNA repair protein RadC [Acidovorax ebreus TPSY]
          Length = 238

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 142 LFLDSGNRLIAMEELFRGTLTQTSVYPREVVLRALHHHAAAVVLAHNHPSGSVQPSRADE 201

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+   A +S     ++
Sbjct: 202 ALTQTLKAALALVDVRVLDHVIVAPGAALSMAEQGLV 238


>gi|322382581|ref|ZP_08056459.1| RadC-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321153436|gb|EFX45843.1| RadC-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 209

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++A E  S G+++   V+ RE+ +  ++ S+ SII VHNHPSGNP PS  DI
Sbjct: 113 LFLNTKNQVLAKETMSIGSLNASIVHPREVFRAAIKRSSASIICVHNHPSGNPTPSLDDI 172

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +I     + I V DHIIIG  A+VS K    +
Sbjct: 173 DITQRLIEAGAIIGIDVLDHIIIGDKAYVSLKEQGYM 209


>gi|239817003|ref|YP_002945913.1| DNA repair protein RadC [Variovorax paradoxus S110]
 gi|259551914|sp|C5CWP0|Y4033_VARPS RecName: Full=UPF0758 protein Vapar_4033
 gi|239803580|gb|ACS20647.1| DNA repair protein RadC [Variovorax paradoxus S110]
          Length = 225

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 129 LFLDAQHRLIVLEELFRGTLTQTSVYPREVVTRALHHQAAAVVLSHNHPSGSIEPSRADE 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   L+ +++ V DH+I+      S     ++
Sbjct: 189 SLTQTLRAALSLIDVRVLDHVIVSAGQSYSMAEKGLL 225


>gi|172046847|sp|Q12EY8|Y948_POLSJ RecName: Full=UPF0758 protein Bpro_0948
          Length = 224

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+V R L L+A S++L HNHPSG   PS AD 
Sbjct: 128 LFLDSQHRLIALEELFRGTLTQTSVYPREVVVRALALNAASVVLAHNHPSGAATPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + + L  +++ V DH ++     VS   L ++
Sbjct: 188 ALTQTLKSALALVDVRVLDHFVVTSTQAVSMAELGLL 224


>gi|254784439|ref|YP_003071867.1| DNA repair protein RadC [Teredinibacter turnerae T7901]
 gi|259551909|sp|C5BLG5|Y184_TERTT RecName: Full=UPF0758 protein TERTU_0184
 gi|237685002|gb|ACR12266.1| DNA repair protein RadC [Teredinibacter turnerae T7901]
          Length = 224

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L++ ++   GTID   VY RE+V++CL  +A ++I  HNHPSG   PS+AD 
Sbjct: 128 LFLDSQHRLLSFDILFNGTIDGAAVYPREVVKKCLAHNAAAVIFAHNHPSGVAEPSEADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  L+I   DHI++G+   VSF     +
Sbjct: 188 QITDRLCRALQLLDIRTLDHIVVGEGDAVSFADRGWL 224


>gi|304310173|ref|YP_003809771.1| DNA repair protein [gamma proteobacterium HdN1]
 gi|301795906|emb|CBL44107.1| DNA repair protein [gamma proteobacterium HdN1]
          Length = 224

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI       GT+D   VY RE+V+  L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 LFLDSQHRLIQYRELFYGTLDSAAVYPREVVKEALRCNAGALIFAHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +   L+ ++I V DH+++G    VS     ++
Sbjct: 188 SITLRLRDALSLVDIRVLDHLVVGDCEVVSLAARGML 224


>gi|73542417|ref|YP_296937.1| DNA repair protein RadC [Ralstonia eutropha JMP134]
 gi|123624203|sp|Q46XP0|Y2732_RALEJ RecName: Full=UPF0758 protein Reut_A2732
 gi|72119830|gb|AAZ62093.1| DNA repair protein RadC [Ralstonia eutropha JMP134]
          Length = 228

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 55/95 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +IA E   RGT++   VY RE+ +R L  +A S+I+ HNHPSG   PS +D+
Sbjct: 128 LFLDTRNRMIASEELFRGTLNQTAVYPREVARRALAHNAASVIVAHNHPSGCCTPSQSDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            MT+ +   L+ +++ + DH ++      SF    
Sbjct: 188 QMTRMLARALDLIDVRLLDHFVVAGTHVHSFAEHG 222


>gi|18311126|ref|NP_563060.1| DNA repair protein RadC [Clostridium perfringens str. 13]
 gi|168212819|ref|ZP_02638444.1| DNA repair protein, RadC family [Clostridium perfringens CPE str.
           F4969]
 gi|168215771|ref|ZP_02641396.1| DNA repair protein, RadC family [Clostridium perfringens NCTC 8239]
 gi|182623959|ref|ZP_02951747.1| DNA repair protein, RadC family [Clostridium perfringens D str.
           JGS1721]
 gi|25009030|sp|Q8XIH5|Y2144_CLOPE RecName: Full=UPF0758 protein CPE2144
 gi|18145809|dbj|BAB81850.1| DNA repair protein [Clostridium perfringens str. 13]
 gi|170715570|gb|EDT27752.1| DNA repair protein, RadC family [Clostridium perfringens CPE str.
           F4969]
 gi|177910852|gb|EDT73206.1| DNA repair protein, RadC family [Clostridium perfringens D str.
           JGS1721]
 gi|182382393|gb|EDT79872.1| DNA repair protein, RadC family [Clostridium perfringens NCTC 8239]
          Length = 227

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 57/95 (60%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  N +I+ +   +G ++   V+ REI +  ++ SA SII+ HNHPSG+P PS  DIN+
Sbjct: 133 LDTKNKVISKKEIFKGGLNSSLVHPREIFREAVKDSAASIIICHNHPSGDPTPSRDDINI 192

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  +      + I + DH+IIG + F+S K   I+
Sbjct: 193 TTRLKECGKMMGIELLDHLIIGDNRFISLKEKDIL 227


>gi|21243995|ref|NP_643577.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109610|gb|AAM38113.1| RadC family protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 187

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I+ E    GT+D   V+ R + +R LELSA ++IL HNHPSGNP PS+AD 
Sbjct: 91  VFLDNQHHIISTEHLFTGTVDGCDVHPRVVAKRALELSAAAVILFHNHPSGNPEPSEADR 150

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +   L+ L+I V DH++IG    VS      
Sbjct: 151 KVTERLKQALSLLDIRVLDHLVIGGQQHVSLASRGW 186


>gi|308047854|ref|YP_003911420.1| DNA repair protein RadC [Ferrimonas balearica DSM 9799]
 gi|307630044|gb|ADN74346.1| DNA repair protein RadC [Ferrimonas balearica DSM 9799]
          Length = 227

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++     SRGTID   VY RE+V+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 131 LLLDSQHRVLQTIELSRGTIDAAQVYPREVVKTALKANAAAVILAHNHPSGVAEPSQADR 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  I   L  +++ V DH+++G+    SF     +
Sbjct: 191 HITGRIQQALALVDVSVLDHLVVGRGQSCSFAERGWL 227


>gi|322421682|ref|YP_004200905.1| DNA repair protein RadC [Geobacter sp. M18]
 gi|320128069|gb|ADW15629.1| DNA repair protein RadC [Geobacter sp. M18]
          Length = 231

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +I     S G+++   V+ RE+    +  SA ++IL+HNHP+G+P PS  D+
Sbjct: 135 LLLDGKNRIITRAQISEGSLNQSIVHPREVFNAAVRQSAAAMILLHNHPTGDPTPSPEDL 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I V DHIIIG+DAF SF     +
Sbjct: 195 EVTRRLCEAGQLMGIRVLDHIIIGEDAFYSFADHGQL 231


>gi|254429018|ref|ZP_05042725.1| DNA repair protein RadC [Alcanivorax sp. DG881]
 gi|196195187|gb|EDX90146.1| DNA repair protein RadC [Alcanivorax sp. DG881]
          Length = 164

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + +++ E    GTID   VY R +VQ+ L  +A ++I  HNHPSG   PS AD 
Sbjct: 68  IFLNNKHKVLSFEPLFNGTIDGAAVYPRVVVQQALACNAAAVIFAHNHPSGCCEPSQADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH ++ +  +VS      +
Sbjct: 128 TITTRLKDALALIDVRVLDHFVVSRSEWVSLAQRGWL 164


>gi|107023439|ref|YP_621766.1| DNA repair protein RadC [Burkholderia cenocepacia AU 1054]
 gi|116690521|ref|YP_836144.1| DNA repair protein RadC [Burkholderia cenocepacia HI2424]
 gi|170733862|ref|YP_001765809.1| DNA repair protein RadC [Burkholderia cenocepacia MC0-3]
 gi|123244775|sp|Q1BUB2|Y1890_BURCA RecName: Full=UPF0758 protein Bcen_1890
 gi|171855185|sp|A0K9S4|Y2501_BURCH RecName: Full=UPF0758 protein Bcen2424_2501
 gi|238688599|sp|B1JXB2|Y2526_BURCC RecName: Full=UPF0758 protein Bcenmc03_2526
 gi|105893628|gb|ABF76793.1| DNA replication and repair protein RadC [Burkholderia cenocepacia
           AU 1054]
 gi|116648610|gb|ABK09251.1| DNA replication and repair protein RadC [Burkholderia cenocepacia
           HI2424]
 gi|169817104|gb|ACA91687.1| DNA repair protein RadC [Burkholderia cenocepacia MC0-3]
          Length = 257

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N LI  E  +RG++  + VY REIV+R ++ +A ++I+ HNHPSG   PS  D 
Sbjct: 161 VYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDR 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G     SF     +
Sbjct: 221 RLTRVLKDALELVDVRLLDHVVVGVSDTFSFARAGWL 257


>gi|228993193|ref|ZP_04153114.1| DNA repair protein radC [Bacillus pseudomycoides DSM 12442]
 gi|228999243|ref|ZP_04158823.1| DNA repair protein radC [Bacillus mycoides Rock3-17]
 gi|229006790|ref|ZP_04164423.1| DNA repair protein radC [Bacillus mycoides Rock1-4]
 gi|228754412|gb|EEM03824.1| DNA repair protein radC [Bacillus mycoides Rock1-4]
 gi|228760440|gb|EEM09406.1| DNA repair protein radC [Bacillus mycoides Rock3-17]
 gi|228766519|gb|EEM15161.1| DNA repair protein radC [Bacillus pseudomycoides DSM 12442]
          Length = 225

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVMHRQTVFIGSLNASIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVECGRIIGIEVLDHIIIGDHKFVSLKEKGHI 225


>gi|110800059|ref|YP_696822.1| DNA repair protein RadC [Clostridium perfringens ATCC 13124]
 gi|168208846|ref|ZP_02634471.1| DNA repair protein, RadC family [Clostridium perfringens B str.
           ATCC 3626]
 gi|123148570|sp|Q0TNG8|Y2399_CLOP1 RecName: Full=UPF0758 protein CPF_2399
 gi|110674706|gb|ABG83693.1| DNA repair protein, RadC family [Clostridium perfringens ATCC
           13124]
 gi|170713218|gb|EDT25400.1| DNA repair protein, RadC family [Clostridium perfringens B str.
           ATCC 3626]
          Length = 227

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 57/95 (60%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  N +I+ +   +G ++   V+ REI +  ++ SA SII+ HNHPSG+P PS  DIN+
Sbjct: 133 LDTKNKVISKKEIFKGGLNSSLVHPREIFREAVKDSAASIIICHNHPSGDPTPSRDDINI 192

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  +      + I + DH+IIG + F+S K   I+
Sbjct: 193 TTRLKECGKMMGIELLDHLIIGDNRFISLKEKDIL 227


>gi|30249435|ref|NP_841505.1| DNA repair protein RadC [Nitrosomonas europaea ATCC 19718]
 gi|54036235|sp|Q82UL9|Y1464_NITEU RecName: Full=UPF0758 protein NE1464
 gi|30138798|emb|CAD85375.1| DNA repair protein radC family [Nitrosomonas europaea ATCC 19718]
          Length = 224

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  +  I  E    GT+    VY RE+V+R L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 IFLDARHRTIVTEELFNGTLTQASVYPREVVKRALYHNAAAMIFAHNHPSGIAEPSTADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++   L  +++ V DH +IG    VSF    +I
Sbjct: 188 ILTQSLKQALALVDVKVLDHFVIGSSEVVSFAERGLI 224


>gi|42518886|ref|NP_964816.1| DNA repair protein RadC [Lactobacillus johnsonii NCC 533]
 gi|41583172|gb|AAS08782.1| DNA repair protein RadC [Lactobacillus johnsonii NCC 533]
 gi|329667568|gb|AEB93516.1| DNA repair protein RadC [Lactobacillus johnsonii DPC 6026]
          Length = 203

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +IA+++  +GT++    + R+I +  +  ++T+  + HNHPSG+  PS  D+
Sbjct: 107 IYLDSKNKIIAEKLIFQGTVNRAVAHPRDIFRWAVIYNSTAFFVAHNHPSGDEQPSQHDL 166

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ ++     + I   DH I+  + ++SF+   ++
Sbjct: 167 RFTKKLVEASKCMGIDFLDHFIVTDNTYLSFRETELL 203


>gi|77164149|ref|YP_342674.1| DNA repair protein RadC [Nitrosococcus oceani ATCC 19707]
 gi|254436177|ref|ZP_05049684.1| DNA repair protein RadC [Nitrosococcus oceani AFC27]
 gi|76882463|gb|ABA57144.1| DNA repair protein RadC [Nitrosococcus oceani ATCC 19707]
 gi|207089288|gb|EDZ66560.1| DNA repair protein RadC [Nitrosococcus oceani AFC27]
          Length = 171

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + +I      +GTID   VY R +VQ+ L ++A +++  HNHPSG   PS+AD 
Sbjct: 75  LYLDNRHRVIETVELFQGTIDGASVYPRVVVQQALSVNAAAVMFFHNHPSGVAEPSNADE 134

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I V DH ++     +SF    ++
Sbjct: 135 AITRRLKEALALVDIRVLDHFVVTAGESISFAERGLL 171


>gi|220929963|ref|YP_002506872.1| DNA repair protein RadC [Clostridium cellulolyticum H10]
 gi|220000291|gb|ACL76892.1| DNA repair protein RadC [Clostridium cellulolyticum H10]
          Length = 229

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N ++  E  S G+++   V+ RE+    ++    SII +HNHPSG+P PS  D+
Sbjct: 133 ILLDTKNKVLKTESISIGSLNASIVHPREVFSEAVKCGCNSIIFIHNHPSGDPTPSKEDL 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  +I   N L I V DHII+G   +VS K    I
Sbjct: 193 QTTDRLINAGNILGIKVLDHIILGDGRYVSLKEQGFI 229


>gi|110801616|ref|YP_699420.1| DNA repair protein RadC [Clostridium perfringens SM101]
 gi|122956547|sp|Q0SR37|Y2111_CLOPS RecName: Full=UPF0758 protein CPR_2111
 gi|110682117|gb|ABG85487.1| DNA repair protein, RadC family [Clostridium perfringens SM101]
          Length = 227

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 57/95 (60%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  N +I+ +   +G ++   V+ REI +  ++ SA SII+ HNHPSG+P PS  DIN+
Sbjct: 133 LDTKNKVISKKEIFKGGLNSSLVHPREIFKEAVKDSAASIIICHNHPSGDPTPSRDDINI 192

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  +      + I + DH+IIG + F+S K   I+
Sbjct: 193 TTRLKECGKMMGIELLDHLIIGDNRFISLKEKDIL 227


>gi|330941093|gb|EGH43995.1| hypothetical protein PSYPI_16995 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 153

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 57  LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 116

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 117 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERGLM 153


>gi|307272661|ref|ZP_07553909.1| DNA repair protein RadC [Enterococcus faecalis TX0855]
 gi|306510656|gb|EFM79678.1| DNA repair protein RadC [Enterococcus faecalis TX0855]
          Length = 240

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 236


>gi|148266148|ref|YP_001232854.1| DNA repair protein RadC [Geobacter uraniireducens Rf4]
 gi|189029395|sp|A5G913|Y4138_GEOUR RecName: Full=UPF0758 protein Gura_4138
 gi|146399648|gb|ABQ28281.1| DNA replication and repair protein RadC [Geobacter uraniireducens
           Rf4]
          Length = 228

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++     S G+++   V+ RE+  + +  SA +IILVHNHP+G+P PS  DI
Sbjct: 132 LLLDGKNRILKRVQISEGSLNQSIVHPREVFNQAVRESAAAIILVHNHPTGDPTPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +    + L I V DHIIIG  +F+SF    ++
Sbjct: 192 DITRRLREAGDLLGIKVLDHIIIGDGSFLSFVDRGMM 228


>gi|114569594|ref|YP_756274.1| DNA repair protein RadC [Maricaulis maris MCS10]
 gi|114340056|gb|ABI65336.1| DNA repair protein RadC [Maricaulis maris MCS10]
          Length = 226

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/97 (54%), Positives = 68/97 (70%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEV   GTIDH PVY RE+V+  L   A++IILVHNHPSG+  PS ADI
Sbjct: 130 LFLDRKNKLIADEVLGEGTIDHAPVYPREVVKSALAHEASAIILVHNHPSGDATPSQADI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++    P  I VHDH++IG++   SFK L ++
Sbjct: 190 EMTRTLMEICKPFEIAVHDHLVIGRENTASFKTLGLM 226


>gi|253576954|ref|ZP_04854278.1| DNA repair protein RadC [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843685|gb|EES71709.1| DNA repair protein RadC [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 162

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +++ EV S GT++   V+ RE+ +  +   A SII VHNHPSG+P PS  D 
Sbjct: 66  LILNTKNRILSKEVISIGTLNSAIVHPREVFKPAIIKGAASIICVHNHPSGDPAPSSEDK 125

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I V DH++IG + +VS K   +I
Sbjct: 126 KLTERLIQAGEIIGIDVLDHVVIGTEGYVSLKEQGMI 162


>gi|119475390|ref|ZP_01615743.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2143]
 gi|119451593|gb|EAW32826.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2143]
          Length = 224

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA +    GTID   +Y RE+V+ C++ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LFLDSQHRVIAFDTLFYGTIDAACIYPREVVRCCMQHNAAAVIFAHNHPSGIAEPSQADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  +++ V DH ++G    VSF    ++
Sbjct: 188 QITRRLIDALVLIDVRVLDHFVVGDGVLVSFAERGLL 224


>gi|328957163|ref|YP_004374549.1| DNA repair protein RadC [Carnobacterium sp. 17-4]
 gi|328673487|gb|AEB29533.1| DNA repair protein RadC [Carnobacterium sp. 17-4]
          Length = 230

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 54/95 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G ++    + REI +  +  SA  +I+ HNHPSGNP PS+ADI
Sbjct: 134 LYLNTKNEIIKKETIFIGGLNSSIAHPREIFKGAVRYSAARMIVGHNHPSGNPEPSEADI 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
             T+ +      + I + DHIIIG+  F+S K + 
Sbjct: 194 QFTRRMSECGELMGIDLLDHIIIGEHEFISLKEIG 228


>gi|167465896|ref|ZP_02330985.1| RadC [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 145

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++A E  S G+++   V+ RE+ +  ++ S+ SII VHNHPSGNP PS  DI
Sbjct: 49  LFLNTKNQVLAKETMSIGSLNASIVHPREVFRAAIKRSSASIICVHNHPSGNPTPSLDDI 108

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +I     + I V DHIIIG  A+VS K    +
Sbjct: 109 DITQRLIEAGAIIGIDVLDHIIIGDKAYVSLKEQGYM 145


>gi|117620845|ref|YP_855621.1| putative DNA repair protein RadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562252|gb|ABK39200.1| putative DNA repair protein RadC [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 176

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E    GT+    VY R++V++ L  +A +++LVHNHPSG P PS ADI
Sbjct: 80  LFLDNQHRVLAYEELFLGTLSAATVYPRDVVKQALHYNAAALMLVHNHPSGYPEPSRADI 139

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I + DH+++G +  VS     +I
Sbjct: 140 AITLRLQNALALVDIRILDHLVVGTEGVVSLAERGLI 176


>gi|229593348|ref|YP_002875467.1| DNA repair protein RadC [Pseudomonas fluorescens SBW25]
 gi|259551894|sp|C3K471|Y5982_PSEFS RecName: Full=UPF0758 protein PFLU_5982
 gi|229365214|emb|CAY53505.1| DNA repair protein [Pseudomonas fluorescens SBW25]
          Length = 224

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E  S+GTID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDSRHRVLGFEALSQGTIDAAMVYPRQVVKRALAYNAAALILCHNHPSGSLEPSAADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DHII+G    +S      +
Sbjct: 188 KLTKLLQKALEVVDVRVLDHIIVGDGDPLSMAEYGWL 224


>gi|253991844|ref|YP_003043200.1| DNA repair protein RadC [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783294|emb|CAQ86459.1| dna repair protein radc [Photorhabdus asymbiotica]
          Length = 230

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  E   +GTI+ V V+ REIV+  ++++A+SIIL HNHPSG+  PS AD 
Sbjct: 134 LFLNNQNKVICHEEMFKGTINKVEVHPREIVRSAIKVNASSIILAHNHPSGHAEPSLADK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I   N + I V DH++IG+   VSF     I
Sbjct: 194 IVTDKVIDACNLVGIQVLDHLVIGRQCCVSFAERGWI 230


>gi|168205621|ref|ZP_02631626.1| DNA repair protein, RadC family [Clostridium perfringens E str.
           JGS1987]
 gi|169344220|ref|ZP_02865202.1| DNA repair protein, RadC family [Clostridium perfringens C str.
           JGS1495]
 gi|169297679|gb|EDS79779.1| DNA repair protein, RadC family [Clostridium perfringens C str.
           JGS1495]
 gi|170662943|gb|EDT15626.1| DNA repair protein, RadC family [Clostridium perfringens E str.
           JGS1987]
          Length = 227

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 57/95 (60%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  N +I+ +   +G ++   V+ REI +  ++ SA SII+ HNHPSG+P PS  DIN+
Sbjct: 133 LDTKNKVISKKEIFKGGLNSSLVHPREIFREAVKDSAASIIICHNHPSGDPTPSRDDINI 192

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  +      + I + DH+IIG + F+S K   I+
Sbjct: 193 TTRLKECGKMMGIELLDHLIIGDNRFISLKEKDIL 227


>gi|39997266|ref|NP_953217.1| DNA repair protein RadC [Geobacter sulfurreducens PCA]
 gi|39984156|gb|AAR35544.1| DNA repair protein RadC [Geobacter sulfurreducens PCA]
          Length = 163

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  +  S G+++   V+ RE+ +     +A +I+LVHNHP+G+PNPS  DI
Sbjct: 67  LHLDGKNRIVCFDRVSIGSLNQAIVHPREVFKTACLSNAAAILLVHNHPTGDPNPSSEDI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  + + L I V DHII+G D F+SF    ++
Sbjct: 127 AITKRLKESGDILGIRVLDHIIVGDDEFLSFVEQGLL 163


>gi|30995411|ref|NP_439113.2| DNA repair protein RadC [Haemophilus influenzae Rd KW20]
 gi|38372879|sp|P44952|Y952_HAEIN RecName: Full=UPF0758 protein HI_0952
          Length = 221

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI    VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTIYVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 221


>gi|302037875|ref|YP_003798197.1| DNA repair protein RadC-like protein [Candidatus Nitrospira
           defluvii]
 gi|300605939|emb|CBK42272.1| DNA repair protein RadC homolog [Candidatus Nitrospira defluvii]
          Length = 238

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +I D   S G++    V+ RE+    +  SA  +I +HNHPSG+P PS  D 
Sbjct: 135 VLLDAKNQVIRDVTISEGSLTLSIVHPREVFIPAMRASAAGVIFLHNHPSGDPTPSQEDR 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +++  + L I V DH+I+G   +VSF     +
Sbjct: 195 VLTARLVSAGSLLGIQVLDHLIVGDGRYVSFADQGWL 231


>gi|77361558|ref|YP_341133.1| associated with replication fork DNA repair protein
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123587696|sp|Q3IFE5|Y2643_PSEHT RecName: Full=UPF0758 protein PSHAa2643
 gi|76876469|emb|CAI87691.1| associated with replication fork DNA repair protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 224

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI DE+   GTI+   VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LYLDSQNRLIKDEILFYGTINSASVYPREVVKAALKNNAAAVIFAHNHPSGIAEPSQADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I V DHII+G +  VSF    +I
Sbjct: 188 LITNKLQQALQLVDINVLDHIIVGGETCVSFAERGLI 224


>gi|257874771|ref|ZP_05654424.1| DNA repair protein RadC [Enterococcus casseliflavus EC20]
 gi|257808937|gb|EEV37757.1| DNA repair protein RadC [Enterococcus casseliflavus EC20]
          Length = 230

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++    + REI    +  SA  +I+VHNHPSG+P  S+AD+
Sbjct: 129 LYLNTKNEIIQKKTIFIGSLNQSIAHPREIFHWAVRYSAARVIVVHNHPSGSPQASEADL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +I   + + I + DH+IIG +A+VS +   +
Sbjct: 189 LFTRRLIKCGDLMGIDILDHLIIGDNAYVSLREEGL 224


>gi|257865156|ref|ZP_05644809.1| DNA repair protein RadC [Enterococcus casseliflavus EC30]
 gi|257871480|ref|ZP_05651133.1| DNA repair protein RadC [Enterococcus casseliflavus EC10]
 gi|257799090|gb|EEV28142.1| DNA repair protein RadC [Enterococcus casseliflavus EC30]
 gi|257805644|gb|EEV34466.1| DNA repair protein RadC [Enterococcus casseliflavus EC10]
          Length = 230

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G+++    + REI    +  SA  +I+VHNHPSG+P  S+AD+
Sbjct: 129 LYLNTKNEIIQKKTIFIGSLNQSIAHPREIFHWAVRYSAARVIVVHNHPSGSPQASEADL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +I   + + I + DH+IIG +A+VS +   +
Sbjct: 189 LFTRRLIKCGDLMGIDILDHLIIGDNAYVSLREEGL 224


>gi|121595744|ref|YP_987640.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|171769520|sp|A1WBD9|Y3450_ACISJ RecName: Full=UPF0758 protein Ajs_3450
 gi|120607824|gb|ABM43564.1| DNA replication and repair protein RadC [Acidovorax sp. JS42]
          Length = 238

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 142 LFLDSGNRLIAMEELFRGTLTQTSVYPREVVLRALHHHAAAVVLAHNHPSGSVQPSRADE 201

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+   A +S     ++
Sbjct: 202 ALTQTLKAALALVDVRVLDHVIVAPGAALSMAEQGLV 238


>gi|307278557|ref|ZP_07559629.1| DNA repair protein RadC [Enterococcus faecalis TX0860]
 gi|306504794|gb|EFM73992.1| DNA repair protein RadC [Enterococcus faecalis TX0860]
          Length = 240

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 236


>gi|229547599|ref|ZP_04436324.1| DNA repair protein RadC [Enterococcus faecalis TX1322]
 gi|229548193|ref|ZP_04436918.1| DNA repair protein RadC [Enterococcus faecalis ATCC 29200]
 gi|307275090|ref|ZP_07556244.1| DNA repair protein RadC [Enterococcus faecalis TX2134]
 gi|307287379|ref|ZP_07567438.1| DNA repair protein RadC [Enterococcus faecalis TX0109]
 gi|312952214|ref|ZP_07771092.1| DNA repair protein RadC [Enterococcus faecalis TX0102]
 gi|229306672|gb|EEN72668.1| DNA repair protein RadC [Enterococcus faecalis ATCC 29200]
 gi|229307289|gb|EEN73276.1| DNA repair protein RadC [Enterococcus faecalis TX1322]
 gi|306501552|gb|EFM70848.1| DNA repair protein RadC [Enterococcus faecalis TX0109]
 gi|306508208|gb|EFM77324.1| DNA repair protein RadC [Enterococcus faecalis TX2134]
 gi|310629870|gb|EFQ13153.1| DNA repair protein RadC [Enterococcus faecalis TX0102]
 gi|315028140|gb|EFT40072.1| DNA repair protein RadC [Enterococcus faecalis TX2137]
 gi|315030879|gb|EFT42811.1| DNA repair protein RadC [Enterococcus faecalis TX4000]
 gi|315032296|gb|EFT44228.1| DNA repair protein RadC [Enterococcus faecalis TX0017]
 gi|315036225|gb|EFT48157.1| DNA repair protein RadC [Enterococcus faecalis TX0027]
 gi|315148798|gb|EFT92814.1| DNA repair protein RadC [Enterococcus faecalis TX4244]
 gi|315154537|gb|EFT98553.1| DNA repair protein RadC [Enterococcus faecalis TX0031]
 gi|315160102|gb|EFU04119.1| DNA repair protein RadC [Enterococcus faecalis TX0312]
 gi|315163278|gb|EFU07295.1| DNA repair protein RadC [Enterococcus faecalis TX0645]
 gi|315165917|gb|EFU09934.1| DNA repair protein RadC [Enterococcus faecalis TX1302]
 gi|315169324|gb|EFU13341.1| DNA repair protein RadC [Enterococcus faecalis TX1341]
 gi|315171821|gb|EFU15838.1| DNA repair protein RadC [Enterococcus faecalis TX1342]
 gi|327536079|gb|AEA94913.1| DNA repair protein RadC [Enterococcus faecalis OG1RF]
          Length = 240

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 236


>gi|300714649|ref|YP_003739452.1| DNA repair protein RadC [Erwinia billingiae Eb661]
 gi|299060485|emb|CAX57592.1| DNA repair protein RadC [Erwinia billingiae Eb661]
          Length = 222

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 54/96 (56%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           FLD  + +I       GT++ V V+ REIV+  L  +A ++IL HNHPSG   PS AD  
Sbjct: 127 FLDNQHRMIHACEMFAGTLNSVEVHPREIVKEALAKNAAALILAHNHPSGVARPSRADHQ 186

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ I+     +NI V DHI+IG    VSF     I
Sbjct: 187 VTRRIVAACQLMNIHVLDHIVIGHGESVSFAERGWI 222


>gi|187933370|ref|YP_001884766.1| DNA repair protein RadC [Clostridium botulinum B str. Eklund 17B]
 gi|238691627|sp|B2TK55|Y562_CLOBB RecName: Full=UPF0758 protein CLL_A0562
 gi|187721523|gb|ACD22744.1| DNA repair protein RadC [Clostridium botulinum B str. Eklund 17B]
          Length = 229

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  NI+I  +   +G+++   V+ REI +  +  S+  II+ HNHPSG+P PS  DI
Sbjct: 133 IFLNTKNIVIGTKDVFKGSLNTSIVHPREIFKEAVNKSSAKIIISHNHPSGDPTPSKEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  I      + I + DHIIIGK+ F+S K    I
Sbjct: 193 NITLRIKECGEIMGIQLLDHIIIGKNGFISLKEKGFI 229


>gi|126172629|ref|YP_001048778.1| DNA repair protein RadC [Shewanella baltica OS155]
 gi|160873513|ref|YP_001552829.1| DNA repair protein RadC [Shewanella baltica OS195]
 gi|217971608|ref|YP_002356359.1| DNA repair protein RadC [Shewanella baltica OS223]
 gi|304411668|ref|ZP_07393280.1| DNA repair protein RadC [Shewanella baltica OS183]
 gi|307306280|ref|ZP_07586025.1| DNA repair protein RadC [Shewanella baltica BA175]
 gi|166218793|sp|A3CZJ6|Y377_SHEB5 RecName: Full=UPF0758 protein Sbal_0377
 gi|189029402|sp|A9KY04|Y388_SHEB9 RecName: Full=UPF0758 protein Sbal195_0388
 gi|254789658|sp|B8E4J5|Y402_SHEB2 RecName: Full=UPF0758 protein Sbal223_0402
 gi|125995834|gb|ABN59909.1| DNA repair protein RadC [Shewanella baltica OS155]
 gi|160859035|gb|ABX47569.1| DNA repair protein RadC [Shewanella baltica OS195]
 gi|217496743|gb|ACK44936.1| DNA repair protein RadC [Shewanella baltica OS223]
 gi|304349856|gb|EFM14262.1| DNA repair protein RadC [Shewanella baltica OS183]
 gi|306911153|gb|EFN41580.1| DNA repair protein RadC [Shewanella baltica BA175]
 gi|315265742|gb|ADT92595.1| DNA repair protein RadC [Shewanella baltica OS678]
          Length = 225

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|254430046|ref|ZP_05043753.1| DNA repair protein RadC [Alcanivorax sp. DG881]
 gi|196196215|gb|EDX91174.1| DNA repair protein RadC [Alcanivorax sp. DG881]
          Length = 164

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + +++ E    GTID   VY R IVQ+ L  +A ++I  HNHPSG   PS AD 
Sbjct: 68  IFLNNKHKVLSFETLFTGTIDGAAVYPRVIVQQALACNAAAVIFSHNHPSGCCEPSRADQ 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DH ++ +  +VS     ++
Sbjct: 128 QITKRLTDALALIDVRVLDHFVVSRSEWVSLAERGMV 164


>gi|319654832|ref|ZP_08008908.1| hypothetical protein HMPREF1013_05530 [Bacillus sp. 2_A_57_CT2]
 gi|317393550|gb|EFV74312.1| hypothetical protein HMPREF1013_05530 [Bacillus sp. 2_A_57_CT2]
          Length = 218

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N++I  +   +G+++   V+ REI +  ++LSA SII  HNHPSG+P PS  DI
Sbjct: 121 LFLNSKNVVIGRKTIFKGSLNASIVHPREIFREAVKLSAASIIAGHNHPSGDPYPSREDI 180

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDA-FVSFKGLRI 96
            +T+ +      + I + DHIIIG    F S K    
Sbjct: 181 EVTKRLSEAGKLVGIDLLDHIIIGHHGNFTSLKEKGY 217


>gi|237797777|ref|ZP_04586238.1| hypothetical protein POR16_02922 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331020627|gb|EGI00684.1| hypothetical protein POR16_02922 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 224

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R L  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMNFEILFRGTINASYVHPRQVVKRALAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALLLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|66043492|ref|YP_233333.1| DNA repair protein RadC [Pseudomonas syringae pv. syringae B728a]
 gi|75503901|sp|Q4ZZX7|Y222_PSEU2 RecName: Full=UPF0758 protein Psyr_0222
 gi|63254199|gb|AAY35295.1| DNA repair protein RadC [Pseudomonas syringae pv. syringae B728a]
 gi|330972197|gb|EGH72263.1| hypothetical protein PSYAR_17040 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 224

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALLLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|49474229|ref|YP_032271.1| DNA repair protein radC [Bartonella quintana str. Toulouse]
 gi|49239733|emb|CAF26115.1| DNA repair protein radC [Bartonella quintana str. Toulouse]
          Length = 264

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L+ADEVQ  GTIDH PVY RE++ R L+LSA+ +ILVHNHPSG+ +PS+ADI
Sbjct: 168 LFLDKKNGLLADEVQQTGTIDHTPVYPREVISRALQLSASGLILVHNHPSGDSSPSEADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +    N L I VHDH+IIG++ + SFK L+ I
Sbjct: 228 TMTHRLKDAANALGITVHDHLIIGRNNYTSFKALKFI 264


>gi|300310517|ref|YP_003774609.1| DNA repair RadC-like protein [Herbaspirillum seropedicae SmR1]
 gi|300073302|gb|ADJ62701.1| DNA repair RadC-like protein [Herbaspirillum seropedicae SmR1]
          Length = 224

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 53/95 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI  E   +GT+    VY RE+++  L  +A S+IL HNHPSG+P PSD D+
Sbjct: 128 LFLDVRNKLIGTEELFKGTLTQSAVYPREVIKAALRHNAASVILAHNHPSGDPEPSDHDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T  +   L  ++I + DH ++      SF    
Sbjct: 188 RLTAALDEALQMMDIRLLDHFVVAGTRLYSFADHG 222


>gi|288553589|ref|YP_003425524.1| DNA repair protein RadC [Bacillus pseudofirmus OF4]
 gi|288544749|gb|ADC48632.1| DNA repair protein RadC [Bacillus pseudofirmus OF4]
          Length = 230

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G+++   V+ RE+ +  L  SA SII +HNHPSG+P PS  DI
Sbjct: 133 LYLNTKNRVIHRHTLFIGSLNASIVHPREVFKEALRRSAASIICLHNHPSGDPTPSLEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L + + DH+IIG   F+S K    I
Sbjct: 193 EVTKRLNEAGKVLGVELLDHVIIGDRKFISLKEQGHI 229


>gi|258511792|ref|YP_003185226.1| DNA repair protein RadC [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478518|gb|ACV58837.1| DNA repair protein RadC [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 233

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++A++  S G++D   V+ REI +R + +SA+SI+ +HNHPSG+P+PS  DI
Sbjct: 133 LLLDTKHRVLAEDTSSVGSLDASIVHPREIFRRAIRISASSILCIHNHPSGDPSPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DHI+IG   FVS +    +
Sbjct: 193 AVTKRLVEAGRVLGIEVLDHIVIGDGRFVSLRAEGYL 229


>gi|260893389|ref|YP_003239486.1| DNA repair protein RadC [Ammonifex degensii KC4]
 gi|260865530|gb|ACX52636.1| DNA repair protein RadC [Ammonifex degensii KC4]
          Length = 232

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+  E  + G ++   V  RE+ +  +  SA ++ILVHNHPSG+P PS  D+
Sbjct: 136 ILLDTKNQLLGIETVAVGGLNSAGVLPREVFRAAVRRSACALILVHNHPSGDPTPSGEDL 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   + L I V DH+IIG + +VS K   +
Sbjct: 196 ALTRRLVQAGDLLGIEVLDHLIIGDNCYVSLKEANL 231


>gi|120597169|ref|YP_961743.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
 gi|146291569|ref|YP_001181993.1| DNA repair protein RadC [Shewanella putrefaciens CN-32]
 gi|166218795|sp|A4Y2L1|Y462_SHEPC RecName: Full=UPF0758 protein Sputcn32_0462
 gi|166218797|sp|A1REU4|Y338_SHESW RecName: Full=UPF0758 protein Sputw3181_0338
 gi|120557262|gb|ABM23189.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
 gi|145563259|gb|ABP74194.1| DNA repair protein RadC [Shewanella putrefaciens CN-32]
 gi|319424742|gb|ADV52816.1| DNA repair protein RadC [Shewanella putrefaciens 200]
          Length = 225

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|309751380|gb|ADO81364.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 221

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 125 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  +   + I V DH+I+GK    SF    ++
Sbjct: 185 LITKKIQESAELMEIRVLDHLIVGKTDCYSFAENFLL 221


>gi|315156406|gb|EFU00423.1| DNA repair protein RadC [Enterococcus faecalis TX0043]
          Length = 240

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 236


>gi|293382175|ref|ZP_06628118.1| DNA repair protein RadC [Enterococcus faecalis R712]
 gi|293388514|ref|ZP_06633018.1| DNA repair protein RadC [Enterococcus faecalis S613]
 gi|312905730|ref|ZP_07764752.1| DNA repair protein RadC [Enterococcus faecalis DAPTO 512]
 gi|312909075|ref|ZP_07767935.1| DNA repair protein RadC [Enterococcus faecalis DAPTO 516]
 gi|291080458|gb|EFE17822.1| DNA repair protein RadC [Enterococcus faecalis R712]
 gi|291082118|gb|EFE19081.1| DNA repair protein RadC [Enterococcus faecalis S613]
 gi|310628209|gb|EFQ11492.1| DNA repair protein RadC [Enterococcus faecalis DAPTO 512]
 gi|311290637|gb|EFQ69193.1| DNA repair protein RadC [Enterococcus faecalis DAPTO 516]
          Length = 240

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 236


>gi|289209451|ref|YP_003461517.1| DNA repair protein RadC [Thioalkalivibrio sp. K90mix]
 gi|288945082|gb|ADC72781.1| DNA repair protein RadC [Thioalkalivibrio sp. K90mix]
          Length = 242

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +IA E   RGTID   V+ RE+V+R L  +A ++IL HNHPSG   PS +DI
Sbjct: 147 LFLDNRHRVIAFEELFRGTIDGAAVHPREVVRRVLHHNAAAVILAHNHPSGVAEPSGSDI 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH++I     VS     ++
Sbjct: 207 AITRRLTEALGLVDVRILDHVVIAD-TPVSMAERGLL 242


>gi|149202958|ref|ZP_01879929.1| DNA repair protein RadC [Roseovarius sp. TM1035]
 gi|149143504|gb|EDM31540.1| DNA repair protein RadC [Roseovarius sp. TM1035]
          Length = 251

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/96 (58%), Positives = 75/96 (78%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ NILIADE Q+RGTIDHVPVY RE+V+R L L+A+++ILVHNHPSG+P PS ADI+
Sbjct: 156 YLDRKNILIADEEQARGTIDHVPVYPREVVKRALHLNASALILVHNHPSGDPTPSAADIS 215

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT+ + T    L + +HDHI+IGK + VSF+    +
Sbjct: 216 MTRQVQTAAEALGLTLHDHIVIGKSSEVSFRSSGFL 251


>gi|145638225|ref|ZP_01793835.1| DNA repair protein RadC [Haemophilus influenzae PittII]
 gi|145272554|gb|EDK12461.1| DNA repair protein RadC [Haemophilus influenzae PittII]
          Length = 214

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 118 LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 177

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  +   + I V DH+I+GK    SF    ++
Sbjct: 178 LITKKIQESAELMEIRVLDHLIVGKTDCYSFAENFLL 214


>gi|90422099|ref|YP_530469.1| DNA repair protein RadC [Rhodopseudomonas palustris BisB18]
 gi|90104113|gb|ABD86150.1| DNA repair protein RadC [Rhodopseudomonas palustris BisB18]
          Length = 242

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GTIDH PVY REIV+R LELSAT+II+VHNHPSG+P PS +DI
Sbjct: 146 LFLDKRNQLIADELQQVGTIDHTPVYPREIVKRALELSATAIIMVHNHPSGDPTPSQSDI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II    PL I VHDHII+GK    S KGL++I
Sbjct: 206 TMTKQIIDIAKPLGIAVHDHIIVGKHGHASLKGLKLI 242


>gi|83858758|ref|ZP_00952280.1| DNA repair protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853581|gb|EAP91433.1| DNA repair protein [Oceanicaulis alexandrii HTCC2633]
          Length = 213

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LDK N L+ADE Q+RGT+DH PVY RE+V+R L L A+++ILVHNHPSG+P PS ADI
Sbjct: 117 LYLDKKNRLVADEHQARGTVDHAPVYPREVVKRALALDASALILVHNHPSGDPTPSHADI 176

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +I+   P NI+VHDH++IG++   SFK L ++
Sbjct: 177 EMTKLVISAAKPFNIVVHDHLVIGRERTASFKSLGLL 213


>gi|317154521|ref|YP_004122569.1| DNA repair protein RadC [Desulfovibrio aespoeensis Aspo-2]
 gi|316944772|gb|ADU63823.1| DNA repair protein RadC [Desulfovibrio aespoeensis Aspo-2]
          Length = 227

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 57/96 (59%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           F+D  N +IA E  S+GT+D  PV+ REI+   L L A ++IL HNHP G+P PS  D++
Sbjct: 132 FMDSKNRVIAWEQVSKGTVDATPVFPREIMVTALRLEAAALILAHNHPGGDPTPSREDLD 191

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ I  T   L I + DHII+    + SF     +
Sbjct: 192 LTRRIRDTAQGLGIRILDHIIVTDHEYYSFNEHGRL 227


>gi|317493712|ref|ZP_07952129.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918039|gb|EFV39381.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 159

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N L+A E    G+I    V+ RE+V+R L  +A ++IL HNHPSG+  PS +D 
Sbjct: 63  LYLNHQNQLLAWETLFTGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDIAPSQSDK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +I  L  +++ V DH I+G     SF    ++
Sbjct: 123 VITQRLIQALGLVDVRVLDHFIVGGRHIASFAENGLL 159


>gi|187731500|ref|YP_001882335.1| DNA repair protein RadC [Shigella boydii CDC 3083-94]
 gi|238691678|sp|B2TTV2|YICR_SHIB3 RecName: Full=UPF0758 protein yicR
 gi|187428492|gb|ACD07766.1| DNA repair protein RadC [Shigella boydii CDC 3083-94]
          Length = 222

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 126 IFLDSQHRVITHSRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II +   +++ V DHI+IG+   VSF     I
Sbjct: 186 LITERIIKSCQFMDLRVLDHIVIGRGENVSFAERGWI 222


>gi|330720900|gb|EGG99083.1| DNA repair protein RadC [gamma proteobacterium IMCC2047]
          Length = 97

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          ++LD  + LI  +    GTID   VY RE+V+  +E +A ++IL HNHPSG   PS AD 
Sbjct: 1  MYLDSQHRLIRYQPHFYGTIDSASVYPRELVKSAIEYNAAAVILAHNHPSGVAEPSQADR 60

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ +   ++ + + V DH+++G    VSF     +
Sbjct: 61 QITEQVRKAMSLIGVRVLDHMVVGDSEVVSFAERGWL 97


>gi|119773468|ref|YP_926208.1| DNA repair protein RadC [Shewanella amazonensis SB2B]
 gi|166218792|sp|A1S2D2|Y327_SHEAM RecName: Full=UPF0758 protein Sama_0327
 gi|119765968|gb|ABL98538.1| DNA repair protein RadC [Shewanella amazonensis SB2B]
          Length = 225

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDAASVYPRELVSLVLEKRAAAVIVCHNHPSGVAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|118593437|ref|ZP_01550817.1| DNA repair protein RadC [Stappia aggregata IAM 12614]
 gi|118433916|gb|EAV40574.1| DNA repair protein RadC [Stappia aggregata IAM 12614]
          Length = 237

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+++R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 141 LFLDKKNALIADEVQQTGTVDHTPVYPREVIRRALELSATALILVHNHPSGDPTPSRADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+    PL I VHDHII+G  + VSF+ L++I
Sbjct: 201 QMTKKIVDIAGPLGIEVHDHIIVGLRSNVSFRSLQLI 237


>gi|56475704|ref|YP_157293.1| RadC family DNA repair protein [Aromatoleum aromaticum EbN1]
 gi|56311747|emb|CAI06392.1| DNA repair protein similar to radC family [Aromatoleum aromaticum
           EbN1]
          Length = 196

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LI  E   RGT+    VY REIV+R LEL A  +I  H HPSG   PS AD 
Sbjct: 100 LYLNARNHLILAEEAFRGTLTQTSVYPREIVRRALELRAAGVIFSHQHPSGACEPSLADE 159

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  + + V DH ++   + VSF    ++
Sbjct: 160 LLTRTLTSALAMVEVRVLDHFVVAGHSTVSFAERGLL 196


>gi|206890013|ref|YP_002248228.1| DNA repair protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741951|gb|ACI21008.1| DNA repair protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 224

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 55/95 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD    LI +   S GT++   ++ RE+ +  ++ SA ++IL+HNHPSG+P PS+ DI
Sbjct: 128 LLLDTKLRLIREVKVSEGTLNQSLIHPREVFKDAVKESAYAVILIHNHPSGDPTPSEQDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +      L I + DH+IIG   + S K   
Sbjct: 188 EITKKLKKASEILEIPILDHVIIGSGKYFSMKERG 222


>gi|293400888|ref|ZP_06645033.1| DNA repair protein RadC [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305914|gb|EFE47158.1| DNA repair protein RadC [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 225

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N ++       GT+    V+ REI +  ++     II VHNHPSG+  PSDADI
Sbjct: 128 LFLDQRNHVLCYRTMFMGTLTSASVHPREIFKEAMQQGCAKIICVHNHPSGDATPSDADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I + DHII+ ++ ++SF+  R++
Sbjct: 188 TLTKAIQEAGKMVAIPLIDHIIVARNTYISFRQKRLM 224


>gi|255970845|ref|ZP_05421431.1| DNA repair protein RadC [Enterococcus faecalis T1]
 gi|256761220|ref|ZP_05501800.1| DNA repair protein RadC [Enterococcus faecalis T3]
 gi|255961863|gb|EET94339.1| DNA repair protein RadC [Enterococcus faecalis T1]
 gi|256682471|gb|EEU22166.1| DNA repair protein RadC [Enterococcus faecalis T3]
          Length = 227

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 128 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 188 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 223


>gi|89902021|ref|YP_524492.1| DNA repair protein RadC [Rhodoferax ferrireducens T118]
 gi|122478527|sp|Q21TE2|Y3252_RHOFD RecName: Full=UPF0758 protein Rfer_3252
 gi|89346758|gb|ABD70961.1| DNA repair protein RadC [Rhodoferax ferrireducens T118]
          Length = 234

 Score =  128 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A+S++L HNHPSG   PS AD 
Sbjct: 138 LFLDVQNRLLALEELFRGTLTQTSVYPREVVLRALHHQASSVVLAHNHPSGTVQPSRADE 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + TTL  +++ V DH+I+     +S     ++
Sbjct: 198 MLTQTLKTTLALIDVRVLDHVIVAPGEALSMAERGLL 234


>gi|255974420|ref|ZP_05425006.1| DNA repair protein RadC [Enterococcus faecalis T2]
 gi|255967292|gb|EET97914.1| DNA repair protein RadC [Enterococcus faecalis T2]
          Length = 227

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 128 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 188 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 223


>gi|313903989|ref|ZP_07837369.1| DNA repair protein RadC [Eubacterium cellulosolvens 6]
 gi|313471138|gb|EFR66460.1| DNA repair protein RadC [Eubacterium cellulosolvens 6]
          Length = 236

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+ +   SRGT++   +  RE+    L   A S+ILVHNHPSG+P+PS  D 
Sbjct: 136 VMLDTKNHLLGEAEISRGTVNQSLISPRELFLSALSFHAVSVILVHNHPSGDPSPSGDDQ 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I      L I + DHIIIG   + SF    ++
Sbjct: 196 DVTERIRCAGELLGIRLVDHIIIGDGEYFSFMEHGLL 232


>gi|254439250|ref|ZP_05052744.1| DNA repair protein RadC [Octadecabacter antarcticus 307]
 gi|198254696|gb|EDY79010.1| DNA repair protein RadC [Octadecabacter antarcticus 307]
          Length = 266

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q  GT+DHVPVY RE+V+R LEL+A+S+ILVHNHPSG+P PS+ DI
Sbjct: 170 LFLDRKNVLIADEAQGNGTVDHVPVYPREVVKRALELNASSLILVHNHPSGDPTPSNEDI 229

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      LNI +HDH+IIG+   +SFK   +I
Sbjct: 230 AMTMQIHDAAKALNISLHDHLIIGRSRELSFKSQGLI 266


>gi|218290834|ref|ZP_03494903.1| DNA repair protein RadC [Alicyclobacillus acidocaldarius LAA1]
 gi|218239192|gb|EED06393.1| DNA repair protein RadC [Alicyclobacillus acidocaldarius LAA1]
          Length = 233

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++A++  S G++D   V+ REI +R + +SA+SI+ +HNHPSG+P+PS  DI
Sbjct: 133 LLLDTKHRVLAEDTSSVGSLDASIVHPREIFRRAIRISASSILCIHNHPSGDPSPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DHI+IG   FVS +    +
Sbjct: 193 AVTKRLVEAGRVLGIEVLDHIVIGDGRFVSLRAEGYL 229


>gi|293392460|ref|ZP_06636780.1| DNA repair protein RadC [Serratia odorifera DSM 4582]
 gi|291424862|gb|EFE98071.1| DNA repair protein RadC [Serratia odorifera DSM 4582]
          Length = 159

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+A E    GTI+   V+ RE+V+  ++ +A S +L HNHPS    PS AD 
Sbjct: 63  LWLDNQNRLLAQETLFTGTINSTTVHPRELVKSAMKHNAASAVLAHNHPSQLAEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I T L  +++ V DH+++G    VSF     +
Sbjct: 123 QITDRIKTALQLVDVRVVDHLVVGGLDIVSFAERGWL 159


>gi|146306213|ref|YP_001186678.1| DNA repair protein RadC [Pseudomonas mendocina ymp]
 gi|145574414|gb|ABP83946.1| DNA repair protein RadC [Pseudomonas mendocina ymp]
          Length = 165

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I+ E   RGT+D   VY RE+V+  L  +A ++ILVHNHPSG+P+PS ADI
Sbjct: 69  LLLDSKHRVISFEELFRGTLDAASVYPREVVKTVLAHNAAAVILVHNHPSGDPSPSQADI 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +     DH I+G +  VS     ++
Sbjct: 129 RLTQTLKNALVMVGTTTLDHFIVGSEGIVSLAEQGLL 165


>gi|227518208|ref|ZP_03948257.1| DNA repair protein RadC [Enterococcus faecalis TX0104]
 gi|256618290|ref|ZP_05475136.1| DNA repair protein RadC [Enterococcus faecalis ATCC 4200]
 gi|256852483|ref|ZP_05557859.1| DNA repair protein RadC [Enterococcus faecalis T8]
 gi|256958161|ref|ZP_05562332.1| DNA repair protein RadC [Enterococcus faecalis DS5]
 gi|257077434|ref|ZP_05571795.1| DNA repair protein RadC [Enterococcus faecalis JH1]
 gi|257088067|ref|ZP_05582428.1| DNA repair protein RadC [Enterococcus faecalis D6]
 gi|257091146|ref|ZP_05585507.1| DNA repair protein radC [Enterococcus faecalis CH188]
 gi|257417093|ref|ZP_05594087.1| DNA repair protein RadC [Enterococcus faecalis AR01/DG]
 gi|257417807|ref|ZP_05594801.1| DNA repair protein radC [Enterococcus faecalis T11]
 gi|294779645|ref|ZP_06745036.1| DNA repair protein RadC [Enterococcus faecalis PC1.1]
 gi|300860938|ref|ZP_07107025.1| DNA repair protein RadC [Enterococcus faecalis TUSoD Ef11]
 gi|227074364|gb|EEI12327.1| DNA repair protein RadC [Enterococcus faecalis TX0104]
 gi|256597817|gb|EEU16993.1| DNA repair protein RadC [Enterococcus faecalis ATCC 4200]
 gi|256712337|gb|EEU27369.1| DNA repair protein RadC [Enterococcus faecalis T8]
 gi|256948657|gb|EEU65289.1| DNA repair protein RadC [Enterococcus faecalis DS5]
 gi|256985464|gb|EEU72766.1| DNA repair protein RadC [Enterococcus faecalis JH1]
 gi|256996097|gb|EEU83399.1| DNA repair protein RadC [Enterococcus faecalis D6]
 gi|256999958|gb|EEU86478.1| DNA repair protein radC [Enterococcus faecalis CH188]
 gi|257158921|gb|EEU88881.1| DNA repair protein RadC [Enterococcus faecalis ARO1/DG]
 gi|257159635|gb|EEU89595.1| DNA repair protein radC [Enterococcus faecalis T11]
 gi|294453302|gb|EFG21713.1| DNA repair protein RadC [Enterococcus faecalis PC1.1]
 gi|295114297|emb|CBL32934.1| DNA replication and repair protein RadC [Enterococcus sp. 7L76]
 gi|300849977|gb|EFK77727.1| DNA repair protein RadC [Enterococcus faecalis TUSoD Ef11]
 gi|315151663|gb|EFT95679.1| DNA repair protein RadC [Enterococcus faecalis TX0012]
 gi|323478891|gb|ADX78330.1| DNA repair protein RadC family protein [Enterococcus faecalis 62]
 gi|329573420|gb|EGG55030.1| DNA repair protein RadC [Enterococcus faecalis TX1467]
          Length = 232

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 133 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 193 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 228


>gi|260888418|ref|ZP_05899681.1| DNA repair protein RadC [Selenomonas sputigena ATCC 35185]
 gi|330838268|ref|YP_004412848.1| DNA repair protein RadC [Selenomonas sputigena ATCC 35185]
 gi|260861954|gb|EEX76454.1| DNA repair protein RadC [Selenomonas sputigena ATCC 35185]
 gi|329746032|gb|AEB99388.1| DNA repair protein RadC [Selenomonas sputigena ATCC 35185]
          Length = 229

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N ++A +  S GT+    V+ RE+ Q  +E SA ++ILVHNHPSG+P PS  DI
Sbjct: 132 LLLNAKNHILALKTISVGTLTSSVVHPREVFQAAIEQSAAAVILVHNHPSGDPAPSGEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     ++I V DH+I+G D F+S K   +I
Sbjct: 192 AVTRRMVEAGEIMDIPVLDHVIVGYDKFISLKEEGMI 228


>gi|255019864|ref|ZP_05291939.1| DNA repair protein RadC [Acidithiobacillus caldus ATCC 51756]
 gi|254970644|gb|EET28131.1| DNA repair protein RadC [Acidithiobacillus caldus ATCC 51756]
          Length = 224

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E   +GTID   VY+RE+ +R LEL+A ++I+ HNHPSG   PS AD 
Sbjct: 128 LFLDNRHRVLRFEELFQGTIDAASVYVREVAKRALELNAAALIVAHNHPSGVAEPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +TQ +   L  L+I + DH ++G+   VS + + 
Sbjct: 188 QLTQRLEQALELLDIRLLDHFVVGETQAVSLREVG 222


>gi|254454766|ref|ZP_05068203.1| DNA repair protein RadC [Octadecabacter antarcticus 238]
 gi|198269172|gb|EDY93442.1| DNA repair protein RadC [Octadecabacter antarcticus 238]
          Length = 265

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q  GT+DHVPVY RE+V+R LEL+A+S+ILVHNHPSG+P PS+ DI
Sbjct: 169 LFLDRKNVLIADEAQGNGTVDHVPVYPREVVKRALELNASSLILVHNHPSGDPTPSNEDI 228

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      LNI +HDH+IIG+   +SFK   +I
Sbjct: 229 AMTMQIHDAAKALNISLHDHLIIGRSRELSFKSQGLI 265


>gi|315174741|gb|EFU18758.1| DNA repair protein RadC [Enterococcus faecalis TX1346]
          Length = 232

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 133 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 193 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 228


>gi|320195796|gb|EFW70421.1| DNA repair protein RadC [Escherichia coli WV_060327]
          Length = 150

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+  E+  RGT++ V V+ RE+++R L+ +A ++ILVHNHPSG P P   DI
Sbjct: 54  ILLDNQNQLLHREILFRGTLNSVSVHPREVIKRVLKHNAAAVILVHNHPSGEPEPRRCDI 113

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  L++ + DH I+     VS     ++
Sbjct: 114 KLTKKLQELLEMLDVRLLDHFIVAGTETVSMAERGLM 150


>gi|253689260|ref|YP_003018450.1| DNA repair protein RadC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251755838|gb|ACT13914.1| DNA repair protein RadC [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 157

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI  EV + G I+   V+ REI++  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQHRLIEKEVIALGGINSTEVHPREILKASLRHNAAAVILAHNHPSGWAEPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +  +L+ L++ V DH+++G    VSF     +
Sbjct: 121 NITDRLKDSLSQLDVKVLDHLVVGSTEVVSFAERGWL 157


>gi|92116052|ref|YP_575781.1| DNA repair protein RadC [Nitrobacter hamburgensis X14]
 gi|91798946|gb|ABE61321.1| DNA repair protein RadC [Nitrobacter hamburgensis X14]
          Length = 254

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI DE+Q  GT+DH PVY RE+V+R LELSAT+II+VHNHPSG+P PS ADI
Sbjct: 158 LFLDKRNQLIVDELQQVGTVDHTPVYPREVVKRALELSATAIIMVHNHPSGDPTPSQADI 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++II    PL I VHDHII+GK+   S KGLR+I
Sbjct: 218 QMTKSIIDISKPLGISVHDHIIVGKNGHASLKGLRLI 254


>gi|251780848|ref|ZP_04823768.1| DNA repair protein RadC [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243085163|gb|EES51053.1| DNA repair protein RadC [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 229

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  NI+I  +   +G+++   V+ REI +  +  S+  II+ HNHPSG+P PS  DI
Sbjct: 133 IFLNTKNIVIGTKDVFKGSLNTSIVHPREIFKEAVNKSSAKIIICHNHPSGDPTPSKEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  I      + I + DHIIIGK+ F+S K    I
Sbjct: 193 NITLRIKECGEIMGIQLLDHIIIGKNGFISLKEKGFI 229


>gi|121582744|ref|YP_973186.1| DNA repair protein RadC [Polaromonas naphthalenivorans CJ2]
 gi|120596006|gb|ABM39444.1| DNA repair protein RadC [Polaromonas naphthalenivorans CJ2]
          Length = 168

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI      RGT+    VY RE+V+  L L+A ++I  HNHPSG   PS AD 
Sbjct: 72  LMLDAQNRLIEYVELFRGTVSQASVYPREVVKESLALNAAAVIFCHNHPSGVAEPSRADE 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + T L+ +++ V DH+I+  +  +SF    ++
Sbjct: 132 VLTQTLKTALSLVDVRVLDHLIVAGNEIMSFAERGLL 168


>gi|319943236|ref|ZP_08017519.1| DNA repair protein RadC [Lautropia mirabilis ATCC 51599]
 gi|319743778|gb|EFV96182.1| DNA repair protein RadC [Lautropia mirabilis ATCC 51599]
          Length = 278

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  + LI  ++  RGT++   VY RE+++  L+L+A ++IL HNHPSG+P PSDAD+
Sbjct: 182 LFLNSQHRLITADMMFRGTVNQTAVYPREVLKHALKLNAAAVILSHNHPSGHPEPSDADL 241

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  ++I V DHII+      SF    ++
Sbjct: 242 SLTRTLQAVLGQVDIRVLDHIIVAGSQQYSFAQHGLL 278


>gi|145630047|ref|ZP_01785829.1| DNA repair protein RadC [Haemophilus influenzae R3021]
 gi|144984328|gb|EDJ91751.1| DNA repair protein RadC [Haemophilus influenzae R3021]
          Length = 99

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 3  LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 62

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ I      + I V DH+I+GK    SF    ++
Sbjct: 63 LITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL 99


>gi|294495396|ref|YP_003541889.1| DNA replication and repair protein RadC [Methanohalophilus mahii
           DSM 5219]
 gi|292666395|gb|ADE36244.1| DNA replication and repair protein RadC [Methanohalophilus mahii
           DSM 5219]
          Length = 229

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++ +EV S G+++   V+ RE+ +  L  SA S+IL HNHPSG+P PS  DI
Sbjct: 132 LHLDTKNQVLREEVVSIGSLNANIVHPREVFKSALLESAASVILTHNHPSGDPTPSREDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ ++     L I V DH+IIG+  FVS K    I
Sbjct: 192 NITRKLVDGGKILGIDVLDHVIIGEGKFVSLKDEGYI 228


>gi|87120857|ref|ZP_01076749.1| DNA repair protein RadC [Marinomonas sp. MED121]
 gi|86163695|gb|EAQ64968.1| DNA repair protein RadC [Marinomonas sp. MED121]
          Length = 224

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 53/95 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + LI  +    GTID   VY RE+V+  L  +A + IL HNHPSG   PS ADI
Sbjct: 128 MFLDSQHRLIHFQEMFYGTIDAAAVYPREVVKMALSYNAAACILAHNHPSGVSEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +TQ +   L+ ++I + DH +IG    +S     
Sbjct: 188 YITQKLQQALSLVDINLLDHFVIGDGKPISLAERG 222


>gi|257420575|ref|ZP_05597565.1| DNA repair protein radC [Enterococcus faecalis X98]
 gi|257162399|gb|EEU92359.1| DNA repair protein radC [Enterococcus faecalis X98]
          Length = 232

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 133 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 193 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 228


>gi|256960307|ref|ZP_05564478.1| DNA repair protein RadC [Enterococcus faecalis Merz96]
 gi|257083375|ref|ZP_05577736.1| DNA repair protein RadC [Enterococcus faecalis Fly1]
 gi|256950803|gb|EEU67435.1| DNA repair protein RadC [Enterococcus faecalis Merz96]
 gi|256991405|gb|EEU78707.1| DNA repair protein RadC [Enterococcus faecalis Fly1]
          Length = 232

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 133 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 193 QFTKRMEECGEMMGIQLLDHIIVGDSGYISLREENF 228


>gi|157370015|ref|YP_001478004.1| DNA repair protein RadC [Serratia proteamaculans 568]
 gi|157321779|gb|ABV40876.1| DNA repair protein RadC [Serratia proteamaculans 568]
          Length = 160

 Score =  127 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+I+   V+ REIV+  L+ +A +++L H HPSG+ +PSDAD 
Sbjct: 64  LYLDNQHRLLTHETLFTGSINSTEVHPREIVKSALKHNAAAVLLAHCHPSGHADPSDADR 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ I   L  + + V DH I+G     SF    ++
Sbjct: 124 NITRRIQEALMLVEVRVLDHCIVGGMTVYSFAEHSLL 160


>gi|325571584|ref|ZP_08147084.1| DNA repair protein RadC [Enterococcus casseliflavus ATCC 12755]
 gi|325156060|gb|EGC68256.1| DNA repair protein RadC [Enterococcus casseliflavus ATCC 12755]
          Length = 230

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +    G+++    + REI    +  SA  +I+VHNHPSG+P  S+AD+
Sbjct: 129 IYLNTKNEIIQKKTIFIGSLNQSIAHPREIFHWAVRYSAARVIVVHNHPSGSPQASEADL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +I   + + I + DH+IIG +A+VS +   +
Sbjct: 189 LFTRRLIKCGDLMGIELLDHLIIGDNAYVSLREEGL 224


>gi|116333860|ref|YP_795387.1| DNA repair protein [Lactobacillus brevis ATCC 367]
 gi|116099207|gb|ABJ64356.1| DNA repair protein [Lactobacillus brevis ATCC 367]
          Length = 220

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 51/95 (53%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  + +I  +   +GT++  PV+ REI +  +   A ++I+ HNHPSG P PS +D   
Sbjct: 112 LDAQHRIIERQTVFQGTLNSCPVHPREIFRVAVMSGAATVIVAHNHPSGQPQPSTSDRAF 171

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            Q +      + I + D  ++G  ++ SFK   I+
Sbjct: 172 MQRLAACGQLMGIPLLDGFVVGLHSYFSFKEAGIL 206


>gi|16803589|ref|NP_465074.1| DNA repair protein RadC [Listeria monocytogenes EGD-e]
 gi|47096713|ref|ZP_00234298.1| DNA repair protein RadC [Listeria monocytogenes str. 1/2a F6854]
 gi|224499790|ref|ZP_03668139.1| DNA repair protein RadC [Listeria monocytogenes Finland 1988]
 gi|224501511|ref|ZP_03669818.1| DNA repair protein RadC [Listeria monocytogenes FSL R2-561]
 gi|254828216|ref|ZP_05232903.1| DNA repair protein RadC [Listeria monocytogenes FSL N3-165]
 gi|254831950|ref|ZP_05236605.1| DNA repair protein RadC [Listeria monocytogenes 10403S]
 gi|254898284|ref|ZP_05258208.1| DNA repair protein RadC [Listeria monocytogenes J0161]
 gi|254912223|ref|ZP_05262235.1| DNA repair protein RadC [Listeria monocytogenes J2818]
 gi|254936551|ref|ZP_05268248.1| DNA repair protein RadC [Listeria monocytogenes F6900]
 gi|255026815|ref|ZP_05298801.1| DNA repair protein RadC [Listeria monocytogenes FSL J2-003]
 gi|284801939|ref|YP_003413804.1| DNA repair protein RadC [Listeria monocytogenes 08-5578]
 gi|284995081|ref|YP_003416849.1| DNA repair protein RadC [Listeria monocytogenes 08-5923]
 gi|25009032|sp|Q8Y6Y2|Y1549_LISMO RecName: Full=UPF0758 protein lmo1549
 gi|16410978|emb|CAC99627.1| lmo1549 [Listeria monocytogenes EGD-e]
 gi|47014897|gb|EAL05845.1| DNA repair protein RadC [Listeria monocytogenes str. 1/2a F6854]
 gi|258600605|gb|EEW13930.1| DNA repair protein RadC [Listeria monocytogenes FSL N3-165]
 gi|258609145|gb|EEW21753.1| DNA repair protein RadC [Listeria monocytogenes F6900]
 gi|284057501|gb|ADB68442.1| DNA repair protein RadC [Listeria monocytogenes 08-5578]
 gi|284060548|gb|ADB71487.1| DNA repair protein RadC [Listeria monocytogenes 08-5923]
 gi|293590197|gb|EFF98531.1| DNA repair protein RadC [Listeria monocytogenes J2818]
          Length = 224

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 LFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|261856735|ref|YP_003264018.1| DNA repair protein RadC [Halothiobacillus neapolitanus c2]
 gi|261837204|gb|ACX96971.1| DNA repair protein RadC [Halothiobacillus neapolitanus c2]
          Length = 223

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ + ++A E    GTI+   V+ RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LFLDQRHRVLAFERLFYGTINQSAVHPREVVKAVLRHNAAAVILAHNHPSGVAEPSTADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   LN +++ + DH+I+G     S   L +I
Sbjct: 188 EITLRLRDALNLIDVRLLDHMIVGD-RCTSMAELGMI 223


>gi|238787658|ref|ZP_04631456.1| DNA repair protein RadC [Yersinia frederiksenii ATCC 33641]
 gi|238724445|gb|EEQ16087.1| DNA repair protein RadC [Yersinia frederiksenii ATCC 33641]
          Length = 159

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+A E    G+I+   V+ REIV+  L+ +A +++L H HPSG+  PS AD 
Sbjct: 63  LWLDNQHRLLAHETLFTGSINSTEVHPREIVKAALQHNAAAVLLAHCHPSGHAEPSVADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  + + + DH I+G     SF    ++
Sbjct: 123 QITGKIKDALALVEVRMLDHCIVGGMTVYSFAEHGLL 159


>gi|266623040|ref|ZP_06115975.1| DNA repair protein RadC [Clostridium hathewayi DSM 13479]
 gi|288865204|gb|EFC97502.1| DNA repair protein RadC [Clostridium hathewayi DSM 13479]
          Length = 231

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+   +L+ D + S+GT++   V  REI    L+  A ++I+VHNHPSG+P PS  DI
Sbjct: 135 MLLNTKGVLLKDVLVSQGTVNASVVSPREIFIEALKYHAVNLIVVHNHPSGDPAPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I+   + + I + DHIIIG +++ SFK   II
Sbjct: 195 TLTRRIMEAGDLIGIRMLDHIIIGDNSYTSFKERGII 231


>gi|217973526|ref|YP_002358277.1| DNA repair protein RadC [Shewanella baltica OS223]
 gi|217498661|gb|ACK46854.1| DNA repair protein RadC [Shewanella baltica OS223]
          Length = 160

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI+ E    GTID   VY RE+V+  L  +A ++I  HNHPSG P PS+AD 
Sbjct: 64  LLLDSQHRLISCEELFFGTIDAASVYPREVVKIVLHRNAAAVIFAHNHPSGMPEPSEADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + T L+ +++ V DH ++G    VSF     +
Sbjct: 124 RITERLKTALSTIDVSVLDHFVVGHQDVVSFAERGWL 160


>gi|110633807|ref|YP_674015.1| DNA repair protein RadC [Mesorhizobium sp. BNC1]
 gi|110284791|gb|ABG62850.1| DNA repair protein RadC [Chelativorans sp. BNC1]
          Length = 251

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 63/96 (65%), Positives = 73/96 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI DE Q  GT+DH PVY RE+V+R LELSA++IILVHNHPSG+P PS ADI
Sbjct: 155 LFLDKKNALIKDECQQTGTVDHTPVYPREVVKRALELSASAIILVHNHPSGDPTPSRADI 214

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I +T  PL I VHDHIIIGK    S KG+R+
Sbjct: 215 EMTKLIASTAEPLGITVHDHIIIGKKGHASMKGMRL 250


>gi|283852530|ref|ZP_06369798.1| DNA repair protein RadC [Desulfovibrio sp. FW1012B]
 gi|283572138|gb|EFC20130.1| DNA repair protein RadC [Desulfovibrio sp. FW1012B]
          Length = 228

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/94 (42%), Positives = 58/94 (61%)

Query: 4   DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMT 63
           D  N LI  E  S+GTID   VY RE++   L  +A+ +ILVHNHPSG+P PS  DI+ T
Sbjct: 135 DTKNRLIGWEQVSKGTIDQAAVYPREVLGVALRHNASGMILVHNHPSGDPRPSVQDIDFT 194

Query: 64  QNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + I T    +++ V DH+++  D F SF+   ++
Sbjct: 195 RRIRTAAREIDLRVLDHLVVTDDRFFSFQSEGML 228


>gi|217964304|ref|YP_002349982.1| RadC [Listeria monocytogenes HCC23]
 gi|254789655|sp|B8DHJ9|Y1020_LISMH RecName: Full=UPF0758 protein LMHCC_1020
 gi|217333574|gb|ACK39368.1| RadC [Listeria monocytogenes HCC23]
 gi|307571130|emb|CAR84309.1| DNA repair protein [Listeria monocytogenes L99]
          Length = 224

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 LFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPAPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|39995494|ref|NP_951445.1| DNA repair protein RadC [Geobacter sulfurreducens PCA]
 gi|54036228|sp|Q74G62|Y386_GEOSL RecName: Full=UPF0758 protein GSU0386
 gi|39982257|gb|AAR33718.1| DNA repair protein RadC [Geobacter sulfurreducens PCA]
 gi|298504494|gb|ADI83217.1| protein of unknown function DUF2466 [Geobacter sulfurreducens
           KN400]
          Length = 229

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++ +   S G+++   V+ RE+    +  SA ++ILVHNHP+G+P PS  D+
Sbjct: 133 LLLDGKNRIMREIQVSEGSLNQSIVHPREVFNPAVRESAAAVILVHNHPTGDPAPSREDL 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    + + I V DHIIIG   F SF    ++
Sbjct: 193 EITRRLREAGDIMGIRVLDHIIIGDGRFTSFVSAGLL 229


>gi|303245835|ref|ZP_07332117.1| DNA repair protein RadC [Desulfovibrio fructosovorans JJ]
 gi|302492618|gb|EFL52486.1| DNA repair protein RadC [Desulfovibrio fructosovorans JJ]
          Length = 228

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 57/94 (60%)

Query: 4   DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMT 63
           D  N LI  E  S+GT+D   VY RE++   L   A+ +ILVHNHPSG+P PS  D+  T
Sbjct: 135 DTKNRLIGWEQVSKGTVDQAAVYPREVLGVALRHKASGMILVHNHPSGDPRPSTEDVEFT 194

Query: 64  QNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + I +    +++ + DH+++ ++ F SF+   +I
Sbjct: 195 RRIKSAAREIDLRLLDHLVVTENRFFSFQAEGMI 228


>gi|37678993|ref|NP_933602.1| DNA repair protein [Vibrio vulnificus YJ016]
 gi|37197735|dbj|BAC93573.1| DNA repair protein [Vibrio vulnificus YJ016]
          Length = 165

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N  I  +    GTID   VY RE+V+  LE++A ++IL HNHPSG+  PS AD 
Sbjct: 70  LLLDNQNRPIEFKELFHGTIDAASVYPREVVKVVLEVNAAAVILAHNHPSGDATPSQADR 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ +++ V DH I+     VSF     +
Sbjct: 130 RITERLKDALSLVDVRVLDH-IVAGKDSVSFAERGWL 165


>gi|150396672|ref|YP_001327139.1| DNA repair protein RadC [Sinorhizobium medicae WSM419]
 gi|226736631|sp|A6U9H4|Y1459_SINMW RecName: Full=UPF0758 protein Smed_1459
 gi|150028187|gb|ABR60304.1| DNA repair protein RadC [Sinorhizobium medicae WSM419]
          Length = 260

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 65/96 (67%), Positives = 76/96 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ +GTIDH PVY RE+V+R LELSAT++ILVHNHPSG+P PS ADI
Sbjct: 164 LFLDKRNTLIADEVQQQGTIDHTPVYPREVVKRALELSATALILVHNHPSGDPTPSCADI 223

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            MT+ I     PL I +HDH+IIGKD  VS KGL++
Sbjct: 224 EMTKLIAEAAKPLGIALHDHVIIGKDGHVSLKGLQL 259


>gi|310817115|ref|YP_003965079.1| DNA repair protein RadC [Ketogulonicigenium vulgare Y25]
 gi|308755850|gb|ADO43779.1| DNA repair protein RadC [Ketogulonicigenium vulgare Y25]
          Length = 252

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ NILIADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS  DI
Sbjct: 156 LFLDRKNILIADEAQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSPQDI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   L  L + +HDH++IG+   +SF+   +I
Sbjct: 216 AITKQIDEGLRVLGLTLHDHLVIGRAREISFRAEGLI 252


>gi|291166595|gb|EFE28641.1| DNA repair protein RadC [Filifactor alocis ATCC 35896]
          Length = 227

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I D   S G+++   V+ RE+ +  L  S+  I L+HNHPSG+  PS  DI
Sbjct: 131 LFLDTKNKIICDRDISVGSLNASIVHPREVFKEALLYSSNKIFLIHNHPSGDTEPSREDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L + V DHIIIG   + S +    +
Sbjct: 191 LITERLKKAGELLGVEVLDHIIIGNGKYSSLRECGYL 227


>gi|188589437|ref|YP_001919945.1| DNA repair protein RadC [Clostridium botulinum E3 str. Alaska E43]
 gi|238689648|sp|B2V090|Y547_CLOBA RecName: Full=UPF0758 protein CLH_0547
 gi|188499718|gb|ACD52854.1| DNA repair protein RadC [Clostridium botulinum E3 str. Alaska E43]
          Length = 229

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  NI+I  +   +G+++   V+ REI +  +  S+T II+ HNHPSG+P PS  DI
Sbjct: 133 IFLNTKNIVIGTKDVFKGSLNTSIVHPREIFKEAVNKSSTKIIICHNHPSGDPTPSKEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  I      + I + DHIIIGK+ F+S K    I
Sbjct: 193 NITLRIKECGEIMGIQLLDHIIIGKNGFISLKEKGFI 229


>gi|296134038|ref|YP_003641285.1| DNA repair protein RadC [Thermincola sp. JR]
 gi|296032616|gb|ADG83384.1| DNA repair protein RadC [Thermincola potens JR]
          Length = 231

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N ++  E  S G ++   V+ REI +  ++ SA ++I+ HNHPSG+P+PS  DI
Sbjct: 135 IMLNTKNQVLNIETVSIGHLNASLVHPREIFKSAIKKSAAALIVAHNHPSGDPHPSKEDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH+I+G + F S K   +I
Sbjct: 195 LITKRLVEVGEIIGIEVLDHVILGDNNFTSLKQEGLI 231


>gi|121606228|ref|YP_983557.1| DNA repair protein RadC [Polaromonas naphthalenivorans CJ2]
 gi|171769297|sp|A1VSK8|Y3339_POLNA RecName: Full=UPF0758 protein Pnap_3339
 gi|120595197|gb|ABM38636.1| DNA replication and repair protein RadC [Polaromonas
           naphthalenivorans CJ2]
          Length = 224

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+V R L L+A S++L HNHPSG   PS AD 
Sbjct: 128 LFLDSQHRLIALEELFRGTLTQTSVYPREVVIRALALNAASVVLAHNHPSGAAQPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + T L  +++ V DH ++     VS   + ++
Sbjct: 188 MLTQTLKTALALVDVRVLDHFVVTASLAVSMAEMGLV 224


>gi|315282469|ref|ZP_07870876.1| putative DNA repair protein [Listeria marthii FSL S4-120]
 gi|313613887|gb|EFR87624.1| putative DNA repair protein [Listeria marthii FSL S4-120]
          Length = 224

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 LFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPAPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|85374339|ref|YP_458401.1| hypothetical protein ELI_07560 [Erythrobacter litoralis HTCC2594]
 gi|84787422|gb|ABC63604.1| hypothetical protein ELI_07560 [Erythrobacter litoralis HTCC2594]
          Length = 236

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LI D     G+ID   ++ RE+++R L++ AT++ILVHNHPSGNP PS AD+
Sbjct: 140 LYLNAQNRLIQDHHVGDGSIDEAAIHPREVIKRGLDIGATALILVHNHPSGNPEPSRADV 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      L I VHDH+I+G++  VS +   +I
Sbjct: 200 QITTRIAEAGRLLGITVHDHVIVGREGHVSLRAKGLI 236


>gi|167622369|ref|YP_001672663.1| DNA repair protein RadC [Shewanella halifaxensis HAW-EB4]
 gi|189029403|sp|B0TQL1|Y429_SHEHH RecName: Full=UPF0758 protein Shal_0429
 gi|167352391|gb|ABZ75004.1| DNA repair protein RadC [Shewanella halifaxensis HAW-EB4]
          Length = 225

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTI+   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTINSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSTADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKQALQTIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|221065434|ref|ZP_03541539.1| DNA repair protein RadC [Comamonas testosteroni KF-1]
 gi|220710457|gb|EED65825.1| DNA repair protein RadC [Comamonas testosteroni KF-1]
          Length = 230

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A ++IL HNHPSG+  PS AD 
Sbjct: 134 LFLDSQNRLLALEEMFRGTLTQTSVYPREVVLRALHHHAGAVILAHNHPSGSVQPSSADC 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHII+G  A  S     ++
Sbjct: 194 ALTATLKAALALIDVRVLDHIIVGPGAACSMAEEALL 230


>gi|107104421|ref|ZP_01368339.1| hypothetical protein PaerPA_01005498 [Pseudomonas aeruginosa PACS2]
 gi|116053466|ref|YP_793793.1| DNA repair protein RadC [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894422|ref|YP_002443292.1| DNA repair protein RadC [Pseudomonas aeruginosa LESB58]
 gi|254243795|ref|ZP_04937117.1| DNA repair protein RadC [Pseudomonas aeruginosa 2192]
 gi|296392178|ref|ZP_06881653.1| DNA repair protein RadC [Pseudomonas aeruginosa PAb1]
 gi|313106745|ref|ZP_07792962.1| DNA repair protein RadC [Pseudomonas aeruginosa 39016]
 gi|122256513|sp|Q02E43|Y7023_PSEAB RecName: Full=UPF0758 protein PA14_70230
 gi|226736626|sp|B7V5L0|Y5714_PSEA8 RecName: Full=UPF0758 protein PLES_57141
 gi|115588687|gb|ABJ14702.1| DNA repair protein RadC [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126197173|gb|EAZ61236.1| DNA repair protein RadC [Pseudomonas aeruginosa 2192]
 gi|218774651|emb|CAW30468.1| DNA repair protein RadC [Pseudomonas aeruginosa LESB58]
 gi|310879464|gb|EFQ38058.1| DNA repair protein RadC [Pseudomonas aeruginosa 39016]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  +G+ID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH IIG    +S      +
Sbjct: 188 QLTARLKEALALIDVRVLDHFIIGDGEPLSLAEYGWL 224


>gi|261820684|ref|YP_003258790.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
 gi|261604697|gb|ACX87183.1| DNA repair protein RadC [Pectobacterium wasabiae WPP163]
          Length = 157

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  + LI  E+ + G I+   V+ REI++  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLNNQHRLIEKEIIALGGINSTEVHPREILKASLRHNAAAVILAHNHPSGCAEPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +  +L+ L++ V DH+++G    VSF     +
Sbjct: 121 HITDRLKESLSQLDVRVLDHLVVGGAEVVSFAERGWL 157


>gi|290893950|ref|ZP_06556926.1| DNA repair protein RadC [Listeria monocytogenes FSL J2-071]
 gi|290556488|gb|EFD90026.1| DNA repair protein RadC [Listeria monocytogenes FSL J2-071]
 gi|313608630|gb|EFR84484.1| putative DNA repair protein [Listeria monocytogenes FSL F2-208]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 LFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPAPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|251788567|ref|YP_003003288.1| DNA repair protein RadC [Dickeya zeae Ech1591]
 gi|271498985|ref|YP_003332010.1| DNA repair protein RadC [Dickeya dadantii Ech586]
 gi|247537188|gb|ACT05809.1| DNA repair protein RadC [Dickeya zeae Ech1591]
 gi|270342540|gb|ACZ75305.1| DNA repair protein RadC [Dickeya dadantii Ech586]
          Length = 157

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E+ + G+I+HV + IREIV+  L  +A ++IL HNHPSG+  PS  D 
Sbjct: 61  LFLDNQHRLIDREIMALGSINHVDIPIREIVKAALRHNAAAVILAHNHPSGHAEPSTPDR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  ++I   DH++IG +  VSF     +
Sbjct: 121 ALTERLKSALELVDIRTLDHLVIGGNQVVSFAERGWL 157


>gi|320539538|ref|ZP_08039205.1| putative phage DNA repair protein [Serratia symbiotica str. Tucson]
 gi|320030391|gb|EFW12403.1| putative phage DNA repair protein [Serratia symbiotica str. Tucson]
          Length = 159

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+A E    G+I+   V+ REIV+  L+ +A +++L H HPSG+  PS AD 
Sbjct: 63  LWLDNQHRLLAHETLFTGSINSTEVHPREIVKAALKHNAAAVLLAHCHPSGHAEPSVADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  + + + DH I+G     SF    ++
Sbjct: 123 QITGKIKDALALVEVRMLDHCIVGGMTVYSFAEHGLL 159


>gi|88707202|ref|ZP_01104892.1| DNA repair protein RadC [Congregibacter litoralis KT71]
 gi|88698545|gb|EAQ95674.1| DNA repair protein RadC [Congregibacter litoralis KT71]
          Length = 170

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++      +GTID   VY R +VQ  L L+A +++L HNHPSG   PS AD 
Sbjct: 74  LFLDSQHRVLQYAELFQGTIDGAAVYPRVVVQEALGLNAAAVVLFHNHPSGVAEPSTADR 133

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +   L  +++ V DH+++      SF    ++
Sbjct: 134 NITKRLQDALALIDVRVLDHLVVSAGEATSFAERGLL 170


>gi|46907778|ref|YP_014167.1| DNA repair protein RadC [Listeria monocytogenes str. 4b F2365]
 gi|47093084|ref|ZP_00230861.1| DNA repair protein RadC [Listeria monocytogenes str. 4b H7858]
 gi|226224150|ref|YP_002758257.1| DNA repair protein RadC [Listeria monocytogenes Clip81459]
 gi|254824392|ref|ZP_05229393.1| DNA repair protein RadC [Listeria monocytogenes FSL J1-194]
 gi|254852174|ref|ZP_05241522.1| DNA repair protein RadC [Listeria monocytogenes FSL R2-503]
 gi|254992662|ref|ZP_05274852.1| DNA repair protein RadC [Listeria monocytogenes FSL J2-064]
 gi|255522562|ref|ZP_05389799.1| DNA repair protein RadC [Listeria monocytogenes FSL J1-175]
 gi|300764784|ref|ZP_07074774.1| DNA repair protein RadC [Listeria monocytogenes FSL N1-017]
 gi|54036226|sp|Q71ZC0|Y1569_LISMF RecName: Full=UPF0758 protein LMOf2365_1569
 gi|259551878|sp|C1KVJ6|Y1560_LISMC RecName: Full=UPF0758 protein Lm4b_01560
 gi|46881047|gb|AAT04344.1| DNA repair protein RadC [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018524|gb|EAL09280.1| DNA repair protein RadC [Listeria monocytogenes str. 4b H7858]
 gi|225876612|emb|CAS05321.1| Putative DNA repair protein RadC [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|258605477|gb|EEW18085.1| DNA repair protein RadC [Listeria monocytogenes FSL R2-503]
 gi|293593627|gb|EFG01388.1| DNA repair protein RadC [Listeria monocytogenes FSL J1-194]
 gi|300514460|gb|EFK41517.1| DNA repair protein RadC [Listeria monocytogenes FSL N1-017]
 gi|328465585|gb|EGF36814.1| hypothetical protein LM1816_06675 [Listeria monocytogenes 1816]
 gi|328474908|gb|EGF45708.1| hypothetical protein LM220_12012 [Listeria monocytogenes 220]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 LFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|51598155|ref|YP_072346.1| hypothetical protein YPTB3868 [Yersinia pseudotuberculosis IP
           32953]
 gi|186897377|ref|YP_001874489.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
 gi|51591437|emb|CAH23106.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|186700403|gb|ACC91032.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
          Length = 159

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+A E    G+I+   V+ REIV+  L+ +A +++L H HPSG+  PS AD 
Sbjct: 63  LWLDNQHRLLAHETLFTGSINSTEVHPREIVKAALQHNAAAVLLAHCHPSGHAEPSVADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  + + + DH I+G     SF    ++
Sbjct: 123 QITGKIKDALALVEVRMLDHCIVGGMTVYSFAEHGLL 159


>gi|288957329|ref|YP_003447670.1| DNA repair protein [Azospirillum sp. B510]
 gi|288909637|dbj|BAI71126.1| DNA repair protein [Azospirillum sp. B510]
          Length = 249

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/98 (60%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGTIDH PVY RE+V+R LELSA ++ILVHNHPSG+P PS ADI
Sbjct: 152 LFLDRRNTLIADEVQQRGTIDHTPVYPREVVKRALELSAAAVILVHNHPSGDPTPSRADI 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDA-FVSFKGLRII 97
            MT+ I+   N + +++HDH++IGK     SFK  R++
Sbjct: 212 EMTKEIVRAANAVGLVIHDHLVIGKGGRHTSFKAQRLL 249


>gi|56694982|ref|YP_165328.1| DNA repair protein RadC [Ruegeria pomeroyi DSS-3]
 gi|73913740|sp|Q5LWK3|Y054_SILPO RecName: Full=UPF0758 protein SPO0054
 gi|56676719|gb|AAV93385.1| DNA repair protein RadC [Ruegeria pomeroyi DSS-3]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/96 (54%), Positives = 73/96 (76%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ N+LIADE Q+RGT+DHVPVY RE+ +R LEL+A+++ILVHNHPSG+P PS +DI+
Sbjct: 129 YLDRKNVLIADEEQARGTVDHVPVYPREVAKRALELNASALILVHNHPSGDPTPSQSDID 188

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT  I +    L + +HDH+IIGK   +SF+    +
Sbjct: 189 MTARIRSACEALGLTLHDHLIIGKSVELSFRAEGYL 224


>gi|118580692|ref|YP_901942.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
 gi|118503402|gb|ABK99884.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
          Length = 166

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   +  S G+++   V+ RE+ +  L  SA +IIL+HNHPSG+P PS  DI
Sbjct: 71  IHLDGKNRICCVDEVSVGSLNQSVVHPREVFKTALLSSAAAIILMHNHPSGDPAPSREDI 130

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + + V DHIIIG + F SF    ++
Sbjct: 131 EITKRLKEAGELIGVKVLDHIIIGDN-FHSFASQGLL 166


>gi|254237987|ref|ZP_04931310.1| DNA repair protein RadC [Pseudomonas aeruginosa C3719]
 gi|126169918|gb|EAZ55429.1| DNA repair protein RadC [Pseudomonas aeruginosa C3719]
          Length = 224

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A EV  +G+ID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDTRHRVLAFEVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH IIG    +S      +
Sbjct: 188 QLTARLKEALALIDVRVLDHFIIGDGEPLSLAEYGWL 224


>gi|226324950|ref|ZP_03800468.1| hypothetical protein COPCOM_02742 [Coprococcus comes ATCC 27758]
 gi|225206298|gb|EEG88652.1| hypothetical protein COPCOM_02742 [Coprococcus comes ATCC 27758]
          Length = 236

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   SRGT++   +  RE+    L+ +A  IIL+HNHPSG+P PS  DI
Sbjct: 137 LMLNTRSRLIGESEISRGTVNMSVISPRELFIEALQKNAVYIILLHNHPSGDPMPSREDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I    + L I + DHIIIG + +VS    +++
Sbjct: 197 LVTQRIREGGSLLGIELLDHIIIGDNCYVSLAEQKLL 233


>gi|85713454|ref|ZP_01044444.1| DNA repair protein RadC [Nitrobacter sp. Nb-311A]
 gi|85699358|gb|EAQ37225.1| DNA repair protein RadC [Nitrobacter sp. Nb-311A]
          Length = 236

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 78/97 (80%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+II+VHNHPSG+P PS ADI
Sbjct: 140 LFLDKRNQLIADEVQQVGTVDHTPVYPREVVKRALELSATAIIMVHNHPSGDPTPSQADI 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++II   +PL I VHDHII+GK+   S KGLR+I
Sbjct: 200 QMTRSIIDISSPLGISVHDHIIVGKNGHASLKGLRLI 236


>gi|312113065|ref|YP_004010661.1| DNA repair protein RadC [Rhodomicrobium vannielii ATCC 17100]
 gi|311218194|gb|ADP69562.1| DNA repair protein RadC [Rhodomicrobium vannielii ATCC 17100]
          Length = 253

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/95 (61%), Positives = 72/95 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQSRGTIDH  VY RE+V+R LELSA+++IL HNHPSG+P PS ADI
Sbjct: 157 LFLDRRNKLIADEVQSRGTIDHTSVYTREVVKRALELSASAVILAHNHPSGDPTPSRADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            MT+ I    + L + VHDHII+G+D  +S K + 
Sbjct: 217 EMTKEIAEVGSKLGVTVHDHIILGRDGHLSLKSVG 251


>gi|260459829|ref|ZP_05808083.1| DNA repair protein RadC [Mesorhizobium opportunistum WSM2075]
 gi|259034631|gb|EEW35888.1| DNA repair protein RadC [Mesorhizobium opportunistum WSM2075]
          Length = 253

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 66/97 (68%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI DEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 157 LFLDKKNTLIVDEVQQTGTVDHTPVYPREVVKRALELSATAIILVHNHPSGDPTPSRADI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIG+    S KGL +I
Sbjct: 217 EMTKQIIDTAKPLGIAVHDHIIIGRKGHASMKGLLLI 253


>gi|290474866|ref|YP_003467746.1| putative CP4-57 prophage; DNA repair protein [Xenorhabdus bovienii
           SS-2004]
 gi|289174179|emb|CBJ80966.1| putative CP4-57 prophage; DNA repair protein [Xenorhabdus bovienii
           SS-2004]
          Length = 156

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    GT+ H  V+ RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQHRLLERETLFTGTLSHTEVHPREVVKAALRHNAAAVILAHNHPSGEMEPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +++ L  + + V DH+++G D  +SF     +
Sbjct: 121 HITKRVVSALALVEVRVLDHLVVGDD-VMSFAERGWL 156


>gi|77918415|ref|YP_356230.1| DNA repair protein, RadC-like [Pelobacter carbinolicus DSM 2380]
 gi|77544498|gb|ABA88060.1| DNA repair protein, RadC-like protein [Pelobacter carbinolicus DSM
           2380]
          Length = 166

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N L+  +  S G++    V+ RE+ +  L  SA  ++LVHNHPSG   PS  D 
Sbjct: 71  LHLDNKNRLLCLDRVSVGSLSASIVHPREVFKSALLSSAAGLVLVHNHPSGQTEPSHEDE 130

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L I V DHII+G   F SF    ++
Sbjct: 131 EVTTRLVKAGEMLGIHVLDHIILGDG-FFSFAEQGLL 166


>gi|238761834|ref|ZP_04622808.1| DNA repair protein RadC [Yersinia kristensenii ATCC 33638]
 gi|238699948|gb|EEP92691.1| DNA repair protein RadC [Yersinia kristensenii ATCC 33638]
          Length = 161

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+A E    GTI+   V+ RE+V+  ++ +A S +L HNHPS    PS AD 
Sbjct: 63  LWLDNQNRLLAQETLFTGTINSTTVHPRELVKSAMKHNAASAVLAHNHPSQLAEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  L  +++ V DH+++G    VSF     +
Sbjct: 123 QITDRLVNALGLVDVRVLDHLVVGGLDIVSFAERGWL 159


>gi|75674533|ref|YP_316954.1| DNA repair protein RadC [Nitrobacter winogradskyi Nb-255]
 gi|74419403|gb|ABA03602.1| DNA repair protein RadC [Nitrobacter winogradskyi Nb-255]
          Length = 236

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 78/97 (80%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GTIDH PVY RE+V+R LELSAT+II+VHNHPSG+P PS ADI
Sbjct: 140 LFLDKRNQLIADEVQQVGTIDHTPVYPREVVKRALELSATAIIMVHNHPSGDPTPSQADI 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+   +PL I VHDHII+GK+   S KGLR++
Sbjct: 200 QMTKSIVDISSPLGISVHDHIIVGKNGHSSLKGLRLM 236


>gi|113971925|ref|YP_735718.1| DNA repair protein RadC [Shewanella sp. MR-4]
 gi|123324586|sp|Q0HE56|Y3597_SHESM RecName: Full=UPF0758 protein Shewmr4_3597
 gi|113886609|gb|ABI40661.1| DNA repair protein RadC [Shewanella sp. MR-4]
          Length = 225

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|229087017|ref|ZP_04219171.1| DNA repair protein radC [Bacillus cereus Rock3-44]
 gi|228696280|gb|EEL49111.1| DNA repair protein radC [Bacillus cereus Rock3-44]
          Length = 225

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 129 LYLNTKNQVMHRQTVFIGSLNASIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I + DHIIIG   FVS K    I
Sbjct: 189 EVTKRLVNCGRIIGIEILDHIIIGDHKFVSLKEKGHI 225


>gi|304414796|ref|ZP_07395755.1| DNA repair protein RadC [Candidatus Regiella insecticola LSR1]
 gi|304283148|gb|EFL91561.1| DNA repair protein RadC [Candidatus Regiella insecticola LSR1]
          Length = 181

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD    +I+ +    G+I  V ++ REIV+  L+++A ++IL HNHPSG   PS+AD 
Sbjct: 85  LFLDNQYRVISHDELFIGSISSVEIHPREIVREALKVNAAALILSHNHPSGQAEPSEADN 144

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  II     L+I + DH++IG   +VSF     I
Sbjct: 145 LITVRIIKACALLDIRLLDHLVIGHGEYVSFAERGWI 181


>gi|251788764|ref|YP_003003485.1| DNA repair protein RadC [Dickeya zeae Ech1591]
 gi|247537385|gb|ACT06006.1| DNA repair protein RadC [Dickeya zeae Ech1591]
          Length = 169

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   + LI       GT+    VY REIV+  L  +A ++IL HNHPSGN  PS AD+
Sbjct: 73  LFLTTRHRLIEYAELFYGTLATTAVYPREIVRNALSCNAAAVILAHNHPSGNTEPSQADL 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DHII+G +  +SF    ++
Sbjct: 133 MLTRRVSAALALVDVRVLDHIIVGGNDTLSFAERALL 169


>gi|284008822|emb|CBA75590.1| DNA repair protein [Arsenophonus nasoniae]
          Length = 222

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  E   +GTI+ V V+ REI+++ ++++A SIIL HNHPSGNP PS AD 
Sbjct: 126 LFLNNQNQIICYEEMFKGTINRVEVHPREILRQAVKVNAVSIILAHNHPSGNPEPSLADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      ++I + DH +I     +SF  L ++
Sbjct: 186 VVTERIANACRLIDIKLLDHFVITHKKCLSFVELDLL 222


>gi|24375732|ref|NP_719775.1| DNA repair protein RadC [Shewanella oneidensis MR-1]
 gi|38372485|sp|Q8E9M2|Y4248_SHEON RecName: Full=UPF0758 protein SO_4248
 gi|24350669|gb|AAN57219.1|AE015857_12 DNA repair protein RadC [Shewanella oneidensis MR-1]
          Length = 225

 Score =  127 bits (320), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|114564978|ref|YP_752492.1| DNA repair protein RadC [Shewanella frigidimarina NCIMB 400]
 gi|122298392|sp|Q07WG1|Y3828_SHEFN RecName: Full=UPF0758 protein Sfri_3828
 gi|114336271|gb|ABI73653.1| DNA repair protein RadC [Shewanella frigidimarina NCIMB 400]
          Length = 225

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDTQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERIKNALATIDVSLLDHMVVGDQEIVSFAERGWI 224


>gi|49475599|ref|YP_033640.1| DNA repair protein radC [Bartonella henselae str. Houston-1]
 gi|49238406|emb|CAF27633.1| DNA repair protein radC [Bartonella henselae str. Houston-1]
          Length = 264

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L+ADEVQ  GTIDH PVY RE++ R L+LSA+ +ILVHNHPSG+  PS AD+
Sbjct: 168 LFLDKKNGLLADEVQQTGTIDHTPVYPREVISRALQLSASGLILVHNHPSGDATPSKADV 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +    N L I VHDH+II ++ + SFK L+ I
Sbjct: 228 TMTYRLKDAANALGITVHDHLIIARNNYTSFKELKFI 264


>gi|238793077|ref|ZP_04636706.1| DNA repair protein RadC [Yersinia intermedia ATCC 29909]
 gi|238727677|gb|EEQ19202.1| DNA repair protein RadC [Yersinia intermedia ATCC 29909]
          Length = 161

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+A E    GTI+   V+ RE+V+  ++ +A S +L HNHPS    PS AD 
Sbjct: 63  LWLDNQNRLLAQETLFTGTINSTTVHPRELVKSAMKHNAASAVLAHNHPSQLAEPSQADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  L  +++ V DH+++G    VSF     +
Sbjct: 123 QITDRLVNALGLVDVRVLDHLVVGGLDIVSFAERGWL 159


>gi|206578396|ref|YP_002240722.1| DNA repair protein, RadC family [Klebsiella pneumoniae 342]
 gi|206567454|gb|ACI09230.1| DNA repair protein, RadC family [Klebsiella pneumoniae 342]
          Length = 161

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  + L+  E    G+I+HV V+ RE+V+  L  +A +++L HNHPSG+P PS  D 
Sbjct: 65  LYLNNQHCLLESETLFAGSINHVQVHPREVVKSALRFNAAAVVLAHNHPSGDPEPSQCDR 124

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   L  +++   DH++IG +  VSF     I
Sbjct: 125 NITGRLKEALALVDVNTLDHLVIGSEGIVSFAERGWI 161


>gi|241767328|ref|ZP_04765050.1| DNA repair protein RadC [Acidovorax delafieldii 2AN]
 gi|241361963|gb|EER58149.1| DNA repair protein RadC [Acidovorax delafieldii 2AN]
          Length = 237

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L+A E   RGT+    VY RE+V R L   A +++L HNHPSG+  PS AD 
Sbjct: 141 LFLDSQNRLLAMEELFRGTLTQTSVYPREVVLRALHHQAAAVVLAHNHPSGSVAPSRADE 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + TTL  +++ V DH+I+     +S     ++
Sbjct: 201 ALTHTLKTTLALVDVRVLDHVIVAPGQALSMAEKGLV 237


>gi|192288820|ref|YP_001989425.1| DNA repair protein RadC [Rhodopseudomonas palustris TIE-1]
 gi|192282569|gb|ACE98949.1| DNA repair protein RadC [Rhodopseudomonas palustris TIE-1]
          Length = 239

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY REIV+R LELSAT++I+VHNHPSG+P PS ADI
Sbjct: 143 LFLDKRNQLIADELQQVGTVDHTPVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADI 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+    PL I VHDHII+GK+   S KGLR+I
Sbjct: 203 QMTKSIVAIAEPLGIAVHDHIIVGKNGHASLKGLRLI 239


>gi|304391571|ref|ZP_07373513.1| putative DNA repair protein RadC-like protein [Ahrensia sp. R2A130]
 gi|303295800|gb|EFL90158.1| putative DNA repair protein RadC-like protein [Ahrensia sp. R2A130]
          Length = 259

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 54/96 (56%), Positives = 70/96 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+K N L+ DE    GT+DH P Y REIV+R LE+ AT++ILVHNHPSG+P PS ADI
Sbjct: 163 LYLNKQNGLMDDEEMQEGTVDHTPAYPREIVRRALEVGATAVILVHNHPSGDPTPSRADI 222

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ I T+   +NI VHDHIIIG+D   S K L++
Sbjct: 223 ELTRQINTSCQTMNIAVHDHIIIGRDTHTSMKALQL 258


>gi|295110011|emb|CBL23964.1| DNA replication and repair protein RadC [Ruminococcus obeum A2-162]
          Length = 236

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+ D + S+GT++   +  REI    L   A ++IL+HNHP GNP+PS  D 
Sbjct: 135 MMLDNQNHLLGDTLLSKGTVNATLITPREIFLEALRYHAVNLILIHNHPGGNPSPSVCDK 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L I + DHIIIG   +VSF+   ++
Sbjct: 195 EITERISQAGEMLGICLLDHIIIGDQRYVSFREQGLL 231


>gi|206561051|ref|YP_002231816.1| DNA repair protein RadC [Burkholderia cenocepacia J2315]
 gi|198037093|emb|CAR53014.1| putative DNA repair protein [Burkholderia cenocepacia J2315]
          Length = 209

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N LI  E  +RG++  + VY REIV+R ++ +A ++I+ HNHPSG   PS  D 
Sbjct: 113 VYLDARNRLIDMEEIARGSLTRMAVYPREIVRRAMKHNAAALIVAHNHPSGAVQPSAEDR 172

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G     SF     +
Sbjct: 173 RLTRVLKDALELVDVRLLDHVVVGVSDTFSFARAGWL 209


>gi|150390056|ref|YP_001320105.1| DNA repair protein RadC [Alkaliphilus metalliredigens QYMF]
 gi|172052477|sp|A6TQH8|Y2289_ALKMQ RecName: Full=UPF0758 protein Amet_2289
 gi|149949918|gb|ABR48446.1| DNA repair protein RadC [Alkaliphilus metalliredigens QYMF]
          Length = 232

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 60/96 (62%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  + +IA E  S G+++   V+ RE+    ++ S+++IILVHNHPSG+P+PS  DI 
Sbjct: 137 LLNTKHEVIAIENISIGSLNASIVHPREVFVVAIKRSSSAIILVHNHPSGDPSPSGEDIR 196

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ ++     L I V DHIIIG + + S K   ++
Sbjct: 197 ITKRLVEAGKLLGIEVLDHIIIGDNVYYSLKEKSMM 232


>gi|292486886|ref|YP_003529756.1| DNA repair protein radC [Erwinia amylovora CFBP1430]
 gi|292900719|ref|YP_003540088.1| RadC-like protein [Erwinia amylovora ATCC 49946]
 gi|291200567|emb|CBJ47696.1| putative RadC-like protein [Erwinia amylovora ATCC 49946]
 gi|291552303|emb|CBA19340.1| DNA repair protein radC homolog [Erwinia amylovora CFBP1430]
          Length = 156

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E    GT+    V+ RE+V+  L+ +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLGCETLFTGTLSQTEVHPREVVKLALKHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+  L  + + V DH+++G +  VSF    ++
Sbjct: 121 HITQRIVKALALVEVRVLDHLVVG-NEVVSFAEQGLL 156


>gi|49081838|gb|AAT50319.1| PA5319 [synthetic construct]
          Length = 225

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +++ EV  +G+ID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDTRHRVLSFEVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH IIG    +S      +
Sbjct: 188 QLTARLKEALALIDVRVLDHFIIGDGEPLSLAEYGWL 224


>gi|315582770|gb|EFU94961.1| DNA repair protein RadC [Enterococcus faecalis TX0309A]
          Length = 240

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIILGDSGYISLREENF 236


>gi|316931615|ref|YP_004106597.1| DNA repair protein RadC [Rhodopseudomonas palustris DX-1]
 gi|315599329|gb|ADU41864.1| DNA repair protein RadC [Rhodopseudomonas palustris DX-1]
          Length = 237

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY REIV+R LELSAT++I+VHNHPSG+P PS ADI
Sbjct: 141 LFLDKRNQLIADELQQVGTVDHTPVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+    PL I VHDHII+GK+   S KGL++I
Sbjct: 201 QMTKSIVAIAEPLGIAVHDHIIVGKNGHASLKGLKLI 237


>gi|255527526|ref|ZP_05394394.1| DNA repair protein RadC [Clostridium carboxidivorans P7]
 gi|255508796|gb|EET85168.1| DNA repair protein RadC [Clostridium carboxidivorans P7]
          Length = 228

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N+++  +  S G+++   V+ RE+    +  ++  II+ HNHPSG+P PS+ DI
Sbjct: 132 IMLNTKNVVLFIKDVSVGSLNSSIVHPREVFCDAIRKNSAFIIVCHNHPSGDPQPSNEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      L I + DH+IIG   ++S K   I+
Sbjct: 192 NVTNRLKECGKLLGIELLDHLIIGNGRYISLKEKGIL 228


>gi|157963648|ref|YP_001503682.1| DNA repair protein RadC [Shewanella pealeana ATCC 700345]
 gi|189029404|sp|A8H9B0|Y3837_SHEPA RecName: Full=UPF0758 protein Spea_3837
 gi|157848648|gb|ABV89147.1| DNA repair protein RadC [Shewanella pealeana ATCC 700345]
          Length = 225

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTI+   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTINSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSTADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKQALQTIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|281178374|dbj|BAI54704.1| putative phage DNA repair protein [Escherichia coli SE15]
          Length = 156

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+  E+  RGT++ V V+ RE+++R L+ +A ++ILVHNHPSG P PS  DI
Sbjct: 60  ILLDNQNQLLHREILFRGTLNSVSVHPREVIKRVLKHNAAAVILVHNHPSGEPEPSRCDI 119

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  L++ + DH I+     VS     ++
Sbjct: 120 QLTKKLQELLEILDVRLLDHFIVAGTETVSMAERGLV 156


>gi|15615594|ref|NP_243898.1| DNA repair protein RadC [Bacillus halodurans C-125]
 gi|13431811|sp|Q9K8H4|Y3032_BACHD RecName: Full=UPF0758 protein BH3032
 gi|10175654|dbj|BAB06751.1| DNA repair protein [Bacillus halodurans C-125]
          Length = 232

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +  L  SA S+I +HNHPSG+P PS  DI
Sbjct: 133 LYLNTKNQVLHKQTVFIGSLNASIVHPREVFKEALRRSAASLICLHNHPSGDPTPSREDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DH+IIG   FVS K    +
Sbjct: 193 EVTHRLAQVGKLIGIELLDHVIIGDRTFVSLKEKGHL 229


>gi|167621854|ref|YP_001676639.1| DNA repair protein RadC [Caulobacter sp. K31]
 gi|167351595|gb|ABZ74325.1| DNA repair protein RadC [Caulobacter sp. K31]
          Length = 223

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 66/97 (68%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N L++ E    G++DH PVY RE+++R LEL+ +++IL HNHPSG+P PS  DI
Sbjct: 127 LFLDRRNQLLSAERLGVGSVDHAPVYPREVMRRALELNCSAMILAHNHPSGDPQPSQPDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +I     L I +HDH+I+   A VSF+   +I
Sbjct: 187 EMTKTLIEAGKALQIQIHDHMIVAGGAVVSFRANGLI 223


>gi|156740065|ref|YP_001430194.1| DNA repair protein RadC [Roseiflexus castenholzii DSM 13941]
 gi|189029400|sp|A7NFF4|Y037_ROSCS RecName: Full=UPF0758 protein Rcas_0037
 gi|156231393|gb|ABU56176.1| DNA repair protein RadC [Roseiflexus castenholzii DSM 13941]
          Length = 233

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 56/96 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   +    G+++   V I E+ +  + L++ SII+VHNHPSG+P PS  DI
Sbjct: 133 ICLDTKNRVQKIQTVYVGSLNASMVRIGEVFKEAIRLNSASIIVVHNHPSGDPTPSPEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +I     L+I V DH++IG   FVS +   +
Sbjct: 193 VVTRQMIEAGRLLDIDVLDHLVIGNGRFVSMRERGL 228


>gi|322420385|ref|YP_004199608.1| DNA repair protein RadC [Geobacter sp. M18]
 gi|320126772|gb|ADW14332.1| DNA repair protein RadC [Geobacter sp. M18]
          Length = 167

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  ++ S G++    V+ RE  +  L  SA ++IL+HNHP G+P+PS  D 
Sbjct: 72  LHLDNRNRVVCIDMVSTGSLTSSIVHPRETFKTALLSSAAAMILIHNHPGGDPSPSAEDR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DHII+G   + SF    +I
Sbjct: 132 EVTRRLREAGELLGIRILDHIIVGDF-YFSFAEGGLI 167


>gi|148550394|ref|YP_001270496.1| DNA repair protein RadC [Pseudomonas putida F1]
 gi|148514452|gb|ABQ81312.1| DNA repair protein RadC [Pseudomonas putida F1]
          Length = 235

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   VY RE+V+R L  +A ++IL HNHPSG   PS  D+
Sbjct: 137 LFLDTKHRPLAFEILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDV 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T ++   L  +++ V DHIIIG    +S      I
Sbjct: 197 HLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWI 233


>gi|313206016|ref|YP_004045193.1| DNA repair protein radc [Riemerella anatipestifer DSM 15868]
 gi|312445332|gb|ADQ81687.1| DNA repair protein RadC [Riemerella anatipestifer DSM 15868]
 gi|315022329|gb|EFT35357.1| DNA repair protein RadC [Riemerella anatipestifer RA-YM]
 gi|325336543|gb|ADZ12817.1| DNA repair protein [Riemerella anatipestifer RA-GD]
          Length = 225

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL++ N ++  +  S+G I    V +R + +  LE  AT+II+VHNHPSGN +PS+ D+
Sbjct: 129 IFLNQSNKVLQKKPLSKGGISGTVVDVRLMFKMALEHYATAIIVVHNHPSGNASPSEQDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L+I + DHIII K+ + SF    ++
Sbjct: 189 EITKKIKEAGVLLDIRLLDHIIIAKNKYFSFADEGVL 225


>gi|297583749|ref|YP_003699529.1| DNA repair protein RadC [Bacillus selenitireducens MLS10]
 gi|297142206|gb|ADH98963.1| DNA repair protein RadC [Bacillus selenitireducens MLS10]
          Length = 228

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   N +I  +    G+++   V+ REI +  L  SA S+I +HNHPSG+  PS  DI
Sbjct: 132 LFLSTKNQVIHRQTIFIGSLNMSVVHPREIFKAALRYSAASMICIHNHPSGDTAPSQEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ ++     + I V DH+I+G  +F S K    +
Sbjct: 192 DVTKRLVEVGKTIGIDVLDHVIVGDHSFCSLKEKGYV 228


>gi|88797504|ref|ZP_01113093.1| DNA repair protein RadC [Reinekea sp. MED297]
 gi|88779676|gb|EAR10862.1| DNA repair protein RadC [Reinekea sp. MED297]
          Length = 224

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L   + ++A E   +GTID   VY RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 IWLSAQHQVLAFETLFQGTIDTAAVYPREVVKAALRHNAAAVILAHNHPSGIAEPSQADQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++ + DH+++G+   VSF    ++
Sbjct: 188 MITKRLASALMTVDVRLLDHMVVGQGIVVSFAERGLL 224


>gi|309776893|ref|ZP_07671863.1| DNA repair protein RadC [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915304|gb|EFP61074.1| DNA repair protein RadC [Erysipelotrichaceae bacterium 3_1_53]
          Length = 229

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL++ N LIA  V   GT+ +  V+ REI +  ++L    I+ VHNHPSG+P PS ADI
Sbjct: 128 LFLNQKNQLIASRVMFVGTLTNASVHPREIFKEAMQLGCAKILCVHNHPSGDPQPSSADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T++I        I + DHII+ ++ + SF    ++
Sbjct: 188 SLTKSIEECGVMTAIPLIDHIIVSRNTYFSFAQKGML 224


>gi|239996967|ref|ZP_04717491.1| DNA repair protein RadC [Alteromonas macleodii ATCC 27126]
          Length = 225

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LIA      GTI+   VY RE++++ +  +A +IILVHNHPSG   PS ADI
Sbjct: 128 LMLDSQHQLIAFRTMFNGTINSAAVYPRELIKQVMIDNAAAIILVHNHPSGVAEPSHADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I + +  +++ V DH ++G    VSF    ++
Sbjct: 188 RLTAEIKSAMASIDVPVLDHFVVGDKETVSFAQRGLL 224


>gi|114326624|ref|YP_743782.1| DNA repair protein RadC [Nitrosomonas eutropha C91]
 gi|114309563|gb|ABI60804.1| DNA repair protein RadC [Nitrosomonas eutropha C91]
          Length = 173

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+    LIA     +GT+    VY RE+V+  +  +A ++IL H HPS    PS AD 
Sbjct: 77  IFLNSQYRLIAYREMFQGTLTCASVYPREVVKAAISYNAAAVILAHCHPSKETEPSQADK 136

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ +++ V DHII+G +   S   + ++
Sbjct: 137 AITKRLKEALDLIDVCVLDHIIVGGNTTKSMAEMGLV 173


>gi|39933462|ref|NP_945738.1| DNA repair protein RadC [Rhodopseudomonas palustris CGA009]
 gi|39647308|emb|CAE25829.1| possible DNA repair protein RadC [Rhodopseudomonas palustris
           CGA009]
          Length = 241

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 64/97 (65%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GT+DH PVY REIV+R LELSAT++I+VHNHPSG+P PS ADI
Sbjct: 145 LFLDKRNQLIADELQQVGTVDHTPVYPREIVKRGLELSATAVIMVHNHPSGDPTPSQADI 204

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++I+    PL I VHDHII+GK+   S KGLR+I
Sbjct: 205 QMTKSIVAIAEPLGIAVHDHIIVGKNGHASLKGLRLI 241


>gi|172058125|ref|YP_001814585.1| DNA repair protein RadC [Exiguobacterium sibiricum 255-15]
 gi|171990646|gb|ACB61568.1| DNA repair protein RadC [Exiguobacterium sibiricum 255-15]
          Length = 217

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I+ +    G ++   V+ R+I +  +  SA S I VHNHPSG+P PS  DI
Sbjct: 121 LYLNTKNEVISKKTLFIGGLNTSIVHPRDIFREAIRCSAASFIAVHNHPSGDPTPSREDI 180

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +++ ++     + I   DH++IG   F+S K    +
Sbjct: 181 EVSERMVEAGRLIGISCIDHLVIGHGQFISMKQRGFM 217


>gi|291550398|emb|CBL26660.1| DNA replication and repair protein RadC [Ruminococcus torques
           L2-14]
          Length = 240

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI++   S GTI+   V  RE+    L+ +A SIIL+HNHPSG+P PS  D+
Sbjct: 137 LLLNTRSRLISEMDVSTGTINSTLVSPRELFVEALQKNAVSIILLHNHPSGDPTPSKEDL 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ I      + I + DHIIIG + + S +    
Sbjct: 197 LTTRRIREAGALIGIELLDHIIIGDNCYFSLREKGF 232


>gi|114045869|ref|YP_736419.1| DNA repair protein RadC [Shewanella sp. MR-7]
 gi|117922202|ref|YP_871394.1| DNA repair protein RadC [Shewanella sp. ANA-3]
 gi|123030985|sp|Q0HZU3|Y359_SHESR RecName: Full=UPF0758 protein Shewmr7_0359
 gi|166218796|sp|A0L1R9|Y3770_SHESA RecName: Full=UPF0758 protein Shewana3_3770
 gi|113887311|gb|ABI41362.1| DNA repair protein RadC [Shewanella sp. MR-7]
 gi|117614534|gb|ABK49988.1| DNA repair protein RadC [Shewanella sp. ANA-3]
          Length = 225

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|319795329|ref|YP_004156969.1| DNA repair protein radc [Variovorax paradoxus EPS]
 gi|315597792|gb|ADU38858.1| DNA repair protein RadC [Variovorax paradoxus EPS]
          Length = 225

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E   RGT+    VY REIV R L   A +++L HNHPSG+  PS AD 
Sbjct: 129 LFLDAQHRLIVLEELFRGTLTQASVYPREIVMRALHHQAAAVVLAHNHPSGSIEPSRADE 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +   L+ +++ V DH+I+      S     ++
Sbjct: 189 SLTQTLRAALSLVDVRVIDHVIVSPGQSFSMAEKGVL 225


>gi|119470592|ref|ZP_01613295.1| associated with replication fork DNA repair protein
           [Alteromonadales bacterium TW-7]
 gi|119446293|gb|EAW27570.1| associated with replication fork DNA repair protein
           [Alteromonadales bacterium TW-7]
          Length = 224

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+ DE+   GTI+   VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LYLDSQNRLVKDEILFYGTINAASVYPREVVKAALKNNAAAVIFAHNHPSGIAEPSQADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I V DHII+G +  VSF    +I
Sbjct: 188 LITNKLQQALQLVDINVLDHIIVGGETCVSFAERGLI 224


>gi|84684609|ref|ZP_01012510.1| DNA repair protein RadC [Maritimibacter alkaliphilus HTCC2654]
 gi|84667588|gb|EAQ14057.1| DNA repair protein RadC [Rhodobacterales bacterium HTCC2654]
          Length = 257

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N LIADE  + GT+ HVPVY REIV+R LELSA+++ILVHNHPSG+P+PS  DI
Sbjct: 160 LYLDRKNTLIADEAAAEGTVGHVPVYPREIVKRALELSASALILVHNHPSGDPSPSRDDI 219

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ + +    L I +HDHIIIGK   VS++    +
Sbjct: 220 DMTERVRSAAAALEITLHDHIIIGKSREVSYRSDGYL 256


>gi|312143465|ref|YP_003994911.1| DNA repair protein RadC [Halanaerobium sp. 'sapolanicus']
 gi|311904116|gb|ADQ14557.1| DNA repair protein RadC [Halanaerobium sp. 'sapolanicus']
          Length = 231

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +IA    S+G +    V+ RE+ +  +  S+ ++ILVHNHPSG+P PS  D+
Sbjct: 135 ILLDVKNRVIAIPEISKGGLSSSIVHPREVFKEAIRRSSAAVILVHNHPSGDPKPSADDL 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +      + I V DHIII  D F+SFK   +I
Sbjct: 195 NITKKLQKAGEIIGIKVIDHIIIAGDKFLSFKEENLI 231


>gi|288986959|ref|YP_003456922.1| DNA repair protein RadC [Allochromatium vinosum DSM 180]
 gi|288898338|gb|ADC64172.1| DNA repair protein RadC [Allochromatium vinosum DSM 180]
          Length = 167

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++  +   RGTID   V+ RE+V+  +E  A ++I  HNHPSG+ +PS AD 
Sbjct: 71  LLLDNRHRVLRYQELFRGTIDTAYVHPREVVRLVIESGAAAVIFAHNHPSGSSDPSQADR 130

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  + + V DHII+G+   +SF     +
Sbjct: 131 TLTRKLQDALALIEVRVLDHIIVGEGRGMSFAEQGWL 167


>gi|296283428|ref|ZP_06861426.1| hypothetical protein CbatJ_07394 [Citromicrobium bathyomarinum
           JL354]
          Length = 236

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+ D     G+ID   ++ RE+++R L+L A ++ILVHNHPSGNP PS ADI
Sbjct: 140 LYLDTKNRLVQDHHVGDGSIDEASIHPREVIRRGLDLGAAALILVHNHPSGNPEPSRADI 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      L I VHDH+IIG+  +VS K   +I
Sbjct: 200 AVTLRIAEAGRLLGIAVHDHVIIGQGRYVSLKAKGLI 236


>gi|188581415|ref|YP_001924860.1| DNA repair protein RadC [Methylobacterium populi BJ001]
 gi|179344913|gb|ACB80325.1| DNA repair protein RadC [Methylobacterium populi BJ001]
          Length = 246

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGT+DH PVY RE+ +R LEL+AT+IIL HNHPSG+P PS ADI
Sbjct: 150 LFLDRRNHLIADEVQGRGTVDHTPVYPREVARRALELAATAIILAHNHPSGDPTPSGADI 209

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I++ L+PL I+VHDH+I+G+D   S KGL++I
Sbjct: 210 RMTREIVSVLDPLGIVVHDHVILGRDGHASLKGLKLI 246


>gi|15600512|ref|NP_254006.1| DNA repair protein RadC [Pseudomonas aeruginosa PAO1]
 gi|13431808|sp|Q9HTN5|Y5319_PSEAE RecName: Full=UPF0758 protein PA5319
 gi|9951636|gb|AAG08704.1|AE004944_8 DNA repair protein RadC [Pseudomonas aeruginosa PAO1]
          Length = 224

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +++ EV  +G+ID   VY R++V+R L  +A ++IL HNHPSG+  PS AD 
Sbjct: 128 LFLDTRHRVLSFEVLFQGSIDGASVYPRQVVKRTLAHNAAALILTHNHPSGDARPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH IIG    +S      +
Sbjct: 188 QLTARLKEALALIDVRVLDHFIIGDGEPLSLAEYGWL 224


>gi|46202447|ref|ZP_00053202.2| COG2003: DNA repair proteins [Magnetospirillum magnetotacticum
           MS-1]
          Length = 128

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ  GT+DH P+Y RE+V+R L L A++I++VHNHPSG+P PS AD+
Sbjct: 32  LFLDRKNTLIADEVQQTGTVDHTPLYPREVVKRALALHASAIVMVHNHPSGDPKPSRADM 91

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ +   L  + I +HDH+++G+    SFK + ++
Sbjct: 92  EMTRAVKDALAAVGIALHDHVVVGRKGHSSFKAMGLL 128


>gi|163745060|ref|ZP_02152420.1| DNA repair protein RadC [Oceanibulbus indolifex HEL-45]
 gi|161381878|gb|EDQ06287.1| DNA repair protein RadC [Oceanibulbus indolifex HEL-45]
          Length = 237

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 76/97 (78%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ NILIADE Q++GT+DHVPVY RE+ +R LEL+A++IILVHNHPSG+P+PS +DI
Sbjct: 141 LYLDRKNILIADEEQAKGTVDHVPVYPREVAKRALELNASAIILVHNHPSGDPSPSRSDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  + T  + L + +HDH+IIGK   +SF+    +
Sbjct: 201 DMTHQVATACDALGLTLHDHLIIGKSRELSFRNEGHL 237


>gi|326202567|ref|ZP_08192435.1| DNA repair protein RadC [Clostridium papyrosolvens DSM 2782]
 gi|325987151|gb|EGD47979.1| DNA repair protein RadC [Clostridium papyrosolvens DSM 2782]
          Length = 229

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N ++     S G+++   V+ RE+    ++    SII VHNHPSG+P PS+ D+
Sbjct: 133 ILLDTKNKVLKIVSISTGSLNASIVHPREVFSEAVKCGCNSIIFVHNHPSGDPTPSNEDV 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  ++   + L I V DHII+G   +VS K    I
Sbjct: 193 RTTDRLVNAGDILGIKVLDHIILGDGRYVSLKEKGFI 229


>gi|330952116|gb|EGH52376.1| hypothetical protein PSYCIT7_12239 [Pseudomonas syringae Cit 7]
          Length = 224

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RG I+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGRINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+I+G    +S     ++
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSMVERGLM 224


>gi|227554373|ref|ZP_03984420.1| DNA repair protein RadC [Enterococcus faecalis HH22]
 gi|227176492|gb|EEI57464.1| DNA repair protein RadC [Enterococcus faecalis HH22]
          Length = 198

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 99  IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 158

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 159 QFTKRMEECGEMMGIQLLDHIILGDSGYISLREENF 194


>gi|78067302|ref|YP_370071.1| DNA repair protein RadC [Burkholderia sp. 383]
 gi|123567821|sp|Q39DN9|Y5833_BURS3 RecName: Full=UPF0758 protein Bcep18194_A5833
 gi|77968047|gb|ABB09427.1| DNA replication and repair protein RadC [Burkholderia sp. 383]
          Length = 257

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + LI  E  +RG++  + VY REIV+R +  +A ++I+ HNHPSG   PS  D 
Sbjct: 161 VYLDARHRLIDMEEITRGSLTRMAVYPREIVRRAMVHNAAALIVAHNHPSGAVQPSAEDR 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH++IG     SF     +
Sbjct: 221 RLTRVLHDALALVDVRLLDHVVIGISDTFSFARAGWL 257


>gi|238764329|ref|ZP_04625280.1| DNA repair protein radC [Yersinia kristensenii ATCC 33638]
 gi|238697480|gb|EEP90246.1| DNA repair protein radC [Yersinia kristensenii ATCC 33638]
          Length = 95

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 56/95 (58%)

Query: 3  LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
          +D  + +I  E    GTI  V V+ REIV+  L+++A ++IL HNHPSG   PS AD  M
Sbjct: 1  MDNQHRVIRHEEMFTGTIGSVEVHPREIVREALKVNAAALILAHNHPSGKAEPSQADRLM 60

Query: 63 TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
          T  +I   + L+I V DH+++G+   VSF     +
Sbjct: 61 TTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL 95


>gi|29377390|ref|NP_816544.1| DNA repair protein RadC [Enterococcus faecalis V583]
 gi|54036236|sp|Q82ZX1|Y2926_ENTFA RecName: Full=UPF0758 protein EF_2926
 gi|29344857|gb|AAO82614.1| DNA repair protein RadC [Enterococcus faecalis V583]
          Length = 232

 Score =  126 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 133 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSARILLAHNHPSGNPTPSPQDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 193 QFTKRMEECGEMMGIQLLDHIILGDSGYISLREENF 228


>gi|290477301|ref|YP_003470222.1| putative associated with replication fork, DNA repair protein
           [Xenorhabdus bovienii SS-2004]
 gi|289176655|emb|CBJ83464.1| putative associated with replication fork, DNA repair protein
           [Xenorhabdus bovienii SS-2004]
          Length = 230

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   N +I  +   +GTI+ V V+ REIV++ ++++A SIIL HNHPSGNP PS AD 
Sbjct: 134 LFLTNQNKVICHDEMFKGTINKVEVHPREIVKQAVKVNAASIILAHNHPSGNPEPSLADK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II     + + V DHI+IGK   VSF     I
Sbjct: 194 LVTEKIIDACELVGVKVLDHIVIGKQHCVSFVERGWI 230


>gi|115522133|ref|YP_779044.1| DNA repair protein RadC [Rhodopseudomonas palustris BisA53]
 gi|115516080|gb|ABJ04064.1| DNA repair protein RadC [Rhodopseudomonas palustris BisA53]
          Length = 238

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 63/97 (64%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+Q  GTIDH PVY REIV+R LELSA++I++VHNHPSG+P PS +DI
Sbjct: 142 LFLDKRNQLIADELQQVGTIDHTPVYPREIVKRALELSASAIVMVHNHPSGDPTPSQSDI 201

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II   +PL I VHDHII+GK+   S KGL++I
Sbjct: 202 QMTKQIIAIADPLGIAVHDHIIVGKNGHASLKGLKLI 238


>gi|197301738|ref|ZP_03166808.1| hypothetical protein RUMLAC_00464 [Ruminococcus lactaris ATCC
           29176]
 gi|197299178|gb|EDY33708.1| hypothetical protein RUMLAC_00464 [Ruminococcus lactaris ATCC
           29176]
          Length = 238

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    LI     S GT++   V  RE+    L+ +A SIIL+HNHPSG+P PS  DI
Sbjct: 137 LLLNTKAKLIGASDISVGTVNATLVSPRELFLEALKKNAVSIILLHNHPSGDPTPSQEDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ +    + + I + DHIIIG + ++S +    
Sbjct: 197 LLTQRVRKAGDLIGIELLDHIIIGDNRYISLREKGF 232


>gi|325263906|ref|ZP_08130639.1| DNA repair protein RadC [Clostridium sp. D5]
 gi|324030944|gb|EGB92226.1| DNA repair protein RadC [Clostridium sp. D5]
          Length = 231

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    LI +   S+GT++   +  RE+    L+ +A SI+L+HNHPSG+P PS  DI
Sbjct: 135 LLLNTKTRLIGETDISKGTVNSAVISPRELFVEALQKNAVSIVLLHNHPSGDPAPSKDDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I + DHI+IG + ++S +   +I
Sbjct: 195 LVTRRIKDAGALIGIELLDHIVIGNNCYISMREKGLI 231


>gi|260877938|ref|ZP_05890293.1| DNA repair protein [Vibrio parahaemolyticus AN-5034]
 gi|308089871|gb|EFO39566.1| DNA repair protein [Vibrio parahaemolyticus AN-5034]
          Length = 157

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I  +   +GTID   VY RE+V+  LE++A ++IL HNHPSG+P+PS AD 
Sbjct: 62  LLLDNQHRVIEFKSLFKGTIDSASVYPREVVKSVLEVNAAAVILAHNHPSGDPSPSQADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  +++ V DHI++G+ + VSF     +
Sbjct: 122 RITRKLIDALALVDVRVLDHIVVGESS-VSFAEKGWL 157


>gi|300690691|ref|YP_003751686.1| DNA repair protein radC homolog, associated with replication fork
           [Ralstonia solanacearum PSI07]
 gi|299077751|emb|CBJ50389.1| DNA repair protein radC homolog, associated with replication fork
           [Ralstonia solanacearum PSI07]
          Length = 224

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GT+    VY REI +R L  +A+++IL HNHP+G+  PS++D+
Sbjct: 128 LFLDVRHRLIAWEELFQGTLTEARVYPREIAKRALYHNASAVILSHNHPTGHVEPSESDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +   L  L++ + DH+I+G+    SF    
Sbjct: 188 MLTRELCRALALLDVRILDHMIVGRTQVYSFLEHG 222


>gi|188990452|ref|YP_001902462.1| DNA repair protein radC homolog [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732212|emb|CAP50404.1| DNA repair protein radC homolog [Xanthomonas campestris pv.
           campestris]
          Length = 159

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 56/96 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E    GTID   V+ R + +R LELSA ++IL HNHPSGNP PS+AD 
Sbjct: 63  LFLDTQHQVLTTEHLFTGTIDGCDVHPRVVARRALELSAAAVILFHNHPSGNPEPSEADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +   L  L+I + DH++IG     S      
Sbjct: 123 KVTERLKQALGLLDIRLLDHLVIGGRQHTSLAARGW 158


>gi|120609194|ref|YP_968872.1| DNA repair protein RadC [Acidovorax citrulli AAC00-1]
 gi|120587658|gb|ABM31098.1| DNA repair protein RadC [Acidovorax citrulli AAC00-1]
          Length = 167

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N  IA E   RGTI+   VY R IV+R ++L+A+S+ILVHNHPSG    SDAD 
Sbjct: 71  VFLDCQNRAIAFEALFRGTINQAVVYPRVIVKRAMDLNASSVILVHNHPSGTSQCSDADR 130

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I  +L  +++ V DH+I+G     SF    ++
Sbjct: 131 GLTERICASLGLIDVRVVDHVIVGSGTPYSFAEAGLL 167


>gi|126724639|ref|ZP_01740482.1| DNA repair protein RadC [Rhodobacterales bacterium HTCC2150]
 gi|126705803|gb|EBA04893.1| DNA repair protein RadC [Rhodobacterales bacterium HTCC2150]
          Length = 253

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LI DE   RGT+DHVPVY RE+ +R LE+SA+++ILVHNHPSG+P PS  DI
Sbjct: 157 LFLDRKNVLITDEALGRGTVDHVPVYPREVAKRGLEVSASAVILVHNHPSGDPTPSGPDI 216

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MTQ I   L  L I +HDH+IIGK   +SF+   +I
Sbjct: 217 QMTQEIDNALTTLGIKLHDHLIIGKFGEISFRAEGLI 253


>gi|254419921|ref|ZP_05033645.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
 gi|196186098|gb|EDX81074.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
          Length = 228

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/97 (51%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+L+ DE  + GT+DH PVY RE+V+R LELSA+++ILVHNHPSG+P PS ADI
Sbjct: 132 LYLDRRNLLLKDEWVADGTVDHAPVYPREVVRRALELSASAMILVHNHPSGDPAPSRADI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++       + VHDH+++G++   SFK L +I
Sbjct: 192 EMTRRVVDAARVFGLDVHDHLVVGREGTASFKSLGLI 228


>gi|127514409|ref|YP_001095606.1| DNA repair protein RadC [Shewanella loihica PV-4]
 gi|126639704|gb|ABO25347.1| DNA repair protein RadC [Shewanella loihica PV-4]
          Length = 233

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 136 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGGAEPSHADR 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 196 RITERLKYALATIDVSLLDHMVVGDREIVSFAERGWI 232


>gi|224476750|ref|YP_002634356.1| putative DNA repair protein RadC [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|254789659|sp|B9DNE3|Y1264_STACT RecName: Full=UPF0758 protein Sca_1264
 gi|222421357|emb|CAL28171.1| putative DNA repair protein RadC [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 226

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N++I  EV   GT++   V+ RE+ +  ++ S+ +II+VHNHPSG+  PS  DI
Sbjct: 128 LFLNSKNVVIRHEVIFVGTLNSSIVHPREVFKAAIKWSSNAIIVVHNHPSGDVTPSKEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      L I + DHIIIG   ++S      
Sbjct: 188 LTTKRLQECGRVLGIELLDHIIIGDAKYLSMVEGGY 223


>gi|124004623|ref|ZP_01689467.1| DNA repair protein RadC [Microscilla marina ATCC 23134]
 gi|123989746|gb|EAY29275.1| DNA repair protein RadC [Microscilla marina ATCC 23134]
          Length = 266

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+K N++I  E  S G +       + I ++ +E  A+SII+VHNHPSGN  PS ADI
Sbjct: 170 VMLNKSNVVIKKEQISSGGVSGTIADPKVIFKKAIEALASSIIVVHNHPSGNLQPSQADI 229

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L+I V DH+I     + SF    ++
Sbjct: 230 GLTRKLAEAGKMLDIPVLDHMIFTDYNYYSFADEGMM 266


>gi|172048651|sp|A5WB02|Y5194_PSEP1 RecName: Full=UPF0758 protein Pput_5194
          Length = 226

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   VY RE+V+R L  +A ++IL HNHPSG   PS  D+
Sbjct: 128 LFLDTKHRPLAFEILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDV 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T ++   L  +++ V DHIIIG    +S      I
Sbjct: 188 HLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWI 224


>gi|332139456|ref|YP_004425194.1| DNA repair protein RadC [Alteromonas macleodii str. 'Deep ecotype']
 gi|238693291|sp|B4S2B7|Y049_ALTMD RecName: Full=UPF0758 protein MADE_00049
 gi|327549478|gb|AEA96196.1| DNA repair protein RadC [Alteromonas macleodii str. 'Deep ecotype']
          Length = 225

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LIA      GTI+   VY RE++++ +  +A +IILVHNHPSG   PS ADI
Sbjct: 128 LMLDSQHQLIAFRTMFNGTINSAAVYPRELIKQVMIDNAAAIILVHNHPSGVAEPSHADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I + +  +++ V DH ++G    +SF    ++
Sbjct: 188 RLTTEIKSAMASIDVPVLDHFVVGDKETISFAQRGLL 224


>gi|228967535|ref|ZP_04128562.1| DNA repair protein radC [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228792190|gb|EEM39765.1| DNA repair protein radC [Bacillus thuringiensis serovar sotto str.
           T04001]
          Length = 102

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++  +    G+++   V+ RE+ +     +A SII +HNHPSG+P PS  DI
Sbjct: 6   LYLNTKNQVLHRQTIFIGSLNTSIVHPREVFKEAFRRAAASIICLHNHPSGDPTPSREDI 65

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DHIIIG   FVS K    I
Sbjct: 66  EVTKRLVECGQIIGIEVLDHIIIGDHKFVSLKEKGHI 102


>gi|154504386|ref|ZP_02041124.1| hypothetical protein RUMGNA_01890 [Ruminococcus gnavus ATCC 29149]
 gi|153795315|gb|EDN77735.1| hypothetical protein RUMGNA_01890 [Ruminococcus gnavus ATCC 29149]
          Length = 231

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   S+GT++   +  RE+    L+ +A SI+L+HNHPSG+P PS  D+
Sbjct: 134 LLLNTKSRLIGETDISKGTVNSAVISPRELFVEALQKNAVSIVLLHNHPSGDPTPSKEDV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + + + DHI+IG + +VS +   ++
Sbjct: 194 LITRRIQEAGRLIGVELLDHIVIGDNCYVSLREKGLV 230


>gi|319898913|ref|YP_004159006.1| DNA repair protein RadC [Bartonella clarridgeiae 73]
 gi|319402877|emb|CBI76428.1| DNA repair protein RadC [Bartonella clarridgeiae 73]
          Length = 261

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI+DEVQ  GTIDH PVY RE++ R LELSA+ +IL+HNHPSGN +PS ADI
Sbjct: 165 LFLDKRNGLISDEVQQTGTIDHTPVYPREVISRALELSASGLILIHNHPSGNASPSKADI 224

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L I +HDHIII ++ + SFK L++I
Sbjct: 225 SMTYRLKDAANALEITIHDHIIIARNNYTSFKELKLI 261


>gi|103486559|ref|YP_616120.1| DNA repair protein RadC [Sphingopyxis alaskensis RB2256]
 gi|98976636|gb|ABF52787.1| DNA repair protein RadC [Sphingopyxis alaskensis RB2256]
          Length = 272

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 68/97 (70%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N+LI DE+ S G+ID   +Y+RE+++R LEL A++II+VHNHPSG+P PS  DI
Sbjct: 176 LYLNSRNMLIRDELASEGSIDQSAIYVREVIRRALELGASAIIIVHNHPSGSPEPSRQDI 235

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L I++HDHII+    + SF+ L ++
Sbjct: 236 AVTREIAEAGTRLGIVLHDHIIVAGSDYRSFRALGLL 272


>gi|256850919|ref|ZP_05556308.1| DNA repair protein RadC [Lactobacillus jensenii 27-2-CHN]
 gi|260661133|ref|ZP_05862047.1| DNA repair protein RadC [Lactobacillus jensenii 115-3-CHN]
 gi|282934169|ref|ZP_06339447.1| DNA repair protein RadC [Lactobacillus jensenii 208-1]
 gi|297205797|ref|ZP_06923192.1| DNA repair protein RadC [Lactobacillus jensenii JV-V16]
 gi|256615981|gb|EEU21169.1| DNA repair protein RadC [Lactobacillus jensenii 27-2-CHN]
 gi|260548070|gb|EEX24046.1| DNA repair protein RadC [Lactobacillus jensenii 115-3-CHN]
 gi|281301783|gb|EFA94049.1| DNA repair protein RadC [Lactobacillus jensenii 208-1]
 gi|297148923|gb|EFH29221.1| DNA repair protein RadC [Lactobacillus jensenii JV-V16]
          Length = 207

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N ++ + +  +GT++   V+ R+I +  +  ++  I++ HNHPSG+ NPS  DI
Sbjct: 111 IYLDNKNKVLGERLLFQGTVNRSVVHPRDIFRWAVFYNSVGILIAHNHPSGDANPSQKDI 170

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I    + + I   DHII+   +++SFK  ++I
Sbjct: 171 EFTKQINKASDLMGINFLDHIIVADRSYLSFKEEQLI 207


>gi|81428462|ref|YP_395462.1| DNA repair protein (RadC) [Lactobacillus sakei subsp. sakei 23K]
 gi|123564345|sp|Q38XC8|Y852_LACSS RecName: Full=UPF0758 protein LCA_0852
 gi|78610104|emb|CAI55153.1| DNA repair protein (RadC) [Lactobacillus sakei subsp. sakei 23K]
          Length = 224

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    GT++    + RE+ +  ++ SA   ILVHNHPSG   PS  DI
Sbjct: 126 VYLDVKNQIIQIKQLYLGTLNSSVAHPREVFKWAVQYSAAKFILVHNHPSGQLAPSTQDI 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ I+     + I   DH+IIG   ++S +    +
Sbjct: 186 NFTKRIVNCGQLMGITCLDHLIIGSSQYLSLREEGYL 222


>gi|20807378|ref|NP_622549.1| DNA repair proteins [Thermoanaerobacter tengcongensis MB4]
 gi|25009024|sp|Q8RBC5|Y897_THETN RecName: Full=UPF0758 protein TTE0897
 gi|20515897|gb|AAM24153.1| DNA repair proteins [Thermoanaerobacter tengcongensis MB4]
          Length = 233

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E SA+SIILVHNHPSG+P PS  D+
Sbjct: 134 VMLNVKNKIIAIETISIGSLNTSIVHPREVFKAAIERSASSIILVHNHPSGDPTPSREDV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N L I V DH+IIG    +S K    
Sbjct: 194 EVTKRLVEAGNILGIKVLDHVIIGDGRGISLKEKGY 229


>gi|189423347|ref|YP_001950524.1| DNA repair protein RadC [Geobacter lovleyi SZ]
 gi|189419606|gb|ACD94004.1| DNA repair protein RadC [Geobacter lovleyi SZ]
          Length = 163

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  +  S G+++   V+ RE+ +     +A +++LVHNHP+G+P PS  DI
Sbjct: 67  LHLDGKNRIVCFDRVSIGSLNQAIVHSREVFKTACLSNAAAVLLVHNHPTGDPTPSQEDI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  +   L I V DHII+G D F+SF    ++
Sbjct: 127 AITRRLKESGEILGIKVLDHIIVGDDEFLSFVERGLL 163


>gi|56475876|ref|YP_157465.1| DNA repair protein, radC [Aromatoleum aromaticum EbN1]
 gi|81677578|sp|Q5P7Z7|Y442_AZOSE RecName: Full=UPF0758 protein AZOSEA04420
 gi|56311919|emb|CAI06564.1| DNA repair protein, radC [Aromatoleum aromaticum EbN1]
          Length = 225

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 1/98 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI      RGT+    VY RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDARNRLIEAVELFRGTLTQTSVYPREVVKLALARNAAAVILAHNHPSGAAEPSPADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKD-AFVSFKGLRII 97
            +T+++   L  ++I V DH I+      +SF    ++
Sbjct: 188 LLTRSLKQALELVDIRVLDHFIVTAHAQPLSFAERGLL 225


>gi|332036123|gb|EGI72599.1| DNA repair protein RadC [Pseudoalteromonas haloplanktis ANT/505]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+ DE+   GTI+   VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LYLDSQNRLVKDEILFYGTINSASVYPREVVKAALKNNAAAVIFAHNHPSGIAEPSQADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I V DHII+G +  VSF    +I
Sbjct: 188 LITNKLQQALQLVDISVLDHIIVGGETCVSFAERGLI 224


>gi|225567950|ref|ZP_03776975.1| hypothetical protein CLOHYLEM_04023 [Clostridium hylemonae DSM
           15053]
 gi|225163238|gb|EEG75857.1| hypothetical protein CLOHYLEM_04023 [Clostridium hylemonae DSM
           15053]
          Length = 230

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   S+GT++   +  RE+    L+ +A +II++HNHPSG+P+PS  D 
Sbjct: 134 LMLNSKSKLIGETDISKGTVNASLITPRELFIEALQKNAVAIIVLHNHPSGDPSPSREDR 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I      + I + DH+IIG + ++SF+   I+
Sbjct: 194 LLTQRIREAGALIGIDLLDHVIIGNNCYMSFREEGIL 230


>gi|26991960|ref|NP_747385.1| DNA repair protein RadC [Pseudomonas putida KT2440]
 gi|37999603|sp|Q88C97|Y5284_PSEPK RecName: Full=UPF0758 protein PP_5284
 gi|24987089|gb|AAN70849.1|AE016729_7 DNA repair protein RadC [Pseudomonas putida KT2440]
          Length = 226

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   VY RE+V+R L  +A ++IL HNHPSG   PS  D+
Sbjct: 128 LFLDTKHRPLAFEILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDV 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T ++   L  +++ V DHIIIG    +S      I
Sbjct: 188 HLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWI 224


>gi|289434829|ref|YP_003464701.1| DNA repair protein RadC [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171073|emb|CBH27615.1| DNA repair protein RadC [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  SA S++  HNHPSG+P+PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASLMCFHNHPSGDPSPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLVEAGNIIGITLLDHIIIGKNKYISLKEKGY 223


>gi|85712366|ref|ZP_01043416.1| DNA repair protein RadC [Idiomarina baltica OS145]
 gi|85693809|gb|EAQ31757.1| DNA repair protein RadC [Idiomarina baltica OS145]
          Length = 157

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + +D  + LI  +    GTI+  PVY RE+++  L+ +A +IIL HNHPSG   PS+AD 
Sbjct: 62  MLMDSQHRLIEYKELFFGTINAAPVYPREVMKEVLQQNAAAIILAHNHPSGVTEPSEADK 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   LN +++ V DHI++G+D  VSF    ++
Sbjct: 122 RVTTRIKDALNHIDVPVLDHIVVGQDT-VSFAERGLV 157


>gi|319405664|emb|CBI79287.1| DNA repair protein RadC [Bartonella sp. AR 15-3]
          Length = 264

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI+DEVQ  GTIDH PVY RE++ R L+LSA+ +IL+HNHPSGN +PS ADI
Sbjct: 168 LFLDKRNGLISDEVQQTGTIDHTPVYPREVISRALQLSASGLILIHNHPSGNASPSKADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L I +HDHIII ++ + SFK L++I
Sbjct: 228 SMTHRLKDAANALEITIHDHIIIARNNYTSFKELKLI 264


>gi|315303311|ref|ZP_07873944.1| putative DNA repair protein [Listeria ivanovii FSL F6-596]
 gi|313628326|gb|EFR96826.1| putative DNA repair protein [Listeria ivanovii FSL F6-596]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 56/96 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  SA SI+  HNHPSG+P PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASIMCFHNHPSGDPTPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   + + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLVEAGSIIGITLLDHIIIGKNKYISLKEKGY 223


>gi|258516472|ref|YP_003192694.1| DNA repair protein RadC [Desulfotomaculum acetoxidans DSM 771]
 gi|257780177|gb|ACV64071.1| DNA repair protein RadC [Desulfotomaculum acetoxidans DSM 771]
          Length = 233

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +++ E  S GT+    V+ RE+ +  ++ SA ++IL+HNHPSG+P PS  DI
Sbjct: 137 MLLNTKNRVLSLETISVGTLSSSAVHPRELFKIAIKKSAAALILIHNHPSGDPAPSKEDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ +      + I V DHIIIG + FVS K   +
Sbjct: 197 DVTKRLEEAGKIIGIDVLDHIIIGDNKFVSLKVKGL 232


>gi|299065959|emb|CBJ37140.1| DNA repair protein radC homolog, associated with replication fork
           [Ralstonia solanacearum CMR15]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GT+    VY REI +R L  +A+++IL HNHP+G+  PS++D+
Sbjct: 128 LFLDVRHRLIAWEELFQGTLTEARVYPREIAKRALHHNASALILSHNHPTGHVEPSESDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +   L  L++ V DH+I+G+    SF    
Sbjct: 188 MLTRELCRALALLDVRVLDHMIVGRAEVYSFLEHG 222


>gi|319408552|emb|CBI82205.1| DNA repair protein RadC [Bartonella schoenbuchensis R1]
          Length = 264

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/97 (60%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L++DEVQ  GTIDH PVY RE+V R LELSA+ +ILVHNHPSG+  PSDADI
Sbjct: 168 LFLDKKNGLLSDEVQQTGTIDHTPVYPREVVSRALELSASGLILVHNHPSGDATPSDADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L II+HDH+II ++ + SFK L++I
Sbjct: 228 SMTYRLKDIANALGIILHDHLIIARNDYTSFKALKLI 264


>gi|116872978|ref|YP_849759.1| DNA repair protein RadC [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461096|sp|A0AIZ8|Y1562_LISW6 RecName: Full=UPF0758 protein lwe1562
 gi|116741856|emb|CAK20980.1| DNA repair protein RadC homolog [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 56/96 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  S+ +I+  HNHPSG+P PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSSAAIMCFHNHPSGDPTPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLVEAGNIIGITLLDHIIIGKNKYISLKEKGY 223


>gi|313623636|gb|EFR93796.1| putative DNA repair protein [Listeria innocua FSL J1-023]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  S+ SI+  HNHPSG+P PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSSASIMCFHNHPSGDPTPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|170719373|ref|YP_001747061.1| DNA repair protein RadC [Pseudomonas putida W619]
 gi|229485561|sp|B1J4M1|Y186_PSEPW RecName: Full=UPF0758 protein PputW619_0186
 gi|169757376|gb|ACA70692.1| DNA repair protein RadC [Pseudomonas putida W619]
          Length = 226

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   +Y RE+V+R L  +A ++IL HNHPSGN  PS  D+
Sbjct: 128 LFLDSKHRPLAFEILFRGTIDRASIYPREVVRRSLMHNAAALILCHNHPSGNSEPSQDDV 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +   L  +++ V DHII+G    +S      I
Sbjct: 188 HMTLALKRGLALIDVRVLDHIIVGDGEPLSMVEQGWI 224


>gi|315127738|ref|YP_004069741.1| replication fork DNA repair protein-associated protein
           [Pseudoalteromonas sp. SM9913]
 gi|315016252|gb|ADT69590.1| replication fork DNA repair protein-associated protein
           [Pseudoalteromonas sp. SM9913]
          Length = 224

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+ DE+   GTI+   VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LYLDSQNRLLKDEILFYGTINAASVYPREVVKAALKNNAAAVIFSHNHPSGIAEPSQADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I V DHIIIG ++ VSF    +I
Sbjct: 188 LITNKLCQALQLVDINVLDHIIIGGESSVSFAERGLI 224


>gi|152983064|ref|YP_001352677.1| DNA repair protein RadC [Janthinobacterium sp. Marseille]
 gi|151283141|gb|ABR91551.1| DNA repair protein RadC [Janthinobacterium sp. Marseille]
          Length = 190

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + ++A E    GTI    VY R IVQR + L+A S+IL HNHPSG+ +PS+AD 
Sbjct: 93  VFMDTQHRVLAYEPLFFGTIHQTSVYPRAIVQRAMSLNAASMILAHNHPSGSTHPSEADK 152

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  +++ V DH IIG++   SF    ++
Sbjct: 153 QLTNRLKSLLESIDVRVLDHFIIGEEGTFSFAEHGLL 189


>gi|167036321|ref|YP_001671552.1| DNA repair protein RadC [Pseudomonas putida GB-1]
 gi|189029399|sp|B0KQ87|Y5335_PSEPG RecName: Full=UPF0758 protein PputGB1_5335
 gi|166862809|gb|ABZ01217.1| DNA repair protein RadC [Pseudomonas putida GB-1]
          Length = 226

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   VY RE+V+R L  +A ++IL HNHPSG+  PS  D+
Sbjct: 128 LFLDSKHRPLAFEILFRGTIDRASVYPREVVRRALLHNAAALILCHNHPSGSSEPSQDDV 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T ++   L  +++ V DHIIIG    +S      I
Sbjct: 188 HLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWI 224


>gi|313633115|gb|EFS00011.1| putative DNA repair protein [Listeria seeligeri FSL N1-067]
 gi|313637692|gb|EFS03068.1| putative DNA repair protein [Listeria seeligeri FSL S4-171]
          Length = 224

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  SA S++  HNHPSG+P+PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSAASLMCFHNHPSGDPSPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLVEAGNIIGITLLDHIIIGKNKYISLKEKGY 223


>gi|119898338|ref|YP_933551.1| DNA repair protein [Azoarcus sp. BH72]
 gi|119670751|emb|CAL94664.1| DNA repair protein [Azoarcus sp. BH72]
          Length = 196

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LI  E   RGT+    VY REI++R LEL A  +I  H HPSG   PS AD 
Sbjct: 100 LYLDAQNRLIRAEEAFRGTLTQTSVYPREILRRSLELHAAGVIFSHQHPSGVCEPSSADE 159

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  +++ V DHI++  D  VSF     +
Sbjct: 160 VLTNMLKSALTLVDVRVLDHIVVAGDRAVSFAETGRL 196


>gi|167758182|ref|ZP_02430309.1| hypothetical protein CLOSCI_00520 [Clostridium scindens ATCC 35704]
 gi|167664079|gb|EDS08209.1| hypothetical protein CLOSCI_00520 [Clostridium scindens ATCC 35704]
          Length = 230

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   S+GT++   +  RE+    L+ +A SI+++HNHPSG+P PS  D+
Sbjct: 134 LMLNSKSRLIGETDISKGTVNASLITPRELFIEALQKNAVSIVIMHNHPSGDPTPSREDM 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I+     + I + DHIIIG + ++SF+   ++
Sbjct: 194 LTTKRILDAGALIGIELLDHIIIGNNCYISFREEGLL 230


>gi|17547163|ref|NP_520565.1| DNA repair protein RadC [Ralstonia solanacearum GMI1000]
 gi|25009031|sp|Q8XWN0|Y2444_RALSO RecName: Full=UPF0758 protein RSc2444
 gi|17429465|emb|CAD16151.1| probable dna repair protein radc homolog [Ralstonia solanacearum
           GMI1000]
          Length = 224

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GT+    VY REI +R L  +A+++IL HNHP+G+  PS++D+
Sbjct: 128 LFLDVRHRLIAWEELFQGTLTEARVYPREIAKRALHHNASALILSHNHPTGHVEPSESDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +   L  L++ V DH+I+G+    SF    
Sbjct: 188 VLTRELCRALALLDVRVLDHMIVGRAEVYSFLEHG 222


>gi|124267880|ref|YP_001021884.1| DNA repair protein RadC [Methylibium petroleiphilum PM1]
 gi|171769841|sp|A2SJB0|Y2695_METPP RecName: Full=UPF0758 protein Mpe_A2695
 gi|124260655|gb|ABM95649.1| DNA repair protein radC family [Methylibium petroleiphilum PM1]
          Length = 222

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + L+A E   RGT++   VY RE+V+R L L+A + IL HNHPSG   PS AD 
Sbjct: 126 LFLDTQHRLLAFEELFRGTLNQASVYPREVVKRALALNAAAAILAHNHPSGVAEPSRADE 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH ++ + + VSF    ++
Sbjct: 186 ALTQALKAALALVDVRVLDHFVVARGSVVSFAERGLL 222


>gi|302386425|ref|YP_003822247.1| DNA repair protein RadC [Clostridium saccharolyticum WM1]
 gi|302197053|gb|ADL04624.1| DNA repair protein RadC [Clostridium saccharolyticum WM1]
          Length = 231

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 59/96 (61%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+    LI D + S+GT++   V  REI    ++  A S++LVHNHPSG+P+PS  D++
Sbjct: 136 LLNTKGSLIRDIMISQGTVNASAVSPREIFIEAMKYHAVSLVLVHNHPSGDPSPSREDLS 195

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            T+ +    + + I + DHIIIG ++++S K   I+
Sbjct: 196 FTRRVKEAGDLVGIRLLDHIIIGDNSYISLKERGIL 231


>gi|240138796|ref|YP_002963269.1| DNA repair protein RadC [Methylobacterium extorquens AM1]
 gi|240008766|gb|ACS39992.1| DNA repair protein RadC [Methylobacterium extorquens AM1]
          Length = 248

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 78/97 (80%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEV  RGT+DH PVY RE+ +R LEL++T+IIL HNHPSG+P PS ADI
Sbjct: 152 LFLDRRNHLIADEVLGRGTVDHTPVYPREVARRALELASTAIILAHNHPSGDPAPSKADI 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I++ L+PL I+VHDH+I+G+D   S KGL++I
Sbjct: 212 RMTREIVSVLDPLGIVVHDHVILGRDGHASLKGLKLI 248


>gi|212635015|ref|YP_002311540.1| DNA repair protein RadC [Shewanella piezotolerans WP3]
 gi|226736630|sp|B8CM29|Y2203_SHEPW RecName: Full=UPF0758 protein swp_2203
 gi|212556499|gb|ACJ28953.1| DNA repair protein RadC [Shewanella piezotolerans WP3]
          Length = 225

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTI+   VY R++V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTINSASVYPRDVVGLVLEKKAAAVIVCHNHPSGIAEPSTADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKQALQTIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|91791693|ref|YP_561344.1| DNA repair protein RadC [Shewanella denitrificans OS217]
 gi|122969048|sp|Q12SF5|Y326_SHEDO RecName: Full=UPF0758 protein Sden_0326
 gi|91713695|gb|ABE53621.1| DNA repair protein RadC [Shewanella denitrificans OS217]
          Length = 225

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKRAAAVIICHNHPSGIAEPSQADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     +
Sbjct: 188 RITERLKNALATIDVSLLDHMVVGDFEIVSFAERGWL 224


>gi|253583728|ref|ZP_04860926.1| DNA repair protein RadC [Fusobacterium varium ATCC 27725]
 gi|251834300|gb|EES62863.1| DNA repair protein RadC [Fusobacterium varium ATCC 27725]
          Length = 229

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N LIA E    GTID   VY REIV+R ++  A S++  HNHPSGN +PS  DI
Sbjct: 131 LFLNSANNLIASETLFYGTIDKSAVYPREIVERVIKNGAKSVVFAHNHPSGNISPSKQDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++  +L  L+I + DHIII KD++ SF    +I
Sbjct: 191 ELTQHMYDSLKTLDIRLIDHIIITKDSYFSFLEEGLI 227


>gi|83649010|ref|YP_437445.1| DNA repair protein [Hahella chejuensis KCTC 2396]
 gi|83637053|gb|ABC33020.1| DNA repair protein [Hahella chejuensis KCTC 2396]
          Length = 207

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N LI+ E    GTID   VY REIV+R L L+A ++IL HNHPSG   PS ADI
Sbjct: 108 MFLDNQNRLISFEKLFYGTIDQASVYPREIVKRALMLNAAAVILAHNHPSGMSEPSVADI 167

Query: 61  NMTQNIITTLNPLNIIVHDHIIIG-KDAFVSFKGLRII 97
            MT+ + ++L  +++ V DHI++G   + VSF     +
Sbjct: 168 AMTKTVKSSLALIDVRVLDHIVVGSDGSSVSFIERGYM 205


>gi|294084235|ref|YP_003550993.1| DNA repair protein RadC [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663808|gb|ADE38909.1| DNA repair protein RadC [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 247

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LIA+E  S+GT+D  PVY+RE+V   L+  A S ILVHNHPSG   PS ADI
Sbjct: 151 LCLDNQNRLIAEETLSKGTVDQTPVYVREVVNAALKHHAQSSILVHNHPSGEAEPSRADI 210

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I   LN ++I +HDH+I+     VS K L  +
Sbjct: 211 EMTLAIQDALNIMSINLHDHLIVAGKQCVSLKTLGYL 247


>gi|257094371|ref|YP_003168012.1| DNA repair protein RadC [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257046895|gb|ACV36083.1| DNA repair protein RadC [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 225

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/98 (37%), Positives = 56/98 (57%), Gaps = 1/98 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N LIA E   RGT+    VY RE+V++ L  +A +++L HNHPSG   PS AD 
Sbjct: 128 LWLDAQNRLIASEELFRGTLTQTSVYPREVVKKALYHNAAAVVLAHNHPSGVAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDA-FVSFKGLRII 97
            +T ++   L  + + V DH I+   +  +SF    ++
Sbjct: 188 LLTADLKQVLALVEVRVLDHFIVAAQSPPLSFAERGLL 225


>gi|90419162|ref|ZP_01227072.1| DNA repair protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90336099|gb|EAS49840.1| DNA repair protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 257

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 69/97 (71%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY RE+V+R LELSAT+IILVHNHPSG+P PS ADI
Sbjct: 161 LFLDKKNALIADEVQGTGTVDHTPVYTREVVKRGLELSATAIILVHNHPSGDPTPSRADI 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ II T  PL I VHDHIIIGK+   S KGLR+I
Sbjct: 221 EMTRTIIDTAKPLGIAVHDHIIIGKNGHASLKGLRLI 257


>gi|319404226|emb|CBI77819.1| DNA repair protein RadC [Bartonella rochalimae ATCC BAA-1498]
          Length = 264

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI+DEVQ  GTIDH PVY RE++ R LELSA+ +IL+HNHPSGN +PS ADI
Sbjct: 168 LFLDKRNGLISDEVQQTGTIDHTPVYPREVISRALELSASGLILIHNHPSGNASPSKADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L I +HDHIII ++ + SFK L++I
Sbjct: 228 SMTYRLKDAANALEITIHDHIIIARNNYTSFKELKLI 264


>gi|309783369|ref|ZP_07678079.1| DNA repair protein RadC-like protein [Ralstonia sp. 5_7_47FAA]
 gi|308917913|gb|EFP63600.1| DNA repair protein RadC-like protein [Ralstonia sp. 5_7_47FAA]
          Length = 164

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I      RGT+    VY RE+V+  L L+A ++I  HNHPSG P PS AD 
Sbjct: 68  IFLDAQNRVIEYIELFRGTLTQTSVYPREVVKTSLRLNAAAVIFAHNHPSGVPEPSRADE 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +   L  +++ V DH+I+   A VSF    ++
Sbjct: 128 NLTKVLKDALALVDVRVLDHVIVAGGASVSFAQRGLL 164


>gi|325982099|ref|YP_004294501.1| DNA repair protein RadC [Nitrosomonas sp. AL212]
 gi|325531618|gb|ADZ26339.1| DNA repair protein RadC [Nitrosomonas sp. AL212]
          Length = 224

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N  IA E    GT+    VY REI++R L  +A ++I  HNHPSG   PS AD 
Sbjct: 128 IFLDAKNHAIATEELFSGTLTQASVYPREIIKRALYHNAAAVIFAHNHPSGIAEPSHADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++   L+ +++ V DH I+G    +SF    +I
Sbjct: 188 VLTQSLKQALSLVDVQVLDHFIVGNGTALSFSEHDLI 224


>gi|171855257|sp|A3QIP9|Y3481_SHELP RecName: Full=UPF0758 protein Shew_3481
          Length = 225

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY RE+V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVCHNHPSGGAEPSHADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKYALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|226940826|ref|YP_002795900.1| RadC [Laribacter hongkongensis HLHK9]
 gi|254789654|sp|C1D8V1|Y1907_LARHH RecName: Full=UPF0758 protein LHK_01907
 gi|226715753|gb|ACO74891.1| RadC [Laribacter hongkongensis HLHK9]
          Length = 226

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N L+A E  + GT+    VY RE+V+  L   A ++IL HNHPSG+  PS AD 
Sbjct: 128 LCLDARNRLLAVEEVAHGTLTESRVYPREVVKAALRQHAVAVILAHNHPSGDSGPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH++I +    SF     +
Sbjct: 188 ELTEALGRALALVDVRLLDHLVISRQGCTSFAECGWL 224


>gi|94311291|ref|YP_584501.1| DNA repair protein RadC [Cupriavidus metallidurans CH34]
 gi|254241444|ref|ZP_04934766.1| hypothetical protein PA2G_02139 [Pseudomonas aeruginosa 2192]
 gi|24461569|gb|AAN62140.1|AF440523_47 putative DNA repair protein RadC [Pseudomonas aeruginosa]
 gi|93355143|gb|ABF09232.1| DNA binding protein, possibly associated to lesions [Cupriavidus
           metallidurans CH34]
 gi|126194822|gb|EAZ58885.1| hypothetical protein PA2G_02139 [Pseudomonas aeruginosa 2192]
          Length = 164

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR L+L+A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINATSVYPRVVVQRVLQLNAAAVVFAHQHPSGISEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+ A  SF    ++
Sbjct: 128 MLTQQLQAALALIDVRVLDHIIVGQGAPFSFAESGLL 164


>gi|91216072|ref|ZP_01253040.1| putative DNA repair protein [Psychroflexus torquis ATCC 700755]
 gi|91185589|gb|EAS71964.1| putative DNA repair protein [Psychroflexus torquis ATCC 700755]
          Length = 232

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I     S+G I    V  R + +  L   +T++ILVHNHPSG   PS AD 
Sbjct: 136 LMLNNSNKIIYKYPLSKGGITSTMVDTRLVYKSALAHGSTALILVHNHPSGTLQPSQADK 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +    + L+I + DHII+ +  + SF    I+
Sbjct: 196 TITQKLKNAGDLLDIKILDHIIVTEKTYFSFADEGIL 232


>gi|85707304|ref|ZP_01038388.1| DNA repair protein RadC [Roseovarius sp. 217]
 gi|85668185|gb|EAQ23062.1| DNA repair protein RadC [Roseovarius sp. 217]
          Length = 146

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N +IADE+ S GT+DHVPVY RE+++R L L+A+++IL+HNHPSG+P PS+AD+
Sbjct: 50  LYLDRKNRIIADELLSTGTVDHVPVYPREVIKRALMLNASALILIHNHPSGDPTPSEADL 109

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ I      L + +HDHII+G    +S + L  +
Sbjct: 110 SMTKEIQKGCKYLGLTLHDHIIVGAGTELSLRALGKL 146


>gi|332171766|gb|AEE21020.1| DNA repair protein RadC [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 224

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI       GTID   VY R +V++ LE +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDSQHQLIKFRKMFFGTIDSASVYPRVLVKQALEDNAAAVILTHNHPSGVAEPSQADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  II+ +  L+I V DH+++G    VSF    +I
Sbjct: 188 HITARIISAMGLLDIKVLDHLVVGDGVAVSFAERGLI 224


>gi|313899428|ref|ZP_07832938.1| DNA repair protein RadC [Clostridium sp. HGF2]
 gi|312955716|gb|EFR37374.1| DNA repair protein RadC [Clostridium sp. HGF2]
          Length = 229

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL++ N LI+  V   GT+ +  V+ REI +  ++L    I+ VHNHPSG+P PS ADI
Sbjct: 128 LFLNQKNQLISSRVMFVGTLTNASVHPREIFREAMQLGCAKILCVHNHPSGDPQPSSADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T++I        I + DHII+ ++ + SF    ++
Sbjct: 188 SLTRSIEECGVMTAIPLMDHIIVSRNTYFSFAQKGLL 224


>gi|256544878|ref|ZP_05472249.1| DNA repair protein RadC [Anaerococcus vaginalis ATCC 51170]
 gi|256399377|gb|EEU12983.1| DNA repair protein RadC [Anaerococcus vaginalis ATCC 51170]
          Length = 226

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N++I+ E+ S G ++   V  RE     ++ SA S+I VHNHPSGNPNPS  D 
Sbjct: 130 ILLDTKNVIISKELISTGDLNSSIVNPRECFISAVKKSANSVIFVHNHPSGNPNPSCNDK 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++     L+I V DHIIIG + + SF+   II
Sbjct: 190 EITQRLVQAGEILDIKVLDHIIIGNNKYFSFRQENII 226


>gi|153811312|ref|ZP_01963980.1| hypothetical protein RUMOBE_01704 [Ruminococcus obeum ATCC 29174]
 gi|149832439|gb|EDM87523.1| hypothetical protein RUMOBE_01704 [Ruminococcus obeum ATCC 29174]
          Length = 236

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N L+ D + S+GT++   +  RE+    L   A ++IL+HNHP GNP PS  D 
Sbjct: 135 MMLDNQNHLLGDTMLSKGTVNATLITPREVYLEALRYHAVNLILIHNHPGGNPAPSKCDK 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L I + DHIIIG   ++SF+   ++
Sbjct: 195 EITERICQAGEMLGINLLDHIIIGDHRYISFREEGLM 231


>gi|317494142|ref|ZP_07952558.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917915|gb|EFV39258.1| DNA repair protein RadC [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 159

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI  E   +GTI H  V+ RE+V+  L+ +A ++I+ H HPS +  PS +D 
Sbjct: 63  LLLDNQHRLITHETLFKGTISHTEVHPREVVKTTLKYNAAAVIVAHCHPSCHAEPSQSDR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ + + + DH++IG    VSF     +
Sbjct: 123 RVTERLRNALDLVGVRLLDHLVIGGMDIVSFAERGWL 159


>gi|77917683|ref|YP_355498.1| DNA repair protein RadC [Pelobacter carbinolicus DSM 2380]
 gi|123575192|sp|Q3A8G4|Y065_PELCD RecName: Full=UPF0758 protein Pcar_0065
 gi|77543766|gb|ABA87328.1| DNA replication and repair protein RadC [Pelobacter carbinolicus
           DSM 2380]
          Length = 227

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N L+ +   S G++    V+ R++    +  SA +++ VHNHPSG+P+PS  D+
Sbjct: 131 LLLDSKNRLLREVGISEGSLTASIVHPRDVFAPVVRESAAAVLFVHNHPSGDPSPSREDL 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ +      + + V DHIIIG + +VS     ++
Sbjct: 191 DITQRLREVGELMGVRVLDHIIIGDEGYVSLADRGVL 227


>gi|109896377|ref|YP_659632.1| DNA repair protein RadC [Pseudoalteromonas atlantica T6c]
 gi|123361460|sp|Q15ZW0|Y046_PSEA6 RecName: Full=UPF0758 protein Patl_0046
 gi|109698658|gb|ABG38578.1| DNA repair protein RadC [Pseudoalteromonas atlantica T6c]
          Length = 224

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI       GTID   VY R +V++ LE +A ++IL HNHPSG   PS AD 
Sbjct: 128 LLLDSQHQLIKFRKMFFGTIDSASVYPRVLVKQALEDNAAAVILTHNHPSGVAEPSQADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  II+ ++ L+I V DH+++G    VSF    +I
Sbjct: 188 HITARIISAMSLLDIKVLDHLVVGDGVAVSFAERGLI 224


>gi|145628112|ref|ZP_01783913.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
 gi|144979887|gb|EDJ89546.1| DNA repair protein RadC [Haemophilus influenzae 22.1-21]
          Length = 99

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 55/97 (56%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          LFLD  + LI  E    GTI+   VY REI++  L  +A ++IL HNHPSG   PS +D 
Sbjct: 3  LFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNAAALILAHNHPSGITEPSYSDQ 62

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ I  +   + I V DH+I+GK    SF    ++
Sbjct: 63 LITKKIQESAELMEIRVLDHLIVGKTDCYSFAENFLL 99


>gi|218888170|ref|YP_002437491.1| DNA repair protein RadC [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218759124|gb|ACL10023.1| DNA repair protein RadC [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 225

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/96 (43%), Positives = 58/96 (60%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            LD  N L+A E  SRGT++   VY REI++  L   A SIILVHNHP GNP+PS  DI 
Sbjct: 130 LLDTQNRLVAWERASRGTVNASVVYPREILELALRHKAASIILVHNHPGGNPSPSAGDIE 189

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ +  +   + + + DH+I+  DA  S K   +I
Sbjct: 190 ITRQLELSAKAIGMRLLDHVIVTDDACYSLKDDGLI 225


>gi|42665|emb|CAA44966.1| radC [Escherichia coli K-12]
 gi|42667|emb|CAA44967.1| radC [Escherichia coli K-12]
 gi|383570|prf||1903291A radC gene
 gi|444279|prf||1906333A radC gene
          Length = 99

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 62/97 (63%)

Query: 1  LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
          +FLD  + +I       GT++HV V+ REI++  ++++A+++IL HNHPSG   PS AD 
Sbjct: 3  IFLDSQHRVITHRRLFSGTLNHVEVHPREIIREAIKINASALILAHNHPSGCAEPSKADK 62

Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ II +   +++ V DHI+IG+  +VSF     I
Sbjct: 63 LITERIIKSCQFMDLRVLDHIVIGRGEYVSFAERGWI 99


>gi|237736412|ref|ZP_04566893.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421454|gb|EEO36501.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 154

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N LIA++    GTID   VY R +++  L  ++  +IL HNHPSGN  PS  DI
Sbjct: 58  LFLNNANKLIAEKTLFYGTIDKSAVYPRVVLEEVLRYNSAGVILAHNHPSGNLRPSKQDI 117

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +N++V DH+IIG D + SF+   +I
Sbjct: 118 QLTEALQELLEKINVMVLDHMIIGDDEYFSFREEGLI 154


>gi|289578046|ref|YP_003476673.1| DNA repair protein RadC [Thermoanaerobacter italicus Ab9]
 gi|297544317|ref|YP_003676619.1| DNA repair protein RadC [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|289527759|gb|ADD02111.1| DNA repair protein RadC [Thermoanaerobacter italicus Ab9]
 gi|296842092|gb|ADH60608.1| DNA repair protein RadC [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 226

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 58/96 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E S +SIILVHNHPSG+P PS  DI
Sbjct: 127 IMLNVKNKVIAIETISIGSLNTSIVHPREVFKAAIERSCSSIILVHNHPSGDPTPSREDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N L I V DH+IIG    +S K    
Sbjct: 187 EVTKRLVEGGNILGIKVLDHVIIGDGRGISLKEKGY 222


>gi|254522631|ref|ZP_05134686.1| DNA repair protein RadC [Stenotrophomonas sp. SKA14]
 gi|313107555|ref|ZP_07793740.1| hypothetical protein PA39016_001030004 [Pseudomonas aeruginosa
           39016]
 gi|219720222|gb|EED38747.1| DNA repair protein RadC [Stenotrophomonas sp. SKA14]
 gi|310880242|gb|EFQ38836.1| hypothetical protein PA39016_001030004 [Pseudomonas aeruginosa
           39016]
          Length = 164

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTSVYPRVVVQRVLELKAAAVVFAHQHPSGISEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+ A  SF    ++
Sbjct: 128 MLTQQLQAALALIDVRVLDHIIVGQGAPFSFAESGLL 164


>gi|16800652|ref|NP_470920.1| DNA repair protein RadC [Listeria innocua Clip11262]
 gi|25009035|sp|Q92BG5|Y1584_LISIN RecName: Full=UPF0758 protein lin1584
 gi|16414071|emb|CAC96815.1| lin1584 [Listeria innocua Clip11262]
 gi|313618770|gb|EFR90672.1| putative DNA repair protein [Listeria innocua FSL S4-378]
          Length = 224

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +I  +    G ++   V+ RE+ +  L  S+ SI+  HNHPSG+P PS  D+
Sbjct: 128 IFLNTKNQVIYRQTIFVGGLNASIVHPREVFRLALRKSSASIMCFHNHPSGDPAPSSEDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +    N + I + DHIIIGK+ ++S K    
Sbjct: 188 LVTKRLAEAGNIVGITLLDHIIIGKNKYISLKEKGY 223


>gi|83956247|ref|ZP_00964688.1| DNA repair protein [Sulfitobacter sp. NAS-14.1]
 gi|83839468|gb|EAP78649.1| DNA repair protein [Sulfitobacter sp. NAS-14.1]
          Length = 146

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N +IADE+ S GT+DHVPVY RE+++R L L+A+++IL+HNHPSG+P PS+AD+
Sbjct: 50  LYLDRKNRIIADELLSTGTVDHVPVYPREVIKRALMLNASALILIHNHPSGDPTPSEADL 109

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ I      L + +HDHII+G    +S +GL  +
Sbjct: 110 SMTKEIQKGCKYLGLTLHDHIIVGAGTELSLRGLGKL 146


>gi|300703309|ref|YP_003744911.1| DNA repair protein RadC fork [Ralstonia solanacearum CFBP2957]
 gi|299070972|emb|CBJ42281.1| DNA repair protein radC homolog, associated with replication fork
           [Ralstonia solanacearum CFBP2957]
          Length = 224

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 60/95 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GT+    VY REI +R L  +A+++IL HNHP+G+  PS++D+
Sbjct: 128 LFLDVRHRLIAWEELFQGTLTEARVYPREIAKRALYHNASAVILSHNHPTGHVEPSESDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +   L+ L++ V DH+I+G+    SF    
Sbjct: 188 ILTRELCRALSLLDVRVLDHMIVGRAEVYSFLEHG 222


>gi|254495321|ref|ZP_05108245.1| DNA repair protein RadC [Polaribacter sp. MED152]
 gi|85819675|gb|EAQ40832.1| DNA repair protein RadC [Polaribacter sp. MED152]
          Length = 228

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++A    S+G +    V IR + +R +EL++  +I+ HNHPSG   PS AD 
Sbjct: 132 LFLNNSNKVLAKTQISKGGLTATVVDIRLLFKRAIELASVGMIVCHNHPSGKLEPSQADK 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L+I + DH+II +  + SF    I+
Sbjct: 192 QLTEKIKRAGTTLDIKLLDHLIITEKWYFSFADEGIL 228


>gi|126464466|ref|YP_001045579.1| DNA repair protein RadC [Rhodobacter sphaeroides ATCC 17029]
 gi|126106277|gb|ABN78807.1| DNA repair protein RadC [Rhodobacter sphaeroides ATCC 17029]
          Length = 138

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N++IADE  S GT+ HVPVY RE+ +R LEL+A+++IL+HNHPSG+P PS  DI
Sbjct: 42  LFLDSKNVVIADEALSSGTVAHVPVYPREVAKRALELNASAVILIHNHPSGDPTPSTEDI 101

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I +    + + VHDHI+IG++A VSF+    +
Sbjct: 102 EMTFQIASACEAIEVRVHDHIVIGREAEVSFRASGFM 138


>gi|313884927|ref|ZP_07818679.1| DNA repair protein RadC [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619618|gb|EFR31055.1| DNA repair protein RadC [Eremococcus coleocola ACS-139-V-Col8]
          Length = 229

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 51/93 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    GT++    + REI +  ++     IIL HNHPSG+  PS ADI
Sbjct: 131 LFLNTKNEIIKKKTIFIGTVNSSVAHPREIFKEAVKYPTARIILGHNHPSGDVAPSTADI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKG 93
             T+ +I     + I + DH+IIG + ++S   
Sbjct: 191 QFTKRMIECGQLMGIEILDHLIIGHENYLSLHE 223


>gi|241662298|ref|YP_002980658.1| DNA repair protein RadC [Ralstonia pickettii 12D]
 gi|240864325|gb|ACS61986.1| DNA repair protein RadC [Ralstonia pickettii 12D]
          Length = 164

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + ++A E   +GT+D   VY R +VQR L L+A+++IL H HPSG   PS AD 
Sbjct: 68  VFLNCQHQVLAYEPMFKGTVDQTSVYPRVLVQRALALNASAVILAHQHPSGMTVPSAADQ 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH+I+GK    SF    ++
Sbjct: 128 VLTDRLKAALAMVDVRVVDHLIVGKGTPYSFAESGLL 164


>gi|291613221|ref|YP_003523378.1| DNA repair protein RadC [Sideroxydans lithotrophicus ES-1]
 gi|291583333|gb|ADE10991.1| DNA repair protein RadC [Sideroxydans lithotrophicus ES-1]
          Length = 224

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + +I  E   +GT+    VY RE+V+R L  +A ++I  HNHPSG   PS +D 
Sbjct: 128 IFVDAQHRVICAEELFQGTLTQTSVYPREVVKRALHHNAAALIFAHNHPSGVAEPSQSDQ 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++  L  +++ V DH I+   A +SF    ++
Sbjct: 188 LLTDALMQALRLVDVRVLDHFIVAGAACLSFAEKGML 224


>gi|198282668|ref|YP_002218989.1| DNA repair protein RadC [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667466|ref|YP_002424861.1| DNA repair protein RadC [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226736615|sp|B7J4A8|Y358_ACIF2 RecName: Full=UPF0758 protein AFE_0358
 gi|238689967|sp|B5EMA3|Y528_ACIF5 RecName: Full=UPF0758 protein Lferr_0528
 gi|198247189|gb|ACH82782.1| DNA repair protein RadC [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519679|gb|ACK80265.1| DNA repair protein RadC [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 224

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++  E    GTID   V+IRE+++R LEL+A ++I+ HNHPSG   PS AD+
Sbjct: 128 IFLDNRHRVLRFEEMFLGTIDGATVHIREVLKRALELNAAALIVAHNHPSGVAEPSAADL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           ++T+ +   +  L++ + DH I+G    +S +   
Sbjct: 188 SLTRRLDQAMQLLDLRLLDHFIVGDGEPLSLREQG 222


>gi|240850644|ref|YP_002972044.1| DNA repair protein RadC [Bartonella grahamii as4aup]
 gi|240267767|gb|ACS51355.1| DNA repair protein RadC [Bartonella grahamii as4aup]
          Length = 264

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/97 (60%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L+ADEVQ  GTIDH PVY RE++ R LELSA+ +ILVHNHPSG+  PSDADI
Sbjct: 168 LFLDKKNGLLADEVQQTGTIDHTPVYPREVISRALELSASGLILVHNHPSGDSTPSDADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +    N L II+HDH+II ++   SFK L++I
Sbjct: 228 TMTYRLKDAANALGIIIHDHLIIARNNHTSFKALKLI 264


>gi|78189473|ref|YP_379811.1| DNA repair protein RadC [Chlorobium chlorochromatii CaD3]
 gi|123579488|sp|Q3AQF7|Y1513_CHLCH RecName: Full=UPF0758 protein Cag_1513
 gi|78171672|gb|ABB28768.1| DNA replication and repair protein RadC [Chlorobium chlorochromatii
           CaD3]
          Length = 222

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I +E+ S GT++   ++ REI +  +  SA SII+VHNHPSG+ NPS+AD 
Sbjct: 126 LHLNTKNQVIKNELISIGTLNTAVIHPREIFKSAIRESAHSIIVVHNHPSGDVNPSNADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DH+I+ K  + SF+   ++
Sbjct: 186 KITNELKQAGAFMQIEMLDHVIMSKTEWYSFRERGLL 222


>gi|163855388|ref|YP_001629686.1| DNA repair protein radC-like protein [Bordetella petrii DSM 12804]
 gi|163259116|emb|CAP41415.1| DNA repair protein radC homolog [Bordetella petrii]
          Length = 164

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL+A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTSVYPRVVVQRVLELNAAAVVFAHQHPSGISEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+ A  SF    ++
Sbjct: 128 MLTQQLQAALALIDVRVLDHIIVGQGAPFSFAESGLL 164


>gi|257463623|ref|ZP_05628014.1| DNA repair protein radC [Fusobacterium sp. D12]
 gi|317061175|ref|ZP_07925660.1| DNA repair protein radC [Fusobacterium sp. D12]
 gi|313686851|gb|EFS23686.1| DNA repair protein radC [Fusobacterium sp. D12]
          Length = 227

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N L+  E   RG+ID   VY REI+++ L+  A S+I  HNHPSG   PS  DI
Sbjct: 131 LFLNTANRLLCSEELFRGSIDRSAVYPREILEKVLKYKAKSVIFAHNHPSGRTQPSRQDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L   ++++ +HII+ K ++ SF    ++
Sbjct: 191 ELTREMKEALKLFDVLLLEHIIVSKHSYFSFLEEGLL 227


>gi|50121779|ref|YP_050946.1| hypothetical protein ECA2855 [Pectobacterium atrosepticum SCRI1043]
 gi|49612305|emb|CAG75755.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 157

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI  EV + G I+   V+ REI++  L  +A ++IL HNHPSG   PS AD 
Sbjct: 61  LYLDNQHRLIEKEVIALGGINSTEVHPREILKASLRHNAAAVILAHNHPSGCAEPSQADR 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +  +L+ L++ V DH+++G    +SF     +
Sbjct: 121 HITDKLKGSLSQLDVRVLDHLVVGGAEVMSFAERGWL 157


>gi|182679809|ref|YP_001833955.1| DNA repair protein RadC [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635692|gb|ACB96466.1| DNA repair protein RadC [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 241

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 57/97 (58%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ  GT+DH PVY REI++R LEL A +IILVHNHPSG+P PS  D+
Sbjct: 145 LFLDRKNGLIADEVQGIGTVDHAPVYPREIIRRALELGACAIILVHNHPSGDPTPSKEDV 204

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I+     + I VHDH+IIGK    S K L++I
Sbjct: 205 QITQQIVALGKAMQISVHDHLIIGKQGHASLKSLQLI 241


>gi|319407236|emb|CBI80875.1| DNA repair protein RadC [Bartonella sp. 1-1C]
          Length = 264

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LI+DEVQ  GTIDH PVY RE++ R LELSA+ +IL+HNHPSGN +PS ADI
Sbjct: 168 LFLDKRNGLISDEVQQTGTIDHTPVYPREVISRALELSASGLILIHNHPSGNASPSKADI 227

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L I +HDHIII ++ + SFK L++I
Sbjct: 228 SMTYRLKDAANALEITIHDHIIIARNNYTSFKELKLI 264


>gi|271501414|ref|YP_003334439.1| DNA repair protein RadC [Dickeya dadantii Ech586]
 gi|270344969|gb|ACZ77734.1| DNA repair protein RadC [Dickeya dadantii Ech586]
          Length = 159

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N  +  E+   GT++H  ++ REIV+  L  +A ++IL HNHPSG   PS++D 
Sbjct: 63  LYLDNQNRFLDKEILFLGTVNHTEIHPREIVKGALRHNAAAVILAHNHPSGYTAPSESDK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  L I V DH IIG    +SF    ++
Sbjct: 123 AITRKVIQALALLEIRVLDHFIIGTHDVLSFAEHGLM 159


>gi|90962045|ref|YP_535961.1| DNA repair protein [Lactobacillus salivarius UCC118]
 gi|227891064|ref|ZP_04008869.1| DNA repair protein [Lactobacillus salivarius ATCC 11741]
 gi|301300891|ref|ZP_07207063.1| DNA repair protein RadC [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|90821239|gb|ABD99878.1| DNA repair protein [Lactobacillus salivarius UCC118]
 gi|227867153|gb|EEJ74574.1| DNA repair protein [Lactobacillus salivarius ATCC 11741]
 gi|300851490|gb|EFK79202.1| DNA repair protein RadC [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 225

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +++++V  +GT++   V+ REI +  L  S   I++ HNHPSGN  PS+ DI
Sbjct: 127 VCLDTKNQVLSEKVIFKGTLNSATVHPREIFKHALNFSCARILVAHNHPSGNVEPSENDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I + DH+I+G + ++S    +I+
Sbjct: 187 QLTKRLINAGKMIGIELIDHVIVGSEVYLSLAEEKIV 223


>gi|291533850|emb|CBL06963.1| DNA replication and repair protein RadC [Megamonas hypermegale
           ART12/1]
          Length = 229

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N +IA    S G+++   V+ RE+ +  +   A+S+ILVHNHPSG+P+PS  DI
Sbjct: 132 LLLDTKNQIIAFPDISIGSLNASIVHPREVFRCAINHFASSMILVHNHPSGDPSPSMEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +I     L+I + DHII+G + F S K   +I
Sbjct: 192 HITKKLIAGSKILDIEILDHIIVGDNKFTSLKQQGMI 228


>gi|170728880|ref|YP_001762906.1| DNA repair protein RadC [Shewanella woodyi ATCC 51908]
 gi|238688685|sp|B1KL05|Y4561_SHEWM RecName: Full=UPF0758 protein Swoo_4561
 gi|169814227|gb|ACA88811.1| DNA repair protein RadC [Shewanella woodyi ATCC 51908]
          Length = 225

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY R++V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPRDVVSLVLEKKAAAVIVCHNHPSGVAEPSHADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKCALSTIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|330957298|gb|EGH57558.1| hypothetical protein PMA4326_01827 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 224

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDSKHRAMTFEILFRGTINAAYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DH+IIG    +S     ++
Sbjct: 188 DLTKRLKEALLLVDVQVLDHVIIGDGEPLSMVEKGLM 224


>gi|218891377|ref|YP_002440244.1| RadC family DNA repair protein [Pseudomonas aeruginosa LESB58]
 gi|218771603|emb|CAW27376.1| RadC family DNA repair protein [Pseudomonas aeruginosa LESB58]
          Length = 164

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + ++A E   RGTI    V+ R IVQR LEL+A ++I  H HPSG   PS AD 
Sbjct: 68  VFLNSMHEVLAYEPMFRGTIHSTSVHARPIVQRALELNAAAVIFSHQHPSGCTEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L+ +++ V DH+I+G+    SF    ++
Sbjct: 128 ALTQTLRAALSLIDVRVLDHLIVGQGTPYSFAESGLL 164


>gi|330808765|ref|YP_004353227.1| putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376873|gb|AEA68223.1| putative DNA repair protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 163

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E    GTID V VY R I+QR LE    +II+ HNHPSG+  PS  DI
Sbjct: 67  LFLDARHRVVAYEPLFYGTIDVVNVYPRRILQRALEHQCAAIIVAHNHPSGDTIPSPGDI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  LN+ + DH IIG+    SF    +I
Sbjct: 127 QITKTLSDVLPKLNVRLLDHFIIGEGEPYSFAESGLI 163


>gi|315576278|gb|EFU88469.1| DNA repair protein RadC [Enterococcus faecalis TX0309B]
          Length = 240

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N +I  +   +G+++    + REI +  ++ S+  I+L HNHPSGNP PS  DI
Sbjct: 141 IYLNTKNDIIQQKTIFKGSLNQSIAHPREIFREAVKYSSDRILLAHNHPSGNPTPSPQDI 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T+ +      + I + DHII+G   ++S +    
Sbjct: 201 QFTKRMEECGEMMGIQLLDHIILGDSGYISLREENF 236


>gi|300214742|gb|ADJ79158.1| DNA repair protein [Lactobacillus salivarius CECT 5713]
          Length = 225

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +++++V  +GT++   V+ REI +  L  S   I++ HNHPSGN  PS+ DI
Sbjct: 127 VCLDTKNQVLSEKVIFKGTLNSATVHPREIFKHALNFSCARILVAHNHPSGNVEPSENDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I + DH+I+G + ++S    +I+
Sbjct: 187 QLTKRLINAGKMIGIELIDHVIVGSEVYLSLAEEKIV 223


>gi|294508375|ref|YP_003572433.1| DNA repair protein RadC [Salinibacter ruber M8]
 gi|294344703|emb|CBH25481.1| DNA repair protein RadC [Salinibacter ruber M8]
          Length = 258

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 50/97 (51%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I D   S G +    V  R + ++ +   A ++I +HNHPSGNP PS  DI
Sbjct: 161 VHLNTANVIIGDYTVSEGGLSSSVVEPRGVFEQAILDDAAAVICLHNHPSGNPEPSREDI 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I VHDH+II      S     +I
Sbjct: 221 RITRQLAEAGGTMGIPVHDHLIIAGTKHTSLAERGVI 257


>gi|289524079|ref|ZP_06440933.1| DNA repair protein RadC [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502735|gb|EFD23899.1| DNA repair protein RadC [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 309

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 2/99 (2%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N  I +   SRG+++   V  +EIV+     SA+S+ILVHNHPSG   PS  D+
Sbjct: 209 ILLDIKNKPIGNVEISRGSVNTTVVDPKEIVKVASLKSASSVILVHNHPSGETTPSSEDV 268

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGK--DAFVSFKGLRII 97
            +T  I    + + + V DHII+GK    + SF    +I
Sbjct: 269 ELTSRITYACDLVGVNVLDHIIVGKNPGDYYSFAREGLI 307


>gi|217978231|ref|YP_002362378.1| DNA repair protein RadC [Methylocella silvestris BL2]
 gi|217503607|gb|ACK51016.1| DNA repair protein RadC [Methylocella silvestris BL2]
          Length = 238

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GT+DH PVY REI++R LELSA ++ILVHNHPSG+P PS  DI
Sbjct: 142 LFLDKKNFLIADEVQGVGTVDHAPVYPREIMRRALELSACALILVHNHPSGDPEPSTEDI 201

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  II    PL I VHDH++IGK    S K +R+I
Sbjct: 202 YLTHQIIAVGKPLKITVHDHLVIGKHGHASLKEMRLI 238


>gi|157373526|ref|YP_001472126.1| DNA repair protein RadC [Shewanella sediminis HAW-EB3]
 gi|189029405|sp|A8FQ75|Y385_SHESH RecName: Full=UPF0758 protein Ssed_0385
 gi|157315900|gb|ABV34998.1| DNA repair protein RadC [Shewanella sediminis HAW-EB3]
          Length = 225

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY R++V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLEKKAAAVIVCHNHPSGVAEPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKFALETIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|114330110|ref|YP_746332.1| DNA repair protein RadC [Nitrosomonas eutropha C91]
 gi|114307124|gb|ABI58367.1| DNA repair protein RadC [Nitrosomonas eutropha C91]
          Length = 167

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + ++A E   +GT+    VY R +VQR LEL+A+++I  H HPSG   PS AD 
Sbjct: 70  VFLNSQHQVLACECLFKGTVSEASVYPRVVVQRALELNASALIFSHQHPSGVAEPSMADR 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L+ ++I V DH IIGK    SF    ++
Sbjct: 130 AITNRLKFILSMIDIRVVDHFIIGKGEPYSFAESGLL 166


>gi|163857461|ref|YP_001631759.1| DNA repair protein RadC [Bordetella petrii DSM 12804]
 gi|229485545|sp|A9IU27|Y3149_BORPD RecName: Full=UPF0758 protein Bpet3149
 gi|163261189|emb|CAP43491.1| DNA repair protein radC homolog [Bordetella petrii]
          Length = 225

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD    LI     +RGT+    VY RE+V+  L   A ++IL HNHPSG+  PS AD 
Sbjct: 129 LYLDSQLNLITSGELARGTLARASVYPREVVREALRHHAAALILAHNHPSGSAQPSQADR 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + T+++   L  + I + DH+I+  D  VS   L ++
Sbjct: 189 DFTRHMQQALALVEIRLLDHLIVAGDTVVSMAELGLL 225


>gi|299535631|ref|ZP_07048952.1| DNA repair protein radC-like protein [Lysinibacillus fusiformis
           ZC1]
 gi|298728831|gb|EFI69385.1| DNA repair protein radC-like protein [Lysinibacillus fusiformis
           ZC1]
          Length = 224

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G+++   V+ REI +  ++ SA SII  HNHPSG P PS  DI
Sbjct: 128 LFLNIKNQIIHKQTIFIGSLNASIVHPREIFREAVKRSAASIICAHNHPSGVPTPSSEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ I+     + I + DH+IIG   ++S K    
Sbjct: 188 EVTKRIVEAGYIIGIELIDHVIIGDHQYISLKEKGY 223


>gi|257469304|ref|ZP_05633398.1| DNA repair protein radC [Fusobacterium ulcerans ATCC 49185]
 gi|317063551|ref|ZP_07928036.1| DNA repair protein radC [Fusobacterium ulcerans ATCC 49185]
 gi|313689227|gb|EFS26062.1| DNA repair protein radC [Fusobacterium ulcerans ATCC 49185]
          Length = 229

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N LIA E    GTID   VY REIV+R +   A S++  HNHPSGN +PS  DI
Sbjct: 131 LFLNSANNLIASETLFYGTIDKSAVYPREIVERTIRNGAKSVVFAHNHPSGNISPSKQDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++  +L  L+I + DHIII K+++ SF    +I
Sbjct: 191 ELTQHMYDSLKTLDIRLIDHIIITKNSYFSFLEEGLI 227


>gi|160880508|ref|YP_001559476.1| DNA repair protein RadC [Clostridium phytofermentans ISDg]
 gi|160429174|gb|ABX42737.1| DNA repair protein RadC [Clostridium phytofermentans ISDg]
          Length = 232

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L  D  + L+ +E+ S GT++   +  RE+    ++  A  IIL+HNHPSG+P PS  DI
Sbjct: 135 LMFDTKSKLLREEIISIGTVNASIMSPREVFLLAVKYEAVYIILLHNHPSGDPTPSKEDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L + + DHIIIG + ++S K   II
Sbjct: 195 AVTKRMKEAGELLGVTLMDHIIIGDNRYISLKEQGII 231


>gi|329851338|ref|ZP_08266095.1| DNA repair protein RadC family protein [Asticcacaulis biprosthecum
           C19]
 gi|328840184|gb|EGF89756.1| DNA repair protein RadC family protein [Asticcacaulis biprosthecum
           C19]
          Length = 243

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/97 (54%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK   LIADE+   GT+DH P Y REI++R LELSA+S+ILVHNHPSG+P+ S  DI
Sbjct: 147 LFLDKKYQLIADEIMGYGTVDHAPAYPREIMRRALELSASSVILVHNHPSGDPSASPGDI 206

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ I+    PL I VHDH+I+G++  +S    R++
Sbjct: 207 DMTRQIVKAGEPLRIKVHDHLIVGREGVLSMSQQRLM 243


>gi|163868311|ref|YP_001609520.1| DNA repair protein RadC [Bartonella tribocorum CIP 105476]
 gi|161017967|emb|CAK01525.1| DNA repair protein RadC [Bartonella tribocorum CIP 105476]
          Length = 270

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 70/97 (72%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N L+ADEVQ  GTIDH PVY RE++ R LELSA+ +ILVHNHPSG+  PSDADI
Sbjct: 174 LFLDKKNGLLADEVQQTGTIDHTPVYPREVISRALELSASGLILVHNHPSGDSTPSDADI 233

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +    N L I +HDH+II +    SFK L++I
Sbjct: 234 TMTYRLKDAANALGITIHDHLIIARHNHTSFKALKLI 270


>gi|296157078|ref|ZP_06839914.1| DNA repair protein RadC [Burkholderia sp. Ch1-1]
 gi|295892414|gb|EFG72196.1| DNA repair protein RadC [Burkholderia sp. Ch1-1]
          Length = 164

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + +IA E    GTID   VY R +VQR L  +A ++IL H HPSG   PS AD 
Sbjct: 68  IFMDSQHQVIAYEPLFHGTIDAAVVYPRVLVQRALAHNAAALILAHQHPSGVAKPSAADK 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++I   L  +++ V DHII+GK    SF    ++
Sbjct: 128 AITRDIKAALAMVDVRVLDHIIVGKGTPYSFSEAGLL 164


>gi|213161115|ref|ZP_03346825.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213428441|ref|ZP_03361191.1| DNA repair protein RadC [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 159

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI  +    GT++ V V+ RE+V+  L+ +A +++L HNHPSG   PS AD 
Sbjct: 63  LWLDNQHRLIVHDTLFLGTVNAVTVHPREVVKSGLKNNAAAVVLAHNHPSGEAEPSKADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  ++I + DH+IIG     SF     +
Sbjct: 123 LITERLQQALELVDIRLLDHLIIGGMDIASFAERGWL 159


>gi|310778318|ref|YP_003966651.1| DNA repair protein RadC [Ilyobacter polytropus DSM 2926]
 gi|309747641|gb|ADO82303.1| DNA repair protein RadC [Ilyobacter polytropus DSM 2926]
          Length = 225

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 61/97 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N L+ +E   +GTID   VY R IV++ L+  A S+I  HNHPSGN NPS ADI
Sbjct: 129 IFLDTANNLLCEETLFKGTIDRSGVYPRNIVEKVLKHGAKSVIFAHNHPSGNLNPSKADI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + T  I   LN + I V DH+II +D++ SF    +I
Sbjct: 189 DFTDKITKVLNAIEIRVLDHMIITRDSYFSFLEKGLI 225


>gi|145301518|ref|YP_001144357.1| DNA repair protein [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142856400|gb|ABO92609.1| DNA repair protein [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 296

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + +I     S GTID   VY RE+V+  L+ +A ++IL HNHPSG   PS AD 
Sbjct: 67  ILLDNQHRVINAVDLSHGTIDSAAVYPREVVKTALKHNAAAVILAHNHPSGVAEPSRADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +   L+ ++I V DHI++  +  +SF     
Sbjct: 127 QITERLQAALDLVDIRVLDHIVVAGENSMSFAVRGF 162


>gi|238855285|ref|ZP_04645604.1| DNA repair protein RadC [Lactobacillus jensenii 269-3]
 gi|260664643|ref|ZP_05865495.1| DNA repair protein RadC [Lactobacillus jensenii SJ-7A-US]
 gi|282932422|ref|ZP_06337847.1| RadC-like protein [Lactobacillus jensenii 208-1]
 gi|313471902|ref|ZP_07812394.1| DNA repair protein RadC [Lactobacillus jensenii 1153]
 gi|238832177|gb|EEQ24495.1| DNA repair protein RadC [Lactobacillus jensenii 269-3]
 gi|239529177|gb|EEQ68178.1| DNA repair protein RadC [Lactobacillus jensenii 1153]
 gi|260561708|gb|EEX27680.1| DNA repair protein RadC [Lactobacillus jensenii SJ-7A-US]
 gi|281303371|gb|EFA95548.1| RadC-like protein [Lactobacillus jensenii 208-1]
          Length = 207

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N ++ + +  +GT++   V+ R+I +  +  ++  I++ HNHPSG+ +PS  DI
Sbjct: 111 IYLDNKNKVLGERLLFQGTVNRSVVHPRDIFRWAVFYNSVGILIAHNHPSGDTSPSQKDI 170

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I    + + I   DHII+   +++SFK  ++I
Sbjct: 171 EFTKQIDKASDLMGINFLDHIIVADRSYLSFKEEQLI 207


>gi|149912934|ref|ZP_01901468.1| DNA repair protein RadC [Roseobacter sp. AzwK-3b]
 gi|149813340|gb|EDM73166.1| DNA repair protein RadC [Roseobacter sp. AzwK-3b]
          Length = 254

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/96 (55%), Positives = 73/96 (76%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           +LD+ NILIADE Q+ GT+DHVPVY RE+V+R L L+A+++ILVHNHPSG+P PS++DI+
Sbjct: 159 YLDRKNILIADEAQANGTVDHVPVYPREVVKRALHLNASALILVHNHPSGDPTPSESDIH 218

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT  I T    L + +HDH+IIGK   +SF+    +
Sbjct: 219 MTHQIQTAAQALGLTLHDHLIIGKSCEISFRAQGYL 254


>gi|104784328|ref|YP_610826.1| DNA repair protein RadC [Pseudomonas entomophila L48]
 gi|122401255|sp|Q1I2U3|Y5431_PSEE4 RecName: Full=UPF0758 protein PSEEN5431
 gi|95113315|emb|CAK18043.1| DNA repair protein radC [Pseudomonas entomophila L48]
          Length = 226

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   +Y RE+V+R L  +A ++IL HNHPSGN  PS  D+
Sbjct: 128 LFLDTKHRPLAFEILFRGTIDRASIYPREVVRRALLHNAAALILCHNHPSGNCEPSQDDV 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +  +L  +++ V DH+I+G    +S      +
Sbjct: 188 HLTLMLKRSLALIDVRVVDHVIVGDGEPLSMIEHGWL 224


>gi|323136973|ref|ZP_08072053.1| DNA repair protein RadC [Methylocystis sp. ATCC 49242]
 gi|322397734|gb|EFY00256.1| DNA repair protein RadC [Methylocystis sp. ATCC 49242]
          Length = 244

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/97 (61%), Positives = 75/97 (77%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ  GTIDH PVY RE+V+R LEL A+++IL HNHPSG+P PS ADI
Sbjct: 148 LFLDKRNALIADEVQGVGTIDHTPVYPREVVRRALELGASALILAHNHPSGDPTPSAADI 207

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT++II    P  I VHDH+I+G++   SF+GL++I
Sbjct: 208 RMTKDIIAIAQPFGIAVHDHLIVGRNGQASFRGLKLI 244


>gi|223984388|ref|ZP_03634527.1| hypothetical protein HOLDEFILI_01821 [Holdemania filiformis DSM
           12042]
 gi|223963630|gb|EEF68003.1| hypothetical protein HOLDEFILI_01821 [Holdemania filiformis DSM
           12042]
          Length = 228

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N ++   +  +GT+D   V+ RE+ +  L  SA  +++VHNHPS +  PS AD 
Sbjct: 131 IYLDAKNHILEHRLLFKGTLDASIVHPREVFKEALLASACRVLVVHNHPSQDLTPSLADR 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +  T   + I + DH+I+G   + SF+   ++
Sbjct: 191 IITQRLKETGELIGIELLDHLIVGTTQYFSFRAHGLL 227


>gi|198275573|ref|ZP_03208104.1| hypothetical protein BACPLE_01738 [Bacteroides plebeius DSM 17135]
 gi|198271202|gb|EDY95472.1| hypothetical protein BACPLE_01738 [Bacteroides plebeius DSM 17135]
          Length = 158

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL++ N ++   + S G +      +R I Q  L  ++ ++IL HNHPSGN  PS  DI
Sbjct: 62  LFLNQANQVLGYTLISEGGLTETTADVRLIFQAALLTNSVALILAHNHPSGNLKPSPEDI 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I V DHII+    + SF    ++
Sbjct: 122 RLTKQVRDAAQLMRIKVLDHIILTDAEYYSFADEGML 158


>gi|170293827|gb|ACB12963.1| RadC [Aquabacterium sp. PL1F5]
          Length = 198

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD   +LI  E   RGT+    VY RE+V+  L  +A +++L HNHPSG  +PS AD 
Sbjct: 102 LYLDAQQVLIEAEELFRGTLTQTSVYPREVVKNALAHNAAAVLLAHNHPSGQLSPSGADE 161

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + ++L  +++ V DH I+G D  +SF    ++
Sbjct: 162 LLTQTLKSSLMMVDVRVLDHFIVGGDRVLSFAEQGLL 198


>gi|221064731|ref|ZP_03540836.1| DNA repair protein RadC [Comamonas testosteroni KF-1]
 gi|319764685|ref|YP_004128622.1| DNA repair protein radc [Alicycliphilus denitrificans BC]
 gi|220709754|gb|EED65122.1| DNA repair protein RadC [Comamonas testosteroni KF-1]
 gi|317119246|gb|ADV01735.1| DNA repair protein RadC [Alicycliphilus denitrificans BC]
          Length = 164

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL+A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSLHQVLAYEPLFRGTINATSVYPRVVVQRVLELNAAAVVFAHQHPSGVSEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+ A  SF    ++
Sbjct: 128 MLTQQLQAALALIDVRVLDHIIVGQGAPFSFAESGLL 164


>gi|91784617|ref|YP_559823.1| DNA repair protein RadC [Burkholderia xenovorans LB400]
 gi|40019185|emb|CAE92909.1| putative DNA repair protein [Pseudomonas putida]
 gi|91688571|gb|ABE31771.1| DNA repair protein RadC [Burkholderia xenovorans LB400]
          Length = 164

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL A +++  H HPSG+  PS+AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTAVYPRVVVQRVLELKAAAVVFAHQHPSGSTEPSNADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ + DHI++G     SF    ++
Sbjct: 128 ALTQRLQAALALIDVRLLDHIVVGLGNPYSFAEHGLL 164


>gi|254441970|ref|ZP_05055456.1| DNA repair protein RadC [Octadecabacter antarcticus 307]
 gi|198250592|gb|EDY74914.1| DNA repair protein RadC [Octadecabacter antarcticus 307]
          Length = 189

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 58/97 (59%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+LIADE Q  GT+DHVPVY RE+V+R LEL+A+S+ILVHNHPSG+P PS+ DI
Sbjct: 93  LFLDRKNVLIADEAQGNGTVDHVPVYPREVVKRALELNASSLILVHNHPSGDPTPSNEDI 152

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      LNI +HDH+IIG+   +SFK   +I
Sbjct: 153 AMTMQIHDAAKALNISLHDHLIIGRSRELSFKSQGLI 189


>gi|121593658|ref|YP_985554.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|121593791|ref|YP_985687.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|120605738|gb|ABM41478.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|120605871|gb|ABM41611.1| DNA repair protein RadC [Acidovorax sp. JS42]
          Length = 164

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL+A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTSVYPRVVVQRVLELNAAAVVFAHQHPSGITEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHIIIG+ A  SF    ++
Sbjct: 128 MLTQQLQAALALIDVRVLDHIIIGQGAPFSFAESGLL 164


>gi|241764305|ref|ZP_04762334.1| DNA repair protein RadC [Acidovorax delafieldii 2AN]
 gi|241366319|gb|EER60856.1| DNA repair protein RadC [Acidovorax delafieldii 2AN]
          Length = 164

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTAVYPRVVVQRVLELKAAAVVFAHQHPSGITEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G     SF    ++
Sbjct: 128 ALTQQLQAALALIDVRVLDHIIVGLGNPYSFAEHGLL 164


>gi|207721439|ref|YP_002251880.1| DNA repair protein RadC [Ralstonia solanacearum MolK2]
 gi|207742580|ref|YP_002258972.1| dna repair protein radc homolog [Ralstonia solanacearum IPO1609]
 gi|206586599|emb|CAQ17186.1| dna repair protein radc homolog [Ralstonia solanacearum MolK2]
 gi|206593974|emb|CAQ60901.1| dna repair protein radc homolog [Ralstonia solanacearum IPO1609]
          Length = 224

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 60/95 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   +GT+    VY REI +R L  +A+++IL HNHP+G+  PS++D+
Sbjct: 128 LFLDVRHRLIAWEELFQGTLTEARVYPREIAKRALYHNASALILSHNHPTGHVEPSESDL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +   L+ L++ V DH+I+G+    SF    
Sbjct: 188 ILTRELCRALSLLDVRVLDHMIVGRAEVYSFLEHG 222


>gi|330827407|ref|YP_004390645.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
 gi|329312715|gb|AEB87129.1| DNA repair protein RadC [Alicycliphilus denitrificans K601]
          Length = 164

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I      RGT+    VY RE+V+  L L+A ++I  HNHPSG P PS AD 
Sbjct: 68  IFLDAQNRVIEYIELFRGTLTQTSVYPREVVKTSLRLNAAAVIFAHNHPSGVPEPSRADE 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +   L  +++ V DH+++   A VSF    ++
Sbjct: 128 NLTKVLKDALALVDVRVLDHVVVAGGASVSFAQRGLL 164


>gi|301644226|ref|ZP_07244233.1| DNA repair protein RadC family protein [Escherichia coli MS 146-1]
 gi|301077423|gb|EFK92229.1| DNA repair protein RadC family protein [Escherichia coli MS 146-1]
          Length = 161

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G++ HV V+ RE+V+  L  +A +++L HNHPSG+P PS  D 
Sbjct: 65  LYLDNQHRLLESETLFAGSVYHVQVHPREVVKSALRFNAAAVVLAHNHPSGDPEPSKVDR 124

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  +   L  +++   DH+++G+D  VSF     I
Sbjct: 125 QMTDKLKEVLGLVDVKTLDHLVVGQDGIVSFAERGWI 161


>gi|110598384|ref|ZP_01386657.1| DNA repair protein RadC [Chlorobium ferrooxidans DSM 13031]
 gi|110339993|gb|EAT58495.1| DNA repair protein RadC [Chlorobium ferrooxidans DSM 13031]
          Length = 223

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I  E+ S GT++   ++ RE+ +  +  SA +II+VHNHPSG+  PS+AD 
Sbjct: 126 LHLNTKNQIIKSELVSVGTLNASLIHPREVFKAAIRESAHAIIVVHNHPSGDVEPSNADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DHIIIG   + SF+   ++
Sbjct: 186 QVTALLKEASALIQIDLLDHIIIGNTGWFSFRENSLL 222


>gi|320160805|ref|YP_004174029.1| DNA repair protein RadC [Anaerolinea thermophila UNI-1]
 gi|319994658|dbj|BAJ63429.1| DNA repair protein RadC [Anaerolinea thermophila UNI-1]
          Length = 235

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 38/96 (39%), Positives = 60/96 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N ++  E    G+++   V + EI +  ++ SA S+ILVHNHPSG+P+PS  DI
Sbjct: 137 ILLDTRNRVLKIENLYIGSLNASTVRVAEIFRPAIQASAASLILVHNHPSGDPSPSPEDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +I     L+I V DH+IIG++ +VS K   +
Sbjct: 197 TLTRTVIQAGKMLDIGVLDHLIIGQNRWVSLKERGL 232


>gi|315500042|ref|YP_004088845.1| DNA repair protein radc [Asticcacaulis excentricus CB 48]
 gi|315418054|gb|ADU14694.1| DNA repair protein RadC [Asticcacaulis excentricus CB 48]
          Length = 244

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADE+ + GT+DH P Y REI++R LELSA+S+ILVHNHPSG+P PS  DI
Sbjct: 148 LFLDKKNQLIADEIMNYGTVDHAPAYPREIMRRALELSASSVILVHNHPSGDPMPSQGDI 207

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+  I    PL I +HDH+I+G++  +S K +  I
Sbjct: 208 DMTKANIAAGKPLKIAIHDHLIVGREGVLSMKQVGAI 244


>gi|332040187|gb|EGI76568.1| hypothetical protein HGR_10625 [Hylemonella gracilis ATCC 19624]
          Length = 223

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + L+A E   RGT+    VY RE+V R L   A +++L HNHPSG+ +PS AD 
Sbjct: 127 LMLDSQHRLLALEELFRGTLAQTSVYPREVVLRALHHHAAAVVLAHNHPSGSVSPSRADE 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++ + L  +++ V DH+I+     +S     ++
Sbjct: 187 LLTRSLQSALALVDVRVLDHVIVAPGQALSMAERGLL 223


>gi|294142830|ref|YP_003558808.1| DNA repair protein RadC [Shewanella violacea DSS12]
 gi|293329299|dbj|BAJ04030.1| DNA repair protein RadC [Shewanella violacea DSS12]
          Length = 225

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY R++V   LE  A+++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLEKKASAVIVCHNHPSGVAEPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKCALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|239909102|ref|YP_002955844.1| DNA repair protein RadC [Desulfovibrio magneticus RS-1]
 gi|239798969|dbj|BAH77958.1| DNA repair protein RadC [Desulfovibrio magneticus RS-1]
          Length = 228

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 56/94 (59%)

Query: 4   DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMT 63
           D  N L+  E  S+GT+D   VY RE++   L  +A+ +ILVHNHP  +P PS  D+  T
Sbjct: 135 DTKNRLVGWERVSKGTVDQAAVYPREVIAMALRYNASGVILVHNHPGADPKPSAEDMAFT 194

Query: 64  QNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           + I+     ++I V DH+++ ++ F SF+   +I
Sbjct: 195 RRIVAAAREMDIRVLDHLVVTENRFFSFQAEGMI 228


>gi|163750748|ref|ZP_02157984.1| DNA repair protein RadC [Shewanella benthica KT99]
 gi|161329592|gb|EDQ00584.1| DNA repair protein RadC [Shewanella benthica KT99]
          Length = 225

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + +I      RGTID   VY R++V   LE  A ++I+ HNHPSG   PS AD 
Sbjct: 128 LLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLEKKAAAVIVCHNHPSGVAEPSLADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++G    VSF     I
Sbjct: 188 RITERLKCALATIDVSLLDHMVVGDREIVSFAERGWI 224


>gi|166031835|ref|ZP_02234664.1| hypothetical protein DORFOR_01536 [Dorea formicigenerans ATCC
           27755]
 gi|166028288|gb|EDR47045.1| hypothetical protein DORFOR_01536 [Dorea formicigenerans ATCC
           27755]
          Length = 230

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   S+GT++   +  RE+    L+ +A  +I++HNHPSG P PS  D 
Sbjct: 134 LMLNSKSKLIGETNISKGTVNASLITPRELFIEALQKNAVFVIILHNHPSGEPTPSREDR 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      + I + DHIIIG + +VSF+   ++
Sbjct: 194 LITRRIQDAGALIGIELLDHIIIGNNCYVSFREEGML 230


>gi|237809187|ref|YP_002893627.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
 gi|237501448|gb|ACQ94041.1| DNA repair protein RadC [Tolumonas auensis DSM 9187]
          Length = 168

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E   RGTI+   VY R +VQR L  +A ++I  H HPSGN  PS AD 
Sbjct: 72  LFLDTRHQVLAYEPLFRGTINQTSVYPRVVVQRALAANAAAVIFAHQHPSGNSEPSAADR 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ ++I V DH IIG+    SF    ++
Sbjct: 132 MITRRLRDALDLIDIRVLDHFIIGQGEPYSFAESGLL 168


>gi|189347307|ref|YP_001943836.1| DNA repair protein RadC [Chlorobium limicola DSM 245]
 gi|189341454|gb|ACD90857.1| DNA repair protein RadC [Chlorobium limicola DSM 245]
          Length = 222

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I  ++ S GT++   ++ RE+ +  +  SA +IILVHNHPSG+  PS+AD 
Sbjct: 126 LHLNTKNRVIRHDIVSVGTLNASLIHPREVFKSAIRESAHAIILVHNHPSGDVEPSNADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DH+I+GK+ + SF+   ++
Sbjct: 186 QVTEILKKAGAILQIELLDHVIVGKENWFSFREHSLL 222


>gi|87199332|ref|YP_496589.1| DNA repair protein RadC [Novosphingobium aromaticivorans DSM 12444]
 gi|87135013|gb|ABD25755.1| DNA repair protein RadC [Novosphingobium aromaticivorans DSM 12444]
          Length = 245

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 67/97 (69%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N+LI D + S GT+D  P+Y RE++++ +++ A ++ILVHNHPSG+P PS ADI
Sbjct: 149 LYLNSQNMLILDHLVSEGTLDESPIYTREVIRKAMDVGAAAMILVHNHPSGSPKPSRADI 208

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ ++     + + VHDHI+IG++   S K   +I
Sbjct: 209 QVTQKVMEAARLMGMTVHDHIVIGREGHTSLKAQGLI 245


>gi|86132165|ref|ZP_01050761.1| DNA repair protein RadC [Dokdonia donghaensis MED134]
 gi|85817499|gb|EAQ38679.1| DNA repair protein RadC [Dokdonia donghaensis MED134]
          Length = 237

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++  E  S+G +    V +R +++  +ELSA  +IL HNHPSG   PS AD 
Sbjct: 141 LFLNNSNKVLRKEQVSKGGLTGTLVDVRMVMKTAIELSAVGMILGHNHPSGTLKPSQADK 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + T    L+I V DHII+ +  + SF    I+
Sbjct: 201 MLTTKLKTAAQSLDIQVLDHIIVTEKQYFSFADDGIL 237


>gi|120599009|ref|YP_963583.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
 gi|120559102|gb|ABM25029.1| DNA repair protein RadC [Shewanella sp. W3-18-1]
          Length = 160

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LIA E    GTID   VY RE+V+  L  +A + I  HNHPSG P PS AD 
Sbjct: 64  LLLDSQHRLIAYEELFFGTIDAASVYPREVVKLVLHRNAAAAIFAHNHPSGIPEPSQADK 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ + + L  +++   DH +IG    VSF     I
Sbjct: 124 RITERLKSALATIDVAALDHFVIGHHEVVSFAERGWI 160


>gi|325290578|ref|YP_004266759.1| DNA replication and repair protein RadC [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965979|gb|ADY56758.1| DNA replication and repair protein RadC [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 230

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+   +L+     S G+++   V+ RE  +  ++ ++ S+IL+HNHPSG+P+PS  D+
Sbjct: 134 MHLNTKKMLLGISEISIGSLNSSLVHPRECFKEAIKRNSHSLILLHNHPSGDPSPSQEDL 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I V DHIIIG   +VS K   +I
Sbjct: 194 EITRRLDECGRILGISVLDHIIIGDGRYVSLKEQGMI 230


>gi|325840362|ref|ZP_08167009.1| putative DNA repair protein RadC [Turicibacter sp. HGF1]
 gi|325490347|gb|EGC92674.1| putative DNA repair protein RadC [Turicibacter sp. HGF1]
          Length = 149

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 48/96 (50%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  N      V S GT++   V+ RE+ +  +  +A SI+  HNHPSG+  PS  DI 
Sbjct: 54  CLNTKNEPTNISVVSVGTLNKTIVHPREVFKTAILSNACSIVAFHNHPSGDTKPSQQDIQ 113

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T  +      L I + DH+IIG   F S K    +
Sbjct: 114 LTNRLYEAGELLGIKLLDHLIIGDGTFTSLKEKGYL 149


>gi|255292379|dbj|BAH89498.1| DNA repair protein RadC [uncultured bacterium]
          Length = 146

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N +IADE+ S GT+DHVPVY RE+++R L L+A+++IL+HNHPSG+P PS+AD+
Sbjct: 50  LYLDRKNRIIADELLSTGTVDHVPVYPREVIKRALMLNASALILIHNHPSGDPTPSEADL 109

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ I      L + +HDHII+G    +S + L  +
Sbjct: 110 SMTKEIQKGCKYLGLTMHDHIIVGAGTELSLRALGKL 146


>gi|171057386|ref|YP_001789735.1| DNA repair protein RadC [Leptothrix cholodnii SP-6]
 gi|238689101|sp|B1Y0I9|Y695_LEPCP RecName: Full=UPF0758 protein Lcho_0695
 gi|170774831|gb|ACB32970.1| DNA repair protein RadC [Leptothrix cholodnii SP-6]
          Length = 222

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+++R L L+A ++IL HNHPSG   PS AD 
Sbjct: 126 LFLDAQHRLIAYEPLFRGTLTQTSVYPREVLKRALALNAAALILAHNHPSGVAEPSRADE 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++ T L  +++ V DH ++G+++ VSF    ++
Sbjct: 186 FLTQSLKTALALIDVRVLDHFVVGRESVVSFAERGLL 222


>gi|307243140|ref|ZP_07525314.1| DNA repair protein RadC [Peptostreptococcus stomatis DSM 17678]
 gi|306493500|gb|EFM65479.1| DNA repair protein RadC [Peptostreptococcus stomatis DSM 17678]
          Length = 228

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 53/94 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +I+D   S G+++   V+ RE+    ++  + +IIL+HNHPSGN  PS  DI
Sbjct: 132 ILLNTKNEIISDVDVSIGSLNSSIVHPREVFIEAIKRRSNAIILMHNHPSGNSEPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ +      L I V DHI+IG   + S K  
Sbjct: 192 MITKRLNECGKMLGINVLDHIVIGDGNYYSLKEN 225


>gi|186894518|ref|YP_001871630.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
 gi|186697544|gb|ACC88173.1| DNA repair protein RadC [Yersinia pseudotuberculosis PB1/+]
          Length = 156

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E+   GT+ H  V+ RE+V+  L+ +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLESEILFTGTLSHTEVHPREVVKLALKHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+  L  + I V DH+++G +  VSF    ++
Sbjct: 121 HITQRIVKALALMQIRVLDHLVVG-NGVVSFAEQGLL 156


>gi|125973275|ref|YP_001037185.1| DNA repair protein RadC [Clostridium thermocellum ATCC 27405]
 gi|281417478|ref|ZP_06248498.1| DNA repair protein RadC [Clostridium thermocellum JW20]
 gi|125713500|gb|ABN51992.1| DNA repair protein RadC [Clostridium thermocellum ATCC 27405]
 gi|281408880|gb|EFB39138.1| DNA repair protein RadC [Clostridium thermocellum JW20]
          Length = 223

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   E+   GTI+  PVY R IV+  L   A S+IL HNHP G  NPS ADI
Sbjct: 125 ICLDAQNRVNYAELVHEGTINEAPVYPRIIVETALRHKANSVILAHNHPGGTLNPSKADI 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I   L  ++I V DHII+    +VSF    ++
Sbjct: 185 EATKRIKAALEAISIKVVDHIIVCGGQYVSFAEKGLL 221


>gi|329119079|ref|ZP_08247771.1| DNA repair protein RadC [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464818|gb|EGF11111.1| DNA repair protein RadC [Neisseria bacilliformis ATCC BAA-1200]
          Length = 224

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N LI     +RGT+    VY+RE+V+  L+  A ++IL HNHP G+P PS+ADI
Sbjct: 128 LLLNSRNRLIDCVELARGTVAENAVYVREVVKLALDRHAAALILAHNHPGGSPEPSEADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  +   L  +++ + DH +I     VSF    ++
Sbjct: 188 AFTGRLKQALELVDVRLLDHFVITAQRAVSFAERGLV 224


>gi|121582506|ref|YP_974038.1| DNA repair protein RadC [Acidovorax sp. JS42]
 gi|120608564|gb|ABM44303.1| DNA repair protein RadC [Acidovorax sp. JS42]
          Length = 164

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N +I      RGT+    VY RE+V+  L L+A ++I  HNHPSG P PS AD 
Sbjct: 68  IFLDAQNRVIEYIELFRGTLTQTSVYPREVVKTSLRLNAAAVIFAHNHPSGVPEPSRADE 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +   L  +++ V DH+++   A VSF    ++
Sbjct: 128 NLTRVLKDALALVDVRVLDHVVVAGGASVSFAQRGLL 164


>gi|256003755|ref|ZP_05428743.1| DNA repair protein RadC [Clostridium thermocellum DSM 2360]
 gi|255992316|gb|EEU02410.1| DNA repair protein RadC [Clostridium thermocellum DSM 2360]
 gi|316940493|gb|ADU74527.1| DNA repair protein RadC [Clostridium thermocellum DSM 1313]
          Length = 224

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   E+   GTI+  PVY R IV+  L   A S+IL HNHP G  NPS ADI
Sbjct: 126 ICLDAQNRVNYAELVHEGTINEAPVYPRIIVETALRHKANSVILAHNHPGGTLNPSKADI 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I   L  ++I V DHII+    +VSF    ++
Sbjct: 186 EATKRIKAALEAISIKVVDHIIVCGGQYVSFAEKGLL 222


>gi|169829398|ref|YP_001699556.1| DNA repair protein radC-like protein [Lysinibacillus sphaericus
           C3-41]
 gi|168993886|gb|ACA41426.1| DNA repair protein radC-like protein [Lysinibacillus sphaericus
           C3-41]
          Length = 223

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G+++   V+ REI +  ++ SA SII  HNHPSG P PS+ DI
Sbjct: 127 LFLNIKNQIIHRQTIFIGSLNASIVHPREIFREAVKRSAASIICAHNHPSGVPTPSEEDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ I      + I + DH+IIG   F+S K    
Sbjct: 187 EVTKRIEEAGYIMGIELIDHVIIGDHQFISLKEKGY 222


>gi|163851630|ref|YP_001639673.1| DNA repair protein RadC [Methylobacterium extorquens PA1]
 gi|163663235|gb|ABY30602.1| DNA repair protein RadC [Methylobacterium extorquens PA1]
          Length = 248

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGT+DH PVY RE+ +R LEL++T+IIL HNHPSG+P PS ADI
Sbjct: 152 LFLDRRNHLIADEVQGRGTVDHTPVYPREVARRALELASTAIILAHNHPSGDPAPSGADI 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I++ L+PL I+VHDH+I+G+D   S KGL++I
Sbjct: 212 RMTREIVSVLDPLGIVVHDHVILGRDGHASLKGLKLI 248


>gi|91201867|emb|CAJ74927.1| similar to DNA repair protein RadC [Candidatus Kuenenia
           stuttgartiensis]
          Length = 232

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 53/94 (56%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            LD  N +I +   S G++    V+ RE+    ++ SA S++ VHNHPSG+P PS  DI 
Sbjct: 136 LLDNKNRIIKELTISIGSLTLSIVHPREVFSPAIKESAASVVFVHNHPSGDPEPSKEDIQ 195

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           +TQ +    N + I V DHII+G   +VS +   
Sbjct: 196 ITQRLQEVGNIVGIKVLDHIIVGNGCYVSLRDKG 229


>gi|83589400|ref|YP_429409.1| DNA repair protein RadC [Moorella thermoacetica ATCC 39073]
 gi|123524970|sp|Q2RL23|Y536_MOOTA RecName: Full=UPF0758 protein Moth_0536
 gi|83572314|gb|ABC18866.1| DNA replication and repair protein RadC [Moorella thermoacetica
           ATCC 39073]
          Length = 229

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 55/95 (57%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  N ++  +  S G+++    + RE+ +  +  SA +IIL HNHPSG+P PS  DI +
Sbjct: 135 LNTKNQVLGIDNVSVGSLNSSLAHPREVFKDPIRRSAAAIILAHNHPSGDPTPSQEDIMV 194

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ ++   + L I V DH+IIG   F S K   ++
Sbjct: 195 TRRLVEAGHILGIEVLDHLIIGDGRFTSLKERNLL 229


>gi|327439515|dbj|BAK15880.1| DNA repair protein [Solibacillus silvestris StLB046]
          Length = 232

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++  +    G+++   V+ REI +  ++ SA SII  HNHPSG P PS  DI
Sbjct: 136 LFLNVKNQVLHKQTIFVGSLNASIVHPREIFREAVKRSAASIICSHNHPSGIPTPSPEDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T  +      + + + DH+IIG   F+S K    
Sbjct: 196 DVTTRLYEAGKIVGVDLLDHVIIGDHQFISMKEKGY 231


>gi|323141285|ref|ZP_08076181.1| DNA repair protein RadC [Phascolarctobacterium sp. YIT 12067]
 gi|322414242|gb|EFY05065.1| DNA repair protein RadC [Phascolarctobacterium sp. YIT 12067]
          Length = 252

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +I  E+ S G++ +  V+ RE+    +   A SI + HNHPSG+P PS  D 
Sbjct: 154 ILLNSKNKVIGTELVSEGSLTNSVVHPREVFLPAILQHAASICVAHNHPSGDPQPSIEDR 213

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L I + DH+IIG  A+ SF+    +
Sbjct: 214 QLTAVLLAAGQTLGIPLLDHLIIGDGAYYSFQEDGAL 250


>gi|254561399|ref|YP_003068494.1| DNA repair protein RadC [Methylobacterium extorquens DM4]
 gi|254268677|emb|CAX24636.1| DNA repair protein RadC [Methylobacterium extorquens DM4]
          Length = 248

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGT+DH PVY RE+ +R LEL++T+IIL HNHPSG+P PS ADI
Sbjct: 152 LFLDRRNHLIADEVQGRGTVDHTPVYPREVARRALELASTAIILAHNHPSGDPAPSGADI 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I++ L+PL I+VHDH+I+G+D   S KGL++I
Sbjct: 212 RMTREIVSVLDPLGIVVHDHVILGRDGHASLKGLKLI 248


>gi|83648347|ref|YP_436782.1| DNA repair protein [Hahella chejuensis KCTC 2396]
 gi|83636390|gb|ABC32357.1| DNA repair protein [Hahella chejuensis KCTC 2396]
          Length = 183

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA EV  RG ID   +Y RE+V+  L  +A  +I+ HNHPSG+P PS  D 
Sbjct: 75  LFLDTQNRLIAYEVLFRGAIDEAHIYPREVVKAALRHNAAKVIVAHNHPSGDPKPSVNDQ 134

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T  ++  L  + I + DH ++G D  VS     I
Sbjct: 135 LITYRLLQALMLVEIPLIDHFVVGGDQVVSMAAQGI 170


>gi|160897347|ref|YP_001562929.1| DNA repair protein RadC [Delftia acidovorans SPH-1]
 gi|238687206|sp|A9BYK1|Y1904_DELAS RecName: Full=UPF0758 protein Daci_1904
 gi|160362931|gb|ABX34544.1| DNA repair protein RadC [Delftia acidovorans SPH-1]
          Length = 226

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+V R L   A ++IL HNHPSG    S AD 
Sbjct: 130 LFLDGQHRLIALEEMFRGTLTRTSVYPREVVLRALHHHAGAVILAHNHPSGQVQASAADK 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQN+   L  ++I V DH+I+   A +S  G  ++
Sbjct: 190 AVTQNLQAALRLVDIQVLDHVIVAPGASLSMAGQGML 226


>gi|291087662|ref|ZP_06347068.2| DNA repair protein RadC [Clostridium sp. M62/1]
 gi|291074382|gb|EFE11746.1| DNA repair protein RadC [Clostridium sp. M62/1]
          Length = 252

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +  +  N+LI +    RGT++      REI    L   A  + LVHNHPSG+P+PS  DI
Sbjct: 156 MMFNTKNMLIRESCLFRGTVNASVASAREIFIEALRYHAVRLALVHNHPSGDPSPSGEDI 215

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L + + DH+IIG +++ SFK   II
Sbjct: 216 RLTRQVAQAGELLGVTLLDHVIIGDNSYFSFKERGII 252


>gi|114767352|ref|ZP_01446159.1| DNA repair protein RadC [Pelagibaca bermudensis HTCC2601]
 gi|114540556|gb|EAU43631.1| DNA repair protein RadC [Roseovarius sp. HTCC2601]
          Length = 168

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 68/100 (68%), Gaps = 3/100 (3%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD+ N LI D++ SRG+IDHVPVY+ E+++  L L A+++IL HNHPSG+P PS ADI
Sbjct: 67  LLLDRKNKLIRDKIMSRGSIDHVPVYVSEVMRSALVLDASALILCHNHPSGDPQPSQADI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAF---VSFKGLRII 97
           +MT+ I+     ++I +HDH+I+G        S +   ++
Sbjct: 127 DMTRKIVDACRVMDITLHDHLIVGFGREQAAFSMRAAGML 166


>gi|326391442|ref|ZP_08212978.1| DNA repair protein RadC [Thermoanaerobacter ethanolicus JW 200]
 gi|325992521|gb|EGD50977.1| DNA repair protein RadC [Thermoanaerobacter ethanolicus JW 200]
          Length = 226

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E S++SIILVHNHPSG+P PS  DI
Sbjct: 127 IMLNVKNKVIAIETISIGSLNTSIVHPREVFKAAIERSSSSIILVHNHPSGDPTPSREDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N L I V DH+IIG    +S K    
Sbjct: 187 EVTKRLVEGGNILGIKVLDHVIIGDGRGISLKEKGY 222


>gi|307266691|ref|ZP_07548219.1| DNA repair protein RadC [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918293|gb|EFN48539.1| DNA repair protein RadC [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 226

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E S++SIILVHNHPSG+P PS  DI
Sbjct: 127 IMLNVKNKVIAIETISIGSLNTSIVHPREVFKAAIERSSSSIILVHNHPSGDPTPSREDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   + L I V DH+IIG    +S K    
Sbjct: 187 EVTKRLVEGGDILGIKVLDHVIIGDGRGISLKEKGY 222


>gi|304439839|ref|ZP_07399733.1| DNA repair protein RadC [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371578|gb|EFM25190.1| DNA repair protein RadC [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 245

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/95 (40%), Positives = 59/95 (62%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD    LI     S+GT+D   V+ RE+ +  +E++A SII+ HNHPSG+P PS  D ++
Sbjct: 150 LDTKKCLIKSSEISKGTLDATVVHPREVFREAIEVNAHSIIISHNHPSGDPVPSQKDRDI 209

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  ++   + LNI + DHI+IG+  + SF+   I+
Sbjct: 210 TNILLKAGDILNIELVDHIVIGRGKYFSFREEGIL 244


>gi|150015380|ref|YP_001307634.1| DNA repair protein RadC [Clostridium beijerinckii NCIMB 8052]
 gi|189029392|sp|A6LQP8|Y490_CLOB8 RecName: Full=UPF0758 protein Cbei_0490
 gi|149901845|gb|ABR32678.1| DNA repair protein RadC [Clostridium beijerinckii NCIMB 8052]
          Length = 229

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  NI++  +   +G+++   V+ REI ++ +  ++ SII+ HNHPSG+P PS  DI
Sbjct: 133 VLLNTKNIVVGIKDVFKGSLNTSVVHPREIFKQAISKNSASIIICHNHPSGDPTPSREDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  I    N + I + DHIIIG + FVS K   +I
Sbjct: 193 NITLRIKECGNIIGIQLVDHIIIGNNKFVSLKERGLI 229


>gi|290969098|ref|ZP_06560628.1| putative DNA repair protein RadC [Megasphaera genomosp. type_1 str.
           28L]
 gi|290780858|gb|EFD93456.1| putative DNA repair protein RadC [Megasphaera genomosp. type_1 str.
           28L]
          Length = 229

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 54/95 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL   N LI  +  S GT++      R++ +  ++ +A S++LVHNHPSG+P PS  DI
Sbjct: 133 VFLSVKNRLITVQTLSVGTLNASLARARDVFRLAMQYNAASVVLVHNHPSGDPEPSREDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ I+     + I V DHIIIG   FVS     
Sbjct: 193 LLTKQIVKAGEIMGIPVLDHIIIGDGTFVSLCERG 227


>gi|238750426|ref|ZP_04611927.1| DNA repair protein RadC [Yersinia rohdei ATCC 43380]
 gi|238711357|gb|EEQ03574.1| DNA repair protein RadC [Yersinia rohdei ATCC 43380]
          Length = 156

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E    GT+ H  V+ RE+V+  L+ +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLERETLFTGTLCHTEVHPREVVKSALKHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+  L  + + V DH+++G    VSF    ++
Sbjct: 121 HITQRIVKALALVEVRVLDHLVVG-SEVVSFAERGLL 156


>gi|89052777|ref|YP_508228.1| DNA repair protein RadC [Jannaschia sp. CCS1]
 gi|88862326|gb|ABD53203.1| DNA repair protein RadC [Jannaschia sp. CCS1]
          Length = 257

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N+L+ADE Q+ GT+DHVPVY RE+++R LEL+AT++ILVHNHPSG+P PS+AD+
Sbjct: 161 LYLDRKNVLVADEAQADGTVDHVPVYPREVIKRALELNATALILVHNHPSGDPTPSEADV 220

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I    +  NI +HDH++IGK   +SF+    +
Sbjct: 221 QMTMAIRDAADVFNIAIHDHLVIGKARELSFRAEGYL 257


>gi|269137403|ref|YP_003294103.1| DNA repair protein [Edwardsiella tarda EIB202]
 gi|267983063|gb|ACY82892.1| DNA repair protein [Edwardsiella tarda EIB202]
          Length = 147

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++       GT++   VY RE+V+  L+ +A ++ILVHNHPSG+P  SDADI
Sbjct: 51  LLLDNRNRVLLWRELFYGTLNQTAVYPREVVKLALQHNAAAVILVHNHPSGHPEASDADI 110

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   +  +++ + DH I+  D  VS     ++
Sbjct: 111 ALTRRLQQAMALIDVRIPDHFIVAGDHTVSMAERGLL 147


>gi|237745564|ref|ZP_04576044.1| DNA repair protein radC [Oxalobacter formigenes HOxBLS]
 gi|229376915|gb|EEO27006.1| DNA repair protein radC [Oxalobacter formigenes HOxBLS]
          Length = 224

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LI      RGT+ H  VY RE+V+  L  +A ++I  HNHP G+  PS+AD 
Sbjct: 128 LFLDIKNKLIESSEMFRGTLSHTSVYPREVVKAALGRNAANVIFAHNHPFGSAEPSNADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++   L  ++I V DHII+      SF    I+
Sbjct: 188 TLTRSLKQALGLVDIRVLDHIIVAGKNTYSFAEYGIL 224


>gi|66768348|ref|YP_243110.1| putative DNA repair protein RadC [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188991850|ref|YP_001903860.1| putative RadC family DNA repair protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|66573680|gb|AAY49090.1| putative DNA repair protein RadC [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733610|emb|CAP51815.1| putative RadC family DNA repair protein [Xanthomonas campestris pv.
           campestris]
          Length = 164

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + ++A E   RGTI+   V+ R IVQR L L+A ++IL H HPSG   PS+AD 
Sbjct: 68  VFMDNLHQVLACEPMFRGTINSATVHARVIVQRALALNAAAVILSHQHPSGATEPSNADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DHIIIGK    SF    ++
Sbjct: 128 TLTHQLEAALALIDVRVLDHIIIGKGTPFSFAERGLL 164


>gi|313501259|gb|ADR62625.1| RadC [Pseudomonas putida BIRD-1]
          Length = 175

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  +A E+  RGTID   VY RE+V+R L  +A ++IL HNHPSG   PS  D+
Sbjct: 77  LFLDTKHRPLAFEILFRGTIDRASVYPREVVRRALVHNAAALILCHNHPSGISEPSQDDV 136

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T ++   L  +++ V DHIIIG    +S      I
Sbjct: 137 HLTLSLKRGLALIDVRVLDHIIIGDGEPLSMVEHGWI 173


>gi|326387170|ref|ZP_08208780.1| DNA repair protein RadC [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208351|gb|EGD59158.1| DNA repair protein RadC [Novosphingobium nitrogenifigens DSM 19370]
          Length = 301

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 48/97 (49%), Positives = 67/97 (69%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N L+ D+V S GT+D   +Y REI+ + + + A S+ILVHNHPSG+P PS ADI
Sbjct: 205 LYLNVQNRLLLDQVVSDGTLDESAIYTREIIGKAMAIGAASLILVHNHPSGSPQPSRADI 264

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +I     LNI+VHDH+IIG++  VS K   +I
Sbjct: 265 QVTQKVIEAGRHLNIVVHDHVIIGREGHVSLKAKGLI 301


>gi|312795310|ref|YP_004028232.1| DNA repair protein radC [Burkholderia rhizoxinica HKI 454]
 gi|312167085|emb|CBW74088.1| DNA repair protein radC [Burkholderia rhizoxinica HKI 454]
          Length = 239

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD    +I  E  SRG++ H  VY RE+V+R LE +A ++I+ HNHPSG   PS AD+
Sbjct: 143 LFLDTRLRMIHAEELSRGSLSHAAVYPREVVRRALETNAAALIIAHNHPSGAAQPSAADL 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT+ +   L  ++I + DH I+  D  +S     ++
Sbjct: 203 SMTRTLKNALCLMDIKLLDHFIVTSDTILSLARHGLL 239


>gi|310819987|ref|YP_003952345.1| DNA repair protein RadC [Stigmatella aurantiaca DW4/3-1]
 gi|309393059|gb|ADO70518.1| DNA repair protein RadC [Stigmatella aurantiaca DW4/3-1]
          Length = 249

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L  +  N+L+ +   + GT++  PV  RE+    L L AT+++  HNHPSG+P PS  D+
Sbjct: 137 LCFNPRNVLLGNVRVAEGTMNTCPVDPREVYAAALSLRATALVFAHNHPSGDPEPSAQDV 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      L I V DH+++G   +VS     ++
Sbjct: 197 RLTAQLAEAGQLLGIKVLDHLVLGDGTYVSLLERGLL 233


>gi|83648279|ref|YP_436714.1| DNA repair protein [Hahella chejuensis KCTC 2396]
 gi|83636322|gb|ABC32289.1| DNA repair protein [Hahella chejuensis KCTC 2396]
          Length = 183

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N LIA EV  RG ID   +Y RE+V+  L  +A  +I+ HNHPSG+P PS  D 
Sbjct: 75  LFLDTQNRLIAYEVLFRGAIDEAHIYPREVVKAALRHNAAKVIVAHNHPSGDPKPSVNDQ 134

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T  ++  L  + I + DH ++G D  VS     I
Sbjct: 135 LITYRLLQALMLVEIPLIDHFVVGGDQVVSMAAQGI 170


>gi|194333569|ref|YP_002015429.1| DNA repair protein RadC [Prosthecochloris aestuarii DSM 271]
 gi|229470324|sp|B4S6M7|Y735_PROA2 RecName: Full=UPF0758 protein Paes_0735
 gi|194311387|gb|ACF45782.1| DNA repair protein RadC [Prosthecochloris aestuarii DSM 271]
          Length = 223

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 58/95 (61%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  N +I  E+ S GT++   ++ REI +  +  SA +II+VHNHPSG+   S+AD  +
Sbjct: 128 LNTKNQIIRHEIISVGTLNASLIHPREIFKEAIRESAHAIIVVHNHPSGDVEASNADKQV 187

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  +    + L I + DH+IIG++ + SF+   ++
Sbjct: 188 TAVLKKAGSLLQIELLDHVIIGRETYFSFREHSLL 222


>gi|210612724|ref|ZP_03289439.1| hypothetical protein CLONEX_01641 [Clostridium nexile DSM 1787]
 gi|210151417|gb|EEA82425.1| hypothetical protein CLONEX_01641 [Clostridium nexile DSM 1787]
          Length = 232

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  + LI +   S+GT++   V  RE+    LE +A SIIL+HNHPSG+P PS  DI
Sbjct: 136 LMLNTKSKLIGETDISKGTVNASLVSPRELFIEALEKNAVSIILMHNHPSGDPTPSKNDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    N + I + DHIIIG + ++SF   R++
Sbjct: 196 LLTKRVTDAGNLIGIELLDHIIIGNNCYISFAEQRLL 232


>gi|114567158|ref|YP_754312.1| DNA repair protein RadC [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317861|sp|Q0AWG3|Y1642_SYNWW RecName: Full=UPF0758 protein Swol_1642
 gi|114338093|gb|ABI68941.1| DNA repair protein RadC [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 235

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+   LI  +  S G +    V+ RE+ +  ++ SA S+ILVHNHPSG+P PS  DI
Sbjct: 139 LYLDRKGGLITMQDISIGGLHSSIVHPREVFKTAVKKSAASMILVHNHPSGDPTPSQEDI 198

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I     + I + DH+IIG+  + S K   +I
Sbjct: 199 EITRRLIEAGKIMGIEILDHVIIGEINYCSLKARGLI 235


>gi|300721251|ref|YP_003710521.1| hypothetical protein XNC1_0176 [Xenorhabdus nematophila ATCC 19061]
 gi|297627738|emb|CBJ88264.1| putative associated with replication fork, DNA repair protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 230

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L   N +I  +   +GTI+ V ++ REIV+  ++++A SIIL HNHPSGNP PS AD 
Sbjct: 134 LCLTNQNKVICHDEMFKGTINKVEIHPREIVKLAVKVNAASIILAHNHPSGNPEPSLADK 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II   + + + V DHI+IGK   VSF     I
Sbjct: 194 VVTEKIIEACDLVGVKVLDHIVIGKQYCVSFMERGWI 230


>gi|310639685|ref|YP_003944443.1| DNA repair protein-like protein [Paenibacillus polymyxa SC2]
 gi|309244635|gb|ADO54202.1| DNA repair protein-like protein [Paenibacillus polymyxa SC2]
          Length = 199

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 54/95 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I  E+ S G+++   ++ RE+    +   + SI+ VHNHPSG+P PS+ DI
Sbjct: 103 LLLNTKNRVIHKEIVSIGSLNATVIHPREVFGAAIRHCSASIVCVHNHPSGDPKPSEQDI 162

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
             T+ +    + + I V DH+IIG+  F S K   
Sbjct: 163 MATKRLAKAGDIIGIDVLDHVIIGESTFYSIKEHG 197


>gi|83814790|ref|YP_446439.1| DNA repair protein RadC [Salinibacter ruber DSM 13855]
 gi|123528135|sp|Q2S042|Y2338_SALRD RecName: Full=UPF0758 protein SRU_2338
 gi|83756184|gb|ABC44297.1| DNA repair protein RadC [Salinibacter ruber DSM 13855]
          Length = 233

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 50/97 (51%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I D   S G +    V  R + ++ +   A ++I +HNHPSGNP PS  DI
Sbjct: 136 VHLNTANVIIGDYTVSEGGLSSSVVEPRGVFEQAILDDAAAVICLHNHPSGNPEPSREDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      + I VHDH+II      S     +I
Sbjct: 196 RITRQLAEAGGTMGIPVHDHLIIAGTKHTSLAERGVI 232


>gi|167037861|ref|YP_001665439.1| DNA repair protein RadC [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167040758|ref|YP_001663743.1| DNA repair protein RadC [Thermoanaerobacter sp. X514]
 gi|166854998|gb|ABY93407.1| DNA repair protein RadC [Thermoanaerobacter sp. X514]
 gi|166856695|gb|ABY95103.1| DNA repair protein RadC [Thermoanaerobacter pseudethanolicus ATCC
           33223]
          Length = 236

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E S++SIILVHNHPSG+P PS  DI
Sbjct: 137 IMLNVKNKVIAIETISIGSLNTSIVHPREVFKAAIERSSSSIILVHNHPSGDPTPSREDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N L I V DH+IIG    +S K    
Sbjct: 197 EVTKRLVEGGNILGIKVLDHVIIGDGRGISLKEKGY 232


>gi|323489982|ref|ZP_08095203.1| DNA repair protein radC-like protein [Planococcus donghaensis
           MPA1U2]
 gi|323396278|gb|EGA89103.1| DNA repair protein radC-like protein [Planococcus donghaensis
           MPA1U2]
          Length = 224

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++  +    G+++   V+ REI +  +  S  SI+  HNHPSGNP PS  DI
Sbjct: 128 LFLNIKNQVMHRQTIFVGSLNASIVHPREIFREAVRRSTASIVCAHNHPSGNPAPSPEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++   + + I + DH+IIG   F+S K    +
Sbjct: 188 EVTKRLVEAGSIIGIELLDHVIIGDHQFISLKEKGFM 224


>gi|158320795|ref|YP_001513302.1| DNA repair protein RadC [Alkaliphilus oremlandii OhILAs]
 gi|172048007|sp|A8MHM4|Y1766_ALKOO RecName: Full=UPF0758 protein Clos_1766
 gi|158140994|gb|ABW19306.1| DNA repair protein RadC [Alkaliphilus oremlandii OhILAs]
          Length = 232

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L   + +IA E  S G+++   V+ RE+  R ++ S+++IIL HNHPSG+PNPS  DI
Sbjct: 136 LLLTTKHDIIAIENISVGSLNASIVHPREVFNRAIKRSSSAIILAHNHPSGDPNPSGEDI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +I   N + I V DHIIIG   + S K  ++I
Sbjct: 196 NITKRLIEAGNIIGISVLDHIIIGDGVYFSMKEHKLI 232


>gi|301060527|ref|ZP_07201367.1| putative DNA repair protein RadC [delta proteobacterium NaphS2]
 gi|300445370|gb|EFK09295.1| putative DNA repair protein RadC [delta proteobacterium NaphS2]
          Length = 243

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           FL + N +I D     G++    VY REI+   LE  A  ++ VHNHPSG+P PS  D +
Sbjct: 134 FLTRKNQVITDCDLFEGSLTGSAVYPREIMTLALEHKAAGLVFVHNHPSGDPAPSPEDQH 193

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T++++     + I V DH+IIG + + SF    +I
Sbjct: 194 LTRDLVWAAMLMGIQVLDHLIIGNNRYFSFADQGVI 229


>gi|71277925|ref|YP_269651.1| DNA repair protein, RadC family protein [Colwellia psychrerythraea
           34H]
 gi|71143665|gb|AAZ24138.1| DNA repair protein, RadC family protein [Colwellia psychrerythraea
           34H]
          Length = 158

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + +I      RGTID   VY RE+V+  L  +A ++IL HNHPSG  +PS AD 
Sbjct: 63  MLLDNQHQMIDFVELFRGTIDASAVYPREVVKTVLLENAAAVILTHNHPSGLNSPSIADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +   L  +++ V DHIIIG+  + SF    ++
Sbjct: 123 DITKRLQEALALIDVRVLDHIIIGEGTY-SFAENGLL 158


>gi|256750969|ref|ZP_05491852.1| DNA repair protein RadC [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914796|ref|ZP_07132112.1| DNA repair protein RadC [Thermoanaerobacter sp. X561]
 gi|307723970|ref|YP_003903721.1| DNA repair protein RadC [Thermoanaerobacter sp. X513]
 gi|320116278|ref|YP_004186437.1| DNA repair protein RadC [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|256750079|gb|EEU63100.1| DNA repair protein RadC [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889731|gb|EFK84877.1| DNA repair protein RadC [Thermoanaerobacter sp. X561]
 gi|307581031|gb|ADN54430.1| DNA repair protein RadC [Thermoanaerobacter sp. X513]
 gi|319929369|gb|ADV80054.1| DNA repair protein RadC [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 226

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E S++SIILVHNHPSG+P PS  DI
Sbjct: 127 IMLNVKNKVIAIETISIGSLNTSIVHPREVFKAAIERSSSSIILVHNHPSGDPTPSREDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++   N L I V DH+IIG    +S K    
Sbjct: 187 EVTKRLVEGGNILGIKVLDHVIIGDGRGISLKEKGY 222


>gi|300853909|ref|YP_003778893.1| DNA repair protein, RadC family [Clostridium ljungdahlii DSM 13528]
 gi|300434024|gb|ADK13791.1| DNA repair protein, RadC family [Clostridium ljungdahlii DSM 13528]
          Length = 230

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  NI+I       G+++   V+ RE+    ++ ++ SII+ HNHPSG+P+PS+ DI
Sbjct: 132 IMLNTKNIVIGIRDVFIGSLNSALVHPREVFYYAIKKNSASIIVCHNHPSGDPSPSNEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           N+T  +      L I + DH+IIG + +VS K   I
Sbjct: 192 NITHRLKECGELLGIQLLDHLIIGNEIYVSLKQKGI 227


>gi|170747019|ref|YP_001753279.1| DNA repair protein RadC [Methylobacterium radiotolerans JCM 2831]
 gi|170653541|gb|ACB22596.1| DNA repair protein RadC [Methylobacterium radiotolerans JCM 2831]
          Length = 248

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 62/97 (63%), Positives = 77/97 (79%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK N LIADEVQ RGT+DH PVY RE+ +R LELSAT+IIL HNHPSG+P PS AD+
Sbjct: 152 LFLDKRNHLIADEVQGRGTVDHTPVYPREVARRALELSATAIILAHNHPSGDPAPSAADV 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I+  L PL I+VHDH+I+G++   S KGL++I
Sbjct: 212 AMTREIVAVLAPLKIVVHDHVILGRNGHASLKGLKLI 248


>gi|21673446|ref|NP_661511.1| DNA repair protein RadC [Chlorobium tepidum TLS]
 gi|30580476|sp|Q8KES1|Y611_CHLTE RecName: Full=UPF0758 protein CT0611
 gi|21646548|gb|AAM71853.1| DNA repair protein RadC [Chlorobium tepidum TLS]
          Length = 222

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   N ++  E  + GT+    ++ REI +  +  SA SIILVHNHPSG+  PS+AD 
Sbjct: 126 LFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +    + L I + DH+I+G + + SF+   ++
Sbjct: 186 QVTSILKKAGDLLQIELLDHVIVGNNDWFSFRDHALL 222


>gi|300113050|ref|YP_003759625.1| DNA repair protein RadC [Nitrosococcus watsonii C-113]
 gi|299538987|gb|ADJ27304.1| DNA repair protein RadC [Nitrosococcus watsonii C-113]
          Length = 224

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++A E   RGTID   V+ RE+++R L  +A + IL HNHPSG   PS AD 
Sbjct: 128 LFLDNQHRVLAFEELFRGTIDGASVHPREVLKRALAHNAAAAILAHNHPSGIAEPSRADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  ++I V DHII+G     SF    +I
Sbjct: 188 CITQRLKEALALVDIRVLDHIIVGDGETFSFAERGLI 224


>gi|310659827|ref|YP_003937548.1| hypothetical protein CLOST_2528 [Clostridium sticklandii DSM 519]
 gi|308826605|emb|CBH22643.1| conserved protein of unknown function [Clostridium sticklandii]
          Length = 159

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 55/92 (59%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  N   +  V S+G+++   V+ RE+ +  +  +A +++L HNHPSGNP PS  DI +
Sbjct: 65  LDTKNQPTSVNVCSKGSLNASLVHPREVFKTAVISNAATVLLAHNHPSGNPEPSKEDIKI 124

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
           T+ +      L I V DH+IIG D++ SFK  
Sbjct: 125 TKRLNEAGKILGIKVLDHLIIGSDSYYSFKEQ 156


>gi|121602861|ref|YP_989118.1| RadC family DNA repair protein [Bartonella bacilliformis KC583]
 gi|120615038|gb|ABM45639.1| DNA repair protein, RadC family [Bartonella bacilliformis KC583]
          Length = 265

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 55/97 (56%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLDK + L++DEVQ  GTID  PVY RE+V R LELSA+ IILVHNHPSG+ +PS  DI
Sbjct: 169 LFLDKKHGLLSDEVQQTGTIDRTPVYPREVVSRALELSASGIILVHNHPSGDASPSQEDI 228

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    N L+I +HDH+II ++ ++SFK L++I
Sbjct: 229 SMTYRLKDVANALDITLHDHLIIARNDYISFKALKLI 265


>gi|157827698|ref|YP_001496762.1| DNA repair protein RadC [Rickettsia bellii OSU 85-389]
 gi|157803002|gb|ABV79725.1| DNA repair protein RadC [Rickettsia bellii OSU 85-389]
          Length = 249

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 56/97 (57%), Positives = 72/97 (74%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+K NILIADEV S+GTID   VY REI++R L   A++IILVHNHPSG+P+PS ADI
Sbjct: 153 LFLNKKNILIADEVLSQGTIDQAAVYPREIIKRALFNEASNIILVHNHPSGSPDPSKADI 212

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I+     +NIIVHDH+II  + + SFK   ++
Sbjct: 213 DMTNIIVDMCKTINIIVHDHVIISNNKYFSFKSNMLL 249


>gi|171912382|ref|ZP_02927852.1| DNA repair protein RadC [Verrucomicrobium spinosum DSM 4136]
          Length = 231

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 5/102 (4%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    L+ DEV  +GT++  P + REI++  L   A + IL HNHPSG+P PS+AD 
Sbjct: 130 LVLNTKLCLVHDEVVFQGTLNESPAHPREIIRAALIHRAHAFILAHNHPSGDPAPSEADR 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDA-----FVSFKGLRII 97
             T+ I      + I + DH++IG        + SFK   +I
Sbjct: 190 RFTRRINEAAQLMQIELLDHVVIGAPRPGAKPYFSFKESGMI 231


>gi|77459227|ref|YP_348734.1| DNA repair protein RadC [Pseudomonas fluorescens Pf0-1]
 gi|77383230|gb|ABA74743.1| putative DNA repair protein [Pseudomonas fluorescens Pf0-1]
          Length = 164

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A EV   G+ID   VY R++V+R L  +A + I VHNHPSG   PS AD 
Sbjct: 68  IFLDARHRVLAFEVLFHGSIDGASVYPRQVVKRSLAHNAAATIFVHNHPSGCTEPSQADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + + V DH I+G+   +S      +
Sbjct: 128 VLTARLKEALALIEVRVLDHFIVGEGRPLSLAEHGWL 164


>gi|304559927|gb|ADM42591.1| DNA repair protein RadC family protein [Edwardsiella tarda FL6-60]
          Length = 161

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E    G+++HV V+ RE+V+  L  +A +++L HNHPSG+P PS AD 
Sbjct: 65  LYLDNLHCLLESETLFAGSVNHVQVHPREVVKSALRFNAAAVVLAHNHPSGDPEPSKADR 124

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I   L  +++   DH+++G+D  VSF     I
Sbjct: 125 QLTDRIKEVLGLVDVKTLDHLVVGQDGIVSFAERGWI 161


>gi|254418550|ref|ZP_05032274.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
 gi|196184727|gb|EDX79703.1| DNA repair protein RadC [Brevundimonas sp. BAL3]
          Length = 205

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 71/97 (73%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+ DE  + GT+DH PVY RE+V+R LELSA+++ILVHNHPSG+P PS ADI
Sbjct: 109 LYLDHRNTLLRDEWVAEGTVDHAPVYPREVVRRALELSASAMILVHNHPSGDPTPSHADI 168

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ ++     L++ VHDH++IG+    SFK L +I
Sbjct: 169 EMTRKVVNAAEALSLKVHDHLVIGRAGTASFKALGLI 205


>gi|224827125|ref|ZP_03700221.1| DNA repair protein RadC [Lutiella nitroferrum 2002]
 gi|224600634|gb|EEG06821.1| DNA repair protein RadC [Lutiella nitroferrum 2002]
          Length = 224

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL   N ++A E    GT+    VY RE+V+R L  +A  +I+ HNHPSG   PS AD 
Sbjct: 128 IFLTAQNRVLAVEEVFSGTLSETRVYPREVVRRALAHNAAGVIVAHNHPSGVAEPSSADR 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +  TL  +++ + DH +I      SF     +
Sbjct: 188 ALTDTLKATLQLVDVRLLDHFVITGSHAESFAERGWL 224


>gi|323527115|ref|YP_004229268.1| DNA repair protein RadC [Burkholderia sp. CCGE1001]
 gi|323384117|gb|ADX56208.1| DNA repair protein RadC [Burkholderia sp. CCGE1001]
          Length = 254

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E  +RGT+  + VY REIV+R L L+A S+I+ HNHPSG   PS +D 
Sbjct: 158 LFLDARHRLIRSEESARGTLTRMAVYPREIVRRALALNAASLIVAHNHPSGAVQPSASDC 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +   L  +++ + DH++IG D+  SF     
Sbjct: 218 RLTRTLREALALIDVQLVDHLVIGADSVYSFARAGW 253


>gi|194336045|ref|YP_002017839.1| DNA repair protein RadC [Pelodictyon phaeoclathratiforme BU-1]
 gi|229470323|sp|B4SF75|Y935_PELPB RecName: Full=UPF0758 protein Ppha_0935
 gi|194308522|gb|ACF43222.1| DNA repair protein RadC [Pelodictyon phaeoclathratiforme BU-1]
          Length = 222

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I  E+ S GT++   ++ RE+ +  ++ S+ +IILVHNHPSG+  PS+AD 
Sbjct: 126 LHLNTKNQIIKTELVSVGTLNAALIHPREVFKSAIKESSHAIILVHNHPSGDVEPSNADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DHIIIGK    SF+   ++
Sbjct: 186 QVTDLLKQASTVIQIDLLDHIIIGKTGCFSFRESGLL 222


>gi|309791140|ref|ZP_07685673.1| DNA repair protein RadC [Oscillochloris trichoides DG6]
 gi|308226838|gb|EFO80533.1| DNA repair protein RadC [Oscillochloris trichoides DG6]
          Length = 236

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 55/95 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +        G+++   + + E+ +  +  ++T+II+VHNHPSG+P PS  DI
Sbjct: 137 VLLDTKNRVQQISTIYVGSVNTAVIRVGEVFRDAVRKNSTAIIMVHNHPSGDPTPSTEDI 196

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ I+     L+I V DH+IIG+  +VS +   
Sbjct: 197 LVTRQIVEAGKLLDIDVLDHLIIGRGRYVSMRERG 231


>gi|228475221|ref|ZP_04059947.1| DNA repair protein RadC [Staphylococcus hominis SK119]
 gi|228270832|gb|EEK12234.1| DNA repair protein RadC [Staphylococcus hominis SK119]
          Length = 225

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 50/96 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  NI+I +E    GT++   ++ RE+    +  S  +II++HNHPSG+  PS  DI
Sbjct: 128 LFLNTKNIVIKEETIFIGTLNSSVIHPREVFNAAIRASCNAIIVIHNHPSGDVTPSKEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T  +      L I + DHIIIG   F S      
Sbjct: 188 ATTIRLKECGQILGIELLDHIIIGDQKFTSLVEEGY 223


>gi|222839521|gb|EEE77858.1| predicted protein [Populus trichocarpa]
          Length = 226

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LIA E   RGT+    VY RE+V R L   A ++IL HNHPSG    S AD 
Sbjct: 130 LFLDSQHRLIALEEMFRGTLTRTSVYPREVVLRALHHHAGAVILAHNHPSGQVQASAADK 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ++   L  ++I V DH+I+   A +S  G  ++
Sbjct: 190 AVTQSLQAALGLVDIQVLDHVIVAPGASLSMAGQGML 226


>gi|270307935|ref|YP_003329993.1| DNA repair protein RadC [Dehalococcoides sp. VS]
 gi|270153827|gb|ACZ61665.1| DNA repair protein RadC [Dehalococcoides sp. VS]
          Length = 228

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI     S G++D   V+ RE+ +  L  SA ++IL HNHPSG+  PS  DI
Sbjct: 132 LMLDVKSRLIKVGHISAGSLDESVVHPREVFKEALSASAATVILAHNHPSGDTEPSPDDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            ++  +    + + I V DHIIIG  +F S K   ++
Sbjct: 192 GLSARLREAGSIMGIEVLDHIIIGGQSFTSLKRQGLL 228


>gi|161523974|ref|YP_001578986.1| DNA repair protein RadC [Burkholderia multivorans ATCC 17616]
 gi|189351265|ref|YP_001946893.1| DNA repair protein RadC [Burkholderia multivorans ATCC 17616]
 gi|160341403|gb|ABX14489.1| DNA repair protein RadC [Burkholderia multivorans ATCC 17616]
 gi|189335287|dbj|BAG44357.1| DNA repair protein [Burkholderia multivorans ATCC 17616]
          Length = 256

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI  E  +RG++  + VY REIV+  + ++A ++I+ HNHPSG   PS  D 
Sbjct: 160 LYLDARHGLIDMEENTRGSLTRMAVYPREIVRSAMRMNAAALIVAHNHPSGAVQPSAEDR 219

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++GK    SF     +
Sbjct: 220 RLTRTLRDALALVDVRLLDHVVVGKADTFSFARAGWL 256


>gi|328954004|ref|YP_004371338.1| DNA repair protein RadC [Desulfobacca acetoxidans DSM 11109]
 gi|328454328|gb|AEB10157.1| DNA repair protein RadC [Desulfobacca acetoxidans DSM 11109]
          Length = 230

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  N +IA+E    GT+D   VY R++++  L+  AT +ILVHNHPSG   PS AD 
Sbjct: 134 IFLNSQNEVIAEETIQEGTVDQTVVYPRKVLEAALKHKATGLILVHNHPSGRLTPSTADR 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ II    PL I VHDH+II K    S     +I
Sbjct: 194 ELTRAIIQAAQPLAITVHDHLIISKQGHYSMAEHHLI 230


>gi|254478306|ref|ZP_05091686.1| DNA repair protein RadC [Carboxydibrachium pacificum DSM 12653]
 gi|214035771|gb|EEB76465.1| DNA repair protein RadC [Carboxydibrachium pacificum DSM 12653]
          Length = 228

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +IA E  S G+++   V+ RE+ +  +E SA+SIILVHNHPSG+P PS  D+
Sbjct: 134 VMLNVKNKIIAIETISIGSLNTSIVHPREVFKAAIERSASSIILVHNHPSGDPTPSRGDV 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ ++   N L I V DH+IIG    +S K   
Sbjct: 194 EVTKRLVEAGNILGIKVLDHVIIGDGRGISLKEKG 228


>gi|21231072|ref|NP_636989.1| RadC family protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66768919|ref|YP_243681.1| RadC family protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|21112702|gb|AAM40913.1| RadC family protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66574251|gb|AAY49661.1| RadC family protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 159

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E    GTID   V+ R + +R L+L+A ++IL HNHPSGNP PS+AD 
Sbjct: 63  VFLDTKHHILATEHLFSGTIDGCDVHPRVVAKRALDLNAVAVILFHNHPSGNPEPSEADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  L+I V DH++IG     S      +
Sbjct: 123 KVTERLKQALALLDIRVLDHLVIGGRQHTSLAARGWV 159


>gi|255262247|ref|ZP_05341589.1| DNA repair protein RadC [Thalassiobium sp. R2A62]
 gi|255104582|gb|EET47256.1| DNA repair protein RadC [Thalassiobium sp. R2A62]
          Length = 190

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/97 (52%), Positives = 73/97 (75%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD+ N LIADE  ++GT+ HVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS++DI
Sbjct: 94  LYLDRKNTLIADEQLAKGTVVHVPVYPREVVKRALELNASALILVHNHPSGDPTPSESDI 153

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  I      L++ +HDH+II K   +SFK   ++
Sbjct: 154 SMTVQIDQAARALDVTLHDHLIISKSRELSFKSEGLL 190


>gi|147669191|ref|YP_001214009.1| DNA repair protein RadC [Dehalococcoides sp. BAV1]
 gi|146270139|gb|ABQ17131.1| DNA replication and repair protein RadC [Dehalococcoides sp. BAV1]
          Length = 228

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI     S G+++   V+ RE+ +  L  SA S+IL HNHPSG+  PS  DI
Sbjct: 132 LMLDVKSRLIRVGHISVGSLEESVVHPREVFKEALSASAASVILAHNHPSGDTEPSHDDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            ++  +      + I V DHIIIG  +F S K   ++
Sbjct: 192 GLSARLREAGGIMGIEVLDHIIIGGQSFTSLKRQGLL 228


>gi|255280930|ref|ZP_05345485.1| DNA repair protein RadC [Bryantella formatexigens DSM 14469]
 gi|255268378|gb|EET61583.1| DNA repair protein RadC [Bryantella formatexigens DSM 14469]
          Length = 231

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 1   LFL---DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSD 57
           +FL   D    L++++  S GT++   V  REI    L   A  +IL+HNHPSGNP PS 
Sbjct: 131 VFLLSFDTKGELLSEKTISVGTVNQSCVSPREIFLEALSCRAVYVILLHNHPSGNPQPSP 190

Query: 58  ADINMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            D  +T  +  +   L I + DHII+G   + SF+    I
Sbjct: 191 EDRLLTMRVHESGKLLEIPLMDHIILGDRRYFSFREEGFI 230


>gi|118580303|ref|YP_901553.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
 gi|118503013|gb|ABK99495.1| DNA repair protein RadC [Pelobacter propionicus DSM 2379]
          Length = 166

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  +  S G+++   V +RE+++  L  SA +I+LVHNHPSG+P PS  DI
Sbjct: 70  LHLDGKNRIVCLDRVSVGSLNQSIVNVREVLKSALLSSAAAILLVHNHPSGDPTPSGEDI 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +  +   + I V DHIIIG   +VSF    ++
Sbjct: 130 AITRRLKESGELICIPVLDHIIIGDGQYVSFVERGLL 166


>gi|314936234|ref|ZP_07843581.1| DNA repair protein RadC [Staphylococcus hominis subsp. hominis C80]
 gi|313654853|gb|EFS18598.1| DNA repair protein RadC [Staphylococcus hominis subsp. hominis C80]
          Length = 228

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 50/96 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  NI+I +E    GT++   ++ RE+    +  S  +II++HNHPSG+  PS  DI
Sbjct: 131 LFLNTKNIVIKEETIFIGTLNSSVIHPREVFNAAIRASCNAIIVIHNHPSGDVTPSKEDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T  +      L I + DHIIIG   F S      
Sbjct: 191 ATTIRLKECGQILGIELLDHIIIGDQKFTSLVEEGY 226


>gi|257066807|ref|YP_003153063.1| DNA repair protein RadC [Anaerococcus prevotii DSM 20548]
 gi|256798687|gb|ACV29342.1| DNA repair protein RadC [Anaerococcus prevotii DSM 20548]
          Length = 228

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 57/95 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N++IA EV S G +    V  RE+ +  ++ SA S+ILVHNHPSGNP PS  D 
Sbjct: 132 ILLDSKNVIIAKEVISIGDLGSTVVNPREVFKPAIKKSAKSMILVHNHPSGNPKPSTEDF 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T  +    + L+I V DHI+IG  ++ SFK   
Sbjct: 192 LITDRLAEAGDILDIKVLDHIVIGNSSYYSFKKEG 226


>gi|206890446|ref|YP_002249007.1| DNA repair protein RadC [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742384|gb|ACI21441.1| DNA repair protein RadC [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 222

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 52/95 (54%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  + LI       GT++H  V+ REI    +   A  II VHNHPSG+  PS  DI +
Sbjct: 125 LDGASNLIQKRTVFIGTLNHSIVHPREIFADAISDRAAGIIFVHNHPSGDSEPSKQDIEI 184

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ ++     L I V DHIII K+ + SF+   ++
Sbjct: 185 TKRLVEIGKMLGIEVIDHIIISKNGYYSFQAEGML 219


>gi|78048960|ref|YP_365135.1| RadC family DNA repair protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037390|emb|CAJ25135.1| RadC family DNA repair protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 187

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E    GTID   V+ R + +R L+L+A ++IL HNHPSGNP PS+AD 
Sbjct: 91  VFLDIKHQILATEHLFFGTIDGCEVHPRVVAKRALDLNAAAVILFHNHPSGNPEPSEADR 150

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +   L+ L+I V DH++IG    +S      
Sbjct: 151 KVTERLQKALSLLDIRVLDHLVIGGRQHISLAARGW 186


>gi|253700088|ref|YP_003021277.1| DNA repair protein RadC [Geobacter sp. M21]
 gi|251774938|gb|ACT17519.1| DNA repair protein RadC [Geobacter sp. M21]
          Length = 167

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N ++  ++ S G+++   V+ RE+ +  L  SA ++IL+HNHP+G+P PS  D+
Sbjct: 72  LHLDGKNRIVCIDMVSTGSLNQSIVHPRELFKTALLSSAAAVILLHNHPTGDPTPSTEDL 131

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +      + I V DHIIIG + + SF    
Sbjct: 132 TITRRLQEAGELIGIRVLDHIIIGDN-YYSFTERG 165


>gi|221211489|ref|ZP_03584468.1| DNA repair protein RadC [Burkholderia multivorans CGD1]
 gi|221168850|gb|EEE01318.1| DNA repair protein RadC [Burkholderia multivorans CGD1]
          Length = 256

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI  E  +RG++  + VY REIV+  + ++A ++I+ HNHPSG   PS  D 
Sbjct: 160 LYLDARHGLIDMEENTRGSLTRMAVYPREIVRSAMRMNAAALIVAHNHPSGAVQPSAEDR 219

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ + DH+++GK    SF     +
Sbjct: 220 RLTRTLRDALALVDVRLLDHVVVGKADTFSFARAGWL 256


>gi|322807326|emb|CBZ04900.1| DNA repair protein RadC [Clostridium botulinum H04402 065]
          Length = 228

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVTYTRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKECGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|222151541|ref|YP_002560697.1| DNA repair protein RadC homolog [Macrococcus caseolyticus JCSC5402]
 gi|222120666|dbj|BAH18001.1| DNA repair protein RadC homolog [Macrococcus caseolyticus JCSC5402]
          Length = 223

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 56/95 (58%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  NI++ +     G+++   V+ RE+ +  ++ SA +II+VHNHPSG+P PS  DI  
Sbjct: 129 LNTKNIVMHESTIFIGSLNASIVHPREVFKEAVKRSAAAIIVVHNHPSGDPEPSYEDIEA 188

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ +I       I V DHIIIG   +VS K   I+
Sbjct: 189 TKRLIKCGEIFGIDVLDHIIIGDGYYVSIKEKGIL 223


>gi|298530828|ref|ZP_07018230.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
 gi|298510202|gb|EFI34106.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
          Length = 160

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D  N +I  +V ++GT+D +PV+ REI++  +   A+ IIL HNHP G   PS  D 
Sbjct: 64  LFVDNKNRMICKKVVAKGTVDQIPVFPREIIRHAILKQASGIILGHNHPGGASEPSKQDR 123

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      L I V DHIII      SF+    +
Sbjct: 124 ELTSKIKRIAMELGIRVLDHIIICDSGHFSFQENGYL 160


>gi|187778415|ref|ZP_02994888.1| hypothetical protein CLOSPO_02009 [Clostridium sporogenes ATCC
           15579]
 gi|187772040|gb|EDU35842.1| hypothetical protein CLOSPO_02009 [Clostridium sporogenes ATCC
           15579]
          Length = 228

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKECGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|289550582|ref|YP_003471486.1| DNA repair protein RadC [Staphylococcus lugdunensis HKU09-01]
 gi|315658077|ref|ZP_07910949.1| DNA repair protein RadC [Staphylococcus lugdunensis M23590]
 gi|289180114|gb|ADC87359.1| DNA repair protein RadC [Staphylococcus lugdunensis HKU09-01]
 gi|315496406|gb|EFU84729.1| DNA repair protein RadC [Staphylococcus lugdunensis M23590]
          Length = 225

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  NI+I +     GT++   ++ REI    L  ++ S+I+VHNHPSG+  PS  DI
Sbjct: 128 LFLDTKNIVIKEHTIFVGTLNSTIIHPREIFAAALRYTSNSLIVVHNHPSGDVTPSSEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  +    + L I + DHIIIG + F S      I
Sbjct: 188 ATTIRLKECGDILGISLLDHIIIGNNKFTSLCDEGYI 224


>gi|253991430|ref|YP_003042786.1| hypothetical protein PAU_03957 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782880|emb|CAQ86045.1| similar putative radc-like protein ykfg of escherichia coli
           [Photorhabdus asymbiotica]
          Length = 156

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E+   GT+ H  V+ RE+V+  L+ +A ++IL HNHPSG  + S  D 
Sbjct: 61  LYLDNQHCLLEREILFTGTLSHTEVHPREVVKLALKYNAAAVILAHNHPSGTTDISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+  L  + + V DH+++G +  VSF    ++
Sbjct: 121 HITQRIVKALALVEVRVLDHLVVG-NEVVSFAEQGLL 156


>gi|229589475|ref|YP_002871594.1| putative DNA repair protein [Pseudomonas fluorescens SBW25]
 gi|229361341|emb|CAY48211.1| putative DNA repair protein [Pseudomonas fluorescens SBW25]
          Length = 164

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A EV   G+ID   VY R++V+R L  +A + I VHNHPSG   PS AD 
Sbjct: 68  IFLDAQHRVLAFEVLFHGSIDGASVYPRQVVKRSLAHNAAAAIFVHNHPSGCTEPSQADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + + V DH I+G+   +S      +
Sbjct: 128 VLTARLKEALALIEVRVMDHFIVGEGRPLSLAEYGWL 164


>gi|330818061|ref|YP_004361766.1| DNA repair protein RadC [Burkholderia gladioli BSR3]
 gi|327370454|gb|AEA61810.1| DNA repair protein RadC [Burkholderia gladioli BSR3]
          Length = 282

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + L+  E  + G++  + VY REIV+R LE  A ++I+ HNHPSG   PS  D 
Sbjct: 186 LYLDAQHRLLELEESTIGSLTRMAVYPREIVRRALESGAAALIVAHNHPSGVVRPSAEDR 245

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ + DHI++G+    SF    ++
Sbjct: 246 RLTQLLRDALALVDVRLTDHIVVGESETFSFAQAGLL 282


>gi|238790648|ref|ZP_04634412.1| DNA repair protein RadC [Yersinia frederiksenii ATCC 33641]
 gi|238721253|gb|EEQ12929.1| DNA repair protein RadC [Yersinia frederiksenii ATCC 33641]
          Length = 194

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI  E  S GT++   VY REIV+  L  +  ++IL HNHPSG P PS+ D 
Sbjct: 98  MHLDNQHRLIHCETASLGTLNQTAVYPREIVKTALYHNTAAVILAHNHPSGIPEPSNYDR 157

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  + T LN +++ V DHI++G+ A VSF     +
Sbjct: 158 QMTDRVRTALNLIDVKVLDHIVLGQGAQVSFAERGWL 194


>gi|293375072|ref|ZP_06621363.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
 gi|292646314|gb|EFF64333.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
          Length = 149

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 51/96 (53%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  N      V S G+++   V+ RE+ +  +  +A S++  HNHPSG+  PSD DI 
Sbjct: 54  CLNTKNEPTNITVVSVGSLNKAIVHPREVFKTAILSNAASVMAFHNHPSGDTTPSDQDIQ 113

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T  ++     L I + DH+IIG  +F S K    +
Sbjct: 114 LTHRLVEAGELLGIKLLDHLIIGDGSFTSLKEKGYL 149


>gi|294670872|ref|ZP_06735728.1| hypothetical protein NEIELOOT_02576 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307359|gb|EFE48602.1| hypothetical protein NEIELOOT_02576 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 224

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L++ N LI     SRGT+    VY+RE+V+  L+  A S+I+ HNHP G   PS +DI
Sbjct: 128 LLLNRQNRLINCVELSRGTVAENTVYVREVVKLALDHYADSLIVAHNHPGGAAEPSPSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  +   L  +++ + DH I+     VS     ++
Sbjct: 188 EWTGRLKQALELVDVRLLDHFIVTARQAVSLAEQGLL 224


>gi|24461706|gb|AAN62275.1|AF440524_62 putative DNA repair protein RadC [Pseudomonas aeruginosa]
          Length = 166

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL   + +IA E   RGTID   ++ R +VQR L  +A+++I  H HPSG   PS +D 
Sbjct: 70  VFLTAKHQVIACETLFRGTIDTAQIHPRVVVQRALLHNASALIAAHQHPSGCSEPSSSDE 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + + L  +++ + DH IIGK    SF    ++
Sbjct: 130 RLTQRLKSALEYVDVRLLDHFIIGKGQPFSFAANALL 166


>gi|84500637|ref|ZP_00998886.1| DNA repair protein [Oceanicola batsensis HTCC2597]
 gi|84391590|gb|EAQ03922.1| DNA repair protein [Oceanicola batsensis HTCC2597]
          Length = 251

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/97 (55%), Positives = 74/97 (76%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N+L+ADE Q+RGT+DHVPVY RE+V+R LEL+A+++ILVHNHPSG+P PS ADI
Sbjct: 155 LFLDRKNVLVADEPQARGTVDHVPVYPREVVKRALELNASALILVHNHPSGDPTPSPADI 214

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MT  +    + L I VHDH++IG+    SF+    +
Sbjct: 215 DMTAQVAAAADALGITVHDHLVIGRATEFSFRAQGYL 251


>gi|218530437|ref|YP_002421253.1| DNA repair protein RadC [Methylobacterium chloromethanicum CM4]
 gi|218522740|gb|ACK83325.1| DNA repair protein RadC [Methylobacterium chloromethanicum CM4]
          Length = 248

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 61/97 (62%), Positives = 79/97 (81%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIADEVQ RGT+DH PVY R + +R LEL++T+IILVHNHPSG+P PS ADI
Sbjct: 152 LFLDRRNHLIADEVQGRGTVDHTPVYPRGVARRALELASTAIILVHNHPSGDPAPSKADI 211

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT+ I++ L+PL I+VHDH+I+G+D   S KGL++I
Sbjct: 212 RMTREIVSVLDPLGIVVHDHVILGRDGHASLKGLKLI 248


>gi|312898568|ref|ZP_07757958.1| putative DNA repair protein RadC [Megasphaera micronuciformis
           F0359]
 gi|310620487|gb|EFQ04057.1| putative DNA repair protein RadC [Megasphaera micronuciformis
           F0359]
          Length = 229

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L++   N LIA    + GT++      R++ +  LE +A ++IL+HNHPSG+P PS  DI
Sbjct: 133 LYVSSKNKLIALRELTSGTLNESLAKARDVFRYALEYNAAAVILIHNHPSGDPTPSKEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             TQ I      + I V DHIIIG   +VS      I
Sbjct: 193 KATQCIAEAGRVMGIPVLDHIIIGDGTYVSLCERGYI 229


>gi|127512189|ref|YP_001093386.1| DNA repair protein RadC [Shewanella loihica PV-4]
 gi|126637484|gb|ABO23127.1| DNA repair protein RadC [Shewanella loihica PV-4]
          Length = 157

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI       GTID   VY RE+V+  L  +A ++IL HNHPSG   PS AD 
Sbjct: 62  MMLDSQHRLIEFNEMFFGTIDAANVYPREVVKAVLLCNAAAVILAHNHPSGCAEPSAADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L+ +++ V DHI++G    VSF     +
Sbjct: 122 RITERLINALSTIDVPVLDHIVVGD-QCVSFAERGWL 157


>gi|157150253|ref|YP_001450516.1| DNA repair protein RadC [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|229485564|sp|A8AXK6|Y1229_STRGC RecName: Full=UPF0758 protein SGO_1229
 gi|157075047|gb|ABV09730.1| DNA repair protein [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 226

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 52/94 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G++       REI+   ++  ATSIILVHNHPSG   PS  D 
Sbjct: 129 LYLNTQNQIIHQQTIFIGSLTRSLAEPREILHYAIKHMATSIILVHNHPSGATRPSRDDD 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I      +  ++ DH+I+G D++ S++  
Sbjct: 189 QVTEKIKEACEMMGFVLLDHLIVGGDSYYSYREE 222


>gi|317403649|gb|EFV84137.1| hypothetical protein HMPREF0005_02879 [Achromobacter xylosoxidans
           C54]
          Length = 149

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF+D    L++ E    GT+D  PVY RE+ +R L L+A ++++ HNHPSGN  PS+ADI
Sbjct: 52  LFMDSQLRLLSAEPLFYGTLDQAPVYPREVARRALMLNAAALVIAHNHPSGNHTPSNADI 111

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT ++   L   +I + DH ++G     SF  L ++
Sbjct: 112 RMTTSLREALGLFDIRLLDHFVVGAGKMTSFAELGLM 148


>gi|326791184|ref|YP_004309005.1| DNA repair protein RadC [Clostridium lentocellum DSM 5427]
 gi|326541948|gb|ADZ83807.1| DNA repair protein RadC [Clostridium lentocellum DSM 5427]
          Length = 234

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 56/96 (58%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            LD    +I  E  S+G++    V+ RE+ +  ++ SA SII VHNHPSG+P PS+ D+ 
Sbjct: 139 LLDAKCKMIGYETVSKGSLTASIVHPREVYRIAIQKSAHSIIAVHNHPSGDPTPSEEDLQ 198

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           MT+ +    + + I + DHIIIG   + SFK    +
Sbjct: 199 MTKRLQKVGDLVGIPLLDHIIIGDGIYKSFKEESYL 234


>gi|170025352|ref|YP_001721857.1| DNA repair protein RadC [Yersinia pseudotuberculosis YPIII]
 gi|169751886|gb|ACA69404.1| DNA repair protein RadC [Yersinia pseudotuberculosis YPIII]
          Length = 156

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E    G+I H  V+ RE+V+  L  +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLGHEALFTGSISHTEVHPRELVKAALRHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++TQ I+  L  + + V DH+++G +  VSF    ++
Sbjct: 121 HITQRIVKALALVEVRVLDHLVVG-NEVVSFAEQGLL 156


>gi|148380954|ref|YP_001255495.1| DNA repair protein, RadC family [Clostridium botulinum A str. ATCC
           3502]
 gi|153933543|ref|YP_001385323.1| DNA repair protein RadC [Clostridium botulinum A str. ATCC 19397]
 gi|153937584|ref|YP_001388731.1| DNA repair protein RadC [Clostridium botulinum A str. Hall]
 gi|168181688|ref|ZP_02616352.1| DNA repair protein, RadC family [Clostridium botulinum Bf]
 gi|237796455|ref|YP_002864007.1| DNA repair protein, RadC family [Clostridium botulinum Ba4 str.
           657]
 gi|166218776|sp|A7FXW3|Y3028_CLOB1 RecName: Full=UPF0758 protein CLB_3028
 gi|166218777|sp|A5I683|Y3003_CLOBH RecName: Full=UPF0758 protein CBO3003/CLC_2900
 gi|259551858|sp|C3L3L0|Y3261_CLOB6 RecName: Full=UPF0758 protein CLJ_B3261
 gi|148290438|emb|CAL84565.1| DNA repair protein [Clostridium botulinum A str. ATCC 3502]
 gi|152929587|gb|ABS35087.1| DNA repair protein, RadC family [Clostridium botulinum A str. ATCC
           19397]
 gi|152933498|gb|ABS38997.1| DNA repair protein, RadC family [Clostridium botulinum A str. Hall]
 gi|182675184|gb|EDT87145.1| DNA repair protein, RadC family [Clostridium botulinum Bf]
 gi|229264193|gb|ACQ55226.1| DNA repair protein, RadC family [Clostridium botulinum Ba4 str.
           657]
          Length = 228

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKECGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|238916926|ref|YP_002930443.1| DNA repair protein RadC [Eubacterium eligens ATCC 27750]
 gi|238872286|gb|ACR71996.1| DNA repair protein RadC [Eubacterium eligens ATCC 27750]
          Length = 230

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 62/97 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD    LI D+V S GT     V +REI +  L+  A S++L+HNHPSGNP+PS  D+
Sbjct: 133 VMLDNRCRLIRDKVLSVGTSTGSMVSVREIFKEALDNRAASVVLLHNHPSGNPSPSREDM 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++++     + I + DHI+IG +++ SFK ++ I
Sbjct: 193 KVTRSVMEAGKIIGIELLDHIVIGDNSYFSFKQMQYI 229


>gi|158430296|pdb|2QLC|A Chain A, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430297|pdb|2QLC|B Chain B, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430298|pdb|2QLC|C Chain C, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430299|pdb|2QLC|D Chain D, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430300|pdb|2QLC|E Chain E, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430301|pdb|2QLC|F Chain F, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430302|pdb|2QLC|G Chain G, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
 gi|158430303|pdb|2QLC|H Chain H, The Crystal Structure Of Dna Repair Protein Radc From
           Chlorobium Tepidum Tls
          Length = 126

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   N ++  E  + GT+    ++ REI +  +  SA SIILVHNHPSG+  PS+AD 
Sbjct: 30  LFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADK 89

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +    + L I + DH+I+G + + SF+   ++
Sbjct: 90  QVTSILKKAGDLLQIELLDHVIVGNNDWFSFRDHALL 126


>gi|126653704|ref|ZP_01725623.1| DNA repair protein RadC [Bacillus sp. B14905]
 gi|126589741|gb|EAZ83876.1| DNA repair protein RadC [Bacillus sp. B14905]
          Length = 223

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +I  +    G+++   V+ REI +  ++ SA SII  HNHPSG P PS  DI
Sbjct: 127 LFLNIKNQIIHRQTIFIGSLNASIVHPREIFREAVKRSAASIICAHNHPSGVPTPSAEDI 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I      + I + DH+IIG   F+S K    
Sbjct: 187 DVTKRIEEAGYIMGIELIDHVIIGDHQFISLKEKGY 222


>gi|168179493|ref|ZP_02614157.1| DNA repair protein, RadC family [Clostridium botulinum NCTC 2916]
 gi|170755607|ref|YP_001782636.1| DNA repair protein RadC [Clostridium botulinum B1 str. Okra]
 gi|226950427|ref|YP_002805518.1| DNA repair protein RadC [Clostridium botulinum A2 str. Kyoto]
 gi|229485548|sp|B1IM02|Y1541_CLOBK RecName: Full=UPF0758 protein CLD_1541
 gi|254764432|sp|C1FVY2|Y3399_CLOBJ RecName: Full=UPF0758 protein CLM_3399
 gi|169120819|gb|ACA44655.1| DNA repair protein, RadC family [Clostridium botulinum B1 str.
           Okra]
 gi|182669777|gb|EDT81753.1| DNA repair protein, RadC family [Clostridium botulinum NCTC 2916]
 gi|226842668|gb|ACO85334.1| DNA repair protein, RadC family [Clostridium botulinum A2 str.
           Kyoto]
          Length = 228

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKECGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|295677432|ref|YP_003605956.1| DNA repair protein RadC [Burkholderia sp. CCGE1002]
 gi|295437275|gb|ADG16445.1| DNA repair protein RadC [Burkholderia sp. CCGE1002]
          Length = 303

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 58/96 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E  +RG++  + VY REIV+R L  +A S+I+ HNHPSG   PS +D 
Sbjct: 180 LFLDARHRLIRCEESARGSLTRMAVYPREIVRRALAANAASLIVAHNHPSGAVEPSASDC 239

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ +   L  +++ + DH++IG D+  SF     
Sbjct: 240 RLTQTLRDALALVDVQLIDHLVIGADSVYSFARAGW 275


>gi|24373030|ref|NP_717072.1| RadC family DNA repair protein [Shewanella oneidensis MR-1]
 gi|24347195|gb|AAN54517.1|AE015589_12 DNA repair protein, RadC family [Shewanella oneidensis MR-1]
          Length = 157

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + LI       GTID   VY RE+V+  L  +A ++I  HNHPSG   PS AD 
Sbjct: 62  MMLDSQHRLIEFNEMFFGTIDSASVYPREVVKAVLLCNAAAVIFAHNHPSGCAEPSSADR 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +I  L  +++ V DHI++     VSF    ++
Sbjct: 122 RITERLIAALATIDVPVLDHIVVAD-TCVSFAERGLL 157


>gi|330428834|gb|AEC20168.1| DNA repair protein RadC [Pusillimonas sp. T7-7]
          Length = 225

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD    LI  E  SRGT+    VY REI++  L+  A ++IL HNHPSG   PS+AD+
Sbjct: 129 LYLDSQLRLITTEEISRGTLSQTSVYPREIIKSGLKHHAAALILAHNHPSGVAEPSEADL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+++   L  ++I + DH+II     VS      I
Sbjct: 189 ALTRHLKHALALVDIRLLDHLIITGTGAVSLAERGQI 225


>gi|163849132|ref|YP_001637176.1| DNA repair protein RadC [Chloroflexus aurantiacus J-10-fl]
 gi|222527106|ref|YP_002571577.1| DNA repair protein RadC [Chloroflexus sp. Y-400-fl]
 gi|189029391|sp|A9WAJ7|Y3603_CHLAA RecName: Full=UPF0758 protein Caur_3603
 gi|254764431|sp|B9LEQ9|Y3887_CHLSY RecName: Full=UPF0758 protein Chy400_3887
 gi|163670421|gb|ABY36787.1| DNA repair protein RadC [Chloroflexus aurantiacus J-10-fl]
 gi|222450985|gb|ACM55251.1| DNA repair protein RadC [Chloroflexus sp. Y-400-fl]
          Length = 229

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 54/96 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +        G+++   V + E+ +  +  ++ +II+VHNHPSG P PS  DI
Sbjct: 131 ILLDTKNRVQQITTVYIGSLNSANVRVGEVFKEAVRRNSAAIIVVHNHPSGEPTPSMEDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ +++    L+I V DH+IIG   +VS +   +
Sbjct: 191 EITRQLVSAGRLLDIEVVDHLIIGNGRYVSLRERGL 226


>gi|221135334|ref|ZP_03561637.1| DNA repair protein RadC [Glaciecola sp. HTCC2999]
          Length = 213

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 55/96 (57%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  +  +  +    GTI+   VY REIV+  L+ +A ++IL HNHPSG P PS ADI 
Sbjct: 117 LLNNQHEFLHYKELFSGTINAASVYPREIVKYALDYNAANVILAHNHPSGTPEPSQADIA 176

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +TQ I   L+ +++ V DHI++G    VS      +
Sbjct: 177 ITQRIRQALDLIDVQVLDHIVVGAGNAVSLAQRGCL 212


>gi|158929981|gb|ABW82962.1| DNA repair protein [uncultured bacterium pEAF66]
          Length = 224

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N L++ +   RGT+ H  VY RE+V+  L  +A S++L HNHPSG P PS+AD+
Sbjct: 128 LFLDVKNRLLSSQEMFRGTLTHTSVYPREVVKAALARNAASVLLAHNHPSGAPEPSEADL 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++++  L  +++ V DH ++      SF     +
Sbjct: 188 ILTRSLVQALALVDVRVLDHFVVAGPHVHSFAEHGQL 224


>gi|88803500|ref|ZP_01119025.1| putative DNA repair protein [Polaribacter irgensii 23-P]
 gi|88780512|gb|EAR11692.1| putative DNA repair protein [Polaribacter irgensii 23-P]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++L+  N ++A    S+G +    V +R + +R LEL++  II+ HNHPSG   PS AD 
Sbjct: 132 IYLNNSNKVVAKGQISKGGLTATLVDVRLVFKRALELASVGIIVCHNHPSGKLQPSAADK 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I      L+I + DH+II + A+ SF    ++
Sbjct: 192 QLTLKIKEAGITLDIKLLDHLIITEKAYFSFADEGLL 228


>gi|311277441|ref|YP_003939672.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
 gi|308746636|gb|ADO46388.1| DNA repair protein RadC [Enterobacter cloacae SCF1]
          Length = 221

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++       GT+ HV V+ REIV+  ++ +A ++IL HNHPSG+  PS +D 
Sbjct: 125 IFLDNQNRVLKHTRMFAGTLSHVEVHPREIVREAIKANAAALILAHNHPSGSAAPSRSDR 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +I     + I V DH +IG+    SF     I
Sbjct: 185 MVTDKVIKCCQFMEIRVVDHFVIGRGESFSFAEHGWI 221


>gi|289432459|ref|YP_003462332.1| DNA repair protein RadC [Dehalococcoides sp. GT]
 gi|288946179|gb|ADC73876.1| DNA repair protein RadC [Dehalococcoides sp. GT]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI     S G+++   V+ RE+ +  L  SA+S+IL HNHPSG+  PS  DI
Sbjct: 132 LMLDVKSRLIRVGHISVGSLEASVVHPREVFKEALSASASSVILAHNHPSGDTEPSHDDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            ++  +      + I V DHIIIG  +F S K   ++
Sbjct: 192 GLSARLREAGGIMGIEVLDHIIIGGQSFTSLKRQGLL 228


>gi|309795803|ref|ZP_07690218.1| DNA repair protein RadC family protein [Escherichia coli MS 145-7]
 gi|308120682|gb|EFO57944.1| DNA repair protein RadC family protein [Escherichia coli MS 145-7]
          Length = 156

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E+   GT+ H  V+ RE+V+  L+ +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLEREILFIGTLSHTEVHPREVVKSALKHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +MTQ I+  L  + + V DH+++G +  +SF  L ++
Sbjct: 121 HMTQRIVKALALVEVRVLDHLVVG-NETISFAELGLL 156


>gi|312961083|ref|ZP_07775588.1| DNA repair protein RadC [Pseudomonas fluorescens WH6]
 gi|311284741|gb|EFQ63317.1| DNA repair protein RadC [Pseudomonas fluorescens WH6]
          Length = 164

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A EV   G+ID   VY R++++R L  +A + I VHNHPSG   PS AD 
Sbjct: 68  IFLDARHRVLAFEVLFHGSIDGASVYPRQVIKRSLVHNAAAAIFVHNHPSGCTEPSQADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  + + V DH I+G+   +S      +
Sbjct: 128 VLTARLKEALALIEVRVLDHFIVGEGRPLSLAEHGWL 164


>gi|254517357|ref|ZP_05129414.1| DNA repair protein RadC [gamma proteobacterium NOR5-3]
 gi|219674195|gb|EED30564.1| DNA repair protein RadC [gamma proteobacterium NOR5-3]
          Length = 177

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   +  I+ E+Q RG+ID   VY R IV+RCLEL+A ++ILVHNHPSG   PS AD 
Sbjct: 81  LFLTAQHHAISFEIQFRGSIDGAAVYPRVIVRRCLELNAAAVILVHNHPSGVSEPSPADR 140

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  +++ V DH+I+      SF    ++
Sbjct: 141 QITVRLQRALELIDVRVVDHLIVSAGDATSFAQAGLL 177


>gi|86143951|ref|ZP_01062319.1| putative DNA repair protein [Leeuwenhoekiella blandensis MED217]
 gi|85829658|gb|EAQ48121.1| putative DNA repair protein [Leeuwenhoekiella blandensis MED217]
          Length = 232

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++     S+G +    V +R +++  LE  A S+IL HNHPSG   PS AD 
Sbjct: 136 LYLNNSNKVLHKHQLSKGGMTGTLVDVRLVLKLALERGAVSLILAHNHPSGGLRPSQADK 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +      L+I V DH+II ++++ SF    ++
Sbjct: 196 DITTKLKVAAASLDIKVLDHLIITENSYFSFADEGLL 232


>gi|307313278|ref|ZP_07592903.1| DNA repair protein RadC [Escherichia coli W]
 gi|306906961|gb|EFN37470.1| DNA repair protein RadC [Escherichia coli W]
 gi|315062961|gb|ADT77288.1| conserved hypothetical protein [Escherichia coli W]
 gi|323376447|gb|ADX48715.1| DNA repair protein RadC [Escherichia coli KO11]
          Length = 156

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  + L+  E    GT+ H  V+ RE+V+  L+ +A ++IL HNHPSG    S  D 
Sbjct: 61  MYLDNQHCLLERETLFTGTLSHTEVHPREVVKSALKHNAAAVILAHNHPSGTTEISQQDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I   L  + + V DH+++GK   VSF    ++
Sbjct: 121 YVTQRIAKALALVEVRVLDHLVVGK-EVVSFAECGLL 156


>gi|310658699|ref|YP_003936420.1| DNA repair protein RadC-like protein [Clostridium sticklandii DSM
           519]
 gi|308825477|emb|CBH21515.1| DNA repair protein radC homolog [Clostridium sticklandii]
          Length = 228

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I  +  S G+++   V+ RE+    ++ SA  +IL+HNHPSG+P PS  DI
Sbjct: 132 VLLNTKNVIIGSKDISEGSLNASIVHPREVFLEAIKKSANKMILMHNHPSGDPTPSSEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ +I+    + I + DH+IIG   F SFK    I
Sbjct: 192 NITKRLISAGQIVGIEILDHVIIGDGNFYSFKENGQI 228


>gi|46579604|ref|YP_010412.1| DNA repair protein RadC [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602908|ref|YP_967308.1| DNA repair protein RadC [Desulfovibrio vulgaris DP4]
 gi|46449019|gb|AAS95671.1| DNA repair protein RadC [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563137|gb|ABM28881.1| DNA repair protein RadC [Desulfovibrio vulgaris DP4]
 gi|311233408|gb|ADP86262.1| DNA repair protein RadC [Desulfovibrio vulgaris RCH1]
          Length = 225

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 56/96 (58%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            LD  N LIA E  ++GT++   +Y R++++  L  SA+ IILVHNHP GNP PS  D  
Sbjct: 130 LLDNQNRLIAWERATKGTVNASVIYPRDVLEMALRCSASGIILVHNHPGGNPVPSQPDFE 189

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ +  +   L I + DH+I+  +   S K   ++
Sbjct: 190 VTRQLSRSALTLGIRLLDHVIVTDEDCYSLKEDGLL 225


>gi|332170536|gb|AEE19791.1| DNA repair protein RadC [Krokinobacter diaphorus 4H-3-7-5]
          Length = 237

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N ++  E  S+G +    V +R +++  +ELSA  +IL HNHPSG   PS AD 
Sbjct: 141 LFLNNSNKVLRKEQVSKGGLTGTLVDVRLVMKTAIELSAVGMILGHNHPSGTLKPSQADK 200

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + T    L+I V DHII+ +  + SF    I+
Sbjct: 201 LLTAKLKTAAQSLDIQVLDHIIVTEKQYFSFADDGIL 237


>gi|291559003|emb|CBL37803.1| DNA replication and repair protein RadC [butyrate-producing
           bacterium SSC/2]
          Length = 242

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F +  N +I +   S GT++      RE+    L   A S++++HNHPSG+P PS  DI
Sbjct: 146 IFFNGKNKVIKELTVSVGTVNQTVASPRELFLEALRCEAVSVLMIHNHPSGDPTPSRQDI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ +      L I + DHIIIG   ++SF+   ++
Sbjct: 206 LTTKRMKEAGEFLGIPLCDHIIIGDQTYLSFREEHMM 242


>gi|262282816|ref|ZP_06060583.1| DNA repair protein RadC [Streptococcus sp. 2_1_36FAA]
 gi|262261068|gb|EEY79767.1| DNA repair protein RadC [Streptococcus sp. 2_1_36FAA]
          Length = 226

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 52/94 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  +    G++       REI+   ++  ATSIILVHNHPSG   PS  D 
Sbjct: 129 LYLNTQNQIIHQQTIFIGSLTRSLAEPREILHYAIKHMATSIILVHNHPSGATRPSRDDD 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I      +  ++ DH+I+G D++ S++  
Sbjct: 189 QVTEKIKEACEMMGFVLLDHLIVGGDSYYSYREE 222


>gi|153814880|ref|ZP_01967548.1| hypothetical protein RUMTOR_01095 [Ruminococcus torques ATCC 27756]
 gi|317500393|ref|ZP_07958617.1| DNA repair protein RadC [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089600|ref|ZP_08338499.1| hypothetical protein HMPREF1025_02082 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847911|gb|EDK24829.1| hypothetical protein RUMTOR_01095 [Ruminococcus torques ATCC 27756]
 gi|316898148|gb|EFV20195.1| DNA repair protein RadC [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330404968|gb|EGG84506.1| hypothetical protein HMPREF1025_02082 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 233

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/96 (39%), Positives = 52/96 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+    LI +   S GTID   V  RE+     + +A  IIL+HNHP G+P PS  D+
Sbjct: 135 IFLNTRCRLIGECNVSEGTIDSALVSPRELFIEAFKRNAYGIILLHNHPGGDPTPSREDV 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ I      L I + DHI+IG + FVS K    
Sbjct: 195 MITRRIYEAGELLGIRLFDHIVIGDNCFVSMKEKGF 230


>gi|311104314|ref|YP_003977167.1| DNA repair protein RadC 1 [Achromobacter xylosoxidans A8]
 gi|310759003|gb|ADP14452.1| DNA repair protein RadC 1 [Achromobacter xylosoxidans A8]
          Length = 164

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R + QR LEL+A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPLFRGTINSTSVYPRVVAQRVLELNAAAVVFSHQHPSGISEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+ A  SF    ++
Sbjct: 128 MLTQQLQVALALIDVRVLDHIIVGQGAPFSFAESGLL 164


>gi|89098269|ref|ZP_01171154.1| hypothetical protein B14911_10922 [Bacillus sp. NRRL B-14911]
 gi|89087126|gb|EAR66242.1| hypothetical protein B14911_10922 [Bacillus sp. NRRL B-14911]
          Length = 228

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 54/95 (56%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           LD  + LI+ +   +GTID   V+ RE+ +  L  SA  II+ H HPSGN +PS  DI +
Sbjct: 134 LDTKHQLISRKEIYKGTIDAAIVHPREVFRFALNKSAAHIIVAHQHPSGNCSPSRDDIEV 193

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ +      + I + DHII+G++ + S K    +
Sbjct: 194 TKRLRKVGEEIGIPLSDHIIVGRNKYFSMKKQGHL 228


>gi|170758657|ref|YP_001788315.1| DNA repair protein RadC [Clostridium botulinum A3 str. Loch Maree]
 gi|229485549|sp|B1KZT0|Y2387_CLOBM RecName: Full=UPF0758 protein CLK_2387
 gi|169405646|gb|ACA54057.1| DNA repair protein, RadC family [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 228

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVTYIRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKKCGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|257465859|ref|ZP_05630170.1| DNA repair protein radC [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917016|ref|ZP_07913256.1| DNA repair protein radC [Fusobacterium gonidiaformans ATCC 25563]
 gi|313690891|gb|EFS27726.1| DNA repair protein radC [Fusobacterium gonidiaformans ATCC 25563]
          Length = 227

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N L+  E   +G+ID   VY REI+++ L+  A S+I  HNHPSGN  PS  DI
Sbjct: 131 LFLNTANQLLCSEELFQGSIDRSAVYPREILEKVLKYKAKSVIFAHNHPSGNTQPSRQDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L   ++++ +HII+ K ++ SF    ++
Sbjct: 191 ALTKEMKDALRMFDVLLIEHIIVSKHSYFSFLEEGLL 227


>gi|209517442|ref|ZP_03266283.1| DNA repair protein RadC [Burkholderia sp. H160]
 gi|209502096|gb|EEA02111.1| DNA repair protein RadC [Burkholderia sp. H160]
          Length = 283

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E  +RG++  + VY REIV+R L  +A S+I+ HNHPSG   PS AD 
Sbjct: 180 LFLDARHRLIRCEESARGSLTRMAVYPREIVRRALAANAASLIVAHNHPSGAVEPSAADC 239

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++TQ +   L  +++ + DH++IG D+  SF     
Sbjct: 240 HLTQTLRDALALVDVQLIDHLVIGADSVYSFARAGW 275


>gi|293374806|ref|ZP_06621110.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
 gi|292646564|gb|EFF64570.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
          Length = 149

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 47/96 (48%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  N      V S GT++   V+ RE+ +  +  +A SI+  HNHPSG   PS  DI 
Sbjct: 54  CLNTKNEPTNISVVSVGTLNKAIVHPREVFKTAILSNAASIMAFHNHPSGETTPSQQDIQ 113

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T  +      L I + DH+IIG   F S K    +
Sbjct: 114 LTNRLYEAGELLGIKLLDHLIIGDGTFTSLKEKGYL 149


>gi|193212294|ref|YP_001998247.1| DNA repair protein RadC [Chlorobaculum parvum NCIB 8327]
 gi|229485546|sp|B3QM94|Y627_CHLP8 RecName: Full=UPF0758 protein Cpar_0627
 gi|193085771|gb|ACF11047.1| DNA repair protein RadC [Chlorobaculum parvum NCIB 8327]
          Length = 222

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N +++ E  + GT+    ++ REI +  +  SA SIILVHNHPSG+  PS+AD 
Sbjct: 126 LFLNTKNRILSHESVTVGTLTSSLIHPREIFKAAIRQSAHSIILVHNHPSGDVQPSNADK 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +  + + L I + DH+I+G D + SF+   ++
Sbjct: 186 QVTSILKKSGDLLQIALLDHVIVGNDDWFSFRDHSLL 222


>gi|257452349|ref|ZP_05617648.1| DNA repair protein radC [Fusobacterium sp. 3_1_5R]
 gi|317058892|ref|ZP_07923377.1| DNA repair protein radC [Fusobacterium sp. 3_1_5R]
 gi|313684568|gb|EFS21403.1| DNA repair protein radC [Fusobacterium sp. 3_1_5R]
          Length = 227

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N L+  E   +G+ID   VY REI+++ L+  A S+I  HNHPSGN  PS  DI
Sbjct: 131 LFLNTANQLLCSEELFQGSIDRSAVYPREILEKVLKYKAKSVIFAHNHPSGNTQPSRQDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L   ++++ +HII+ K ++ SF    ++
Sbjct: 191 ALTKEMKDALRMFDVLLIEHIIVSKHSYFSFLEEGLL 227


>gi|153853159|ref|ZP_01994568.1| hypothetical protein DORLON_00553 [Dorea longicatena DSM 13814]
 gi|149753945|gb|EDM63876.1| hypothetical protein DORLON_00553 [Dorea longicatena DSM 13814]
          Length = 230

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    L+ +   S+GT++   +  RE+    L+ +A SII++HNHPSG+P PS  D+
Sbjct: 134 LMLNSKAKLLGETNISKGTVNASLITPRELFIEALQKNAVSIIILHNHPSGDPTPSREDM 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I+     + I + DHIIIG + ++SF+   ++
Sbjct: 194 LTTKRILDAGALIGIDLLDHIIIGNNCYMSFREEGML 230


>gi|78047921|ref|YP_364096.1| RadC family DNA repair protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78036351|emb|CAJ24042.1| RadC family DNA repair protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 164

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + ++A E   +GTI    V+ R I+QR LEL+A ++I  H HPSG   PS AD 
Sbjct: 68  VFLNNKHEVLAYEPMFKGTIHSATVHARPIMQRALELNAAAVIFSHQHPSGCTEPSSADC 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ + T L  +++ V DH+I+G+    SF    ++
Sbjct: 128 AITQTLKTALALIDVRVLDHLIVGQGTPYSFAESDML 164


>gi|15606726|ref|NP_214106.1| DNA repair protein RadC [Aquifex aeolicus VF5]
 gi|6685835|sp|O67541|Y1610_AQUAE RecName: Full=UPF0758 protein aq_1610
 gi|2983952|gb|AAC07500.1| DNA repair protein RadC [Aquifex aeolicus VF5]
          Length = 231

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N L+  EV + G ++ V    ++I+ + ++LSA  II+ HNHP G P+PS+ D+
Sbjct: 135 LYLDLSNRLLDWEVVAIGNVNTVFSKPKDILFKAVKLSANGIIIAHNHPQGEPSPSNEDL 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N T+ +      L   + DH+I+ +  + SF+   ++
Sbjct: 195 NFTERLKKACELLGFELLDHLILSEGRYFSFREEGVL 231


>gi|298529740|ref|ZP_07017143.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511176|gb|EFI35079.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
          Length = 238

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + +D  N LI  E  SRGT+D  PV+ REI+   LE  A+ +IL+HNHP G+P+PS  D 
Sbjct: 142 IMVDNKNRLIDFEKMSRGTVDQAPVFPREILTVALEKRASGVILLHNHPGGDPHPSFQDR 201

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      L + + DH+II +D+F SF+    +
Sbjct: 202 ELTRKIREVSTALGVRLLDHVIISEDSFFSFQEHGFL 238


>gi|293375077|ref|ZP_06621368.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
 gi|292646319|gb|EFF64338.1| DNA repair protein RadC family protein [Turicibacter sanguinis
           PC909]
          Length = 149

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 49/96 (51%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  N      + S G+++   V+ RE+ +  +  +A SI+  HNHPSG   PS  DI 
Sbjct: 54  CLNTKNEPTNITLVSVGSLNKAIVHPREVFKTAILSNAASIMAFHNHPSGETTPSQQDIQ 113

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T+ +      L I + DH+IIG  +F S K    +
Sbjct: 114 LTKRLYEAGELLGIKLLDHLIIGDGSFTSLKEKGYL 149


>gi|257481766|ref|ZP_05635807.1| DNA repair protein RadC [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 219

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/91 (38%), Positives = 58/91 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + ++  E+  RGTI+   V+ R++V+R +  +A S+IL HNHPSG   PS +DI
Sbjct: 128 LFLDNKHRVMTFEILFRGTINASYVHPRQVVKRAMAHNAASLILCHNHPSGITTPSRSDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSF 91
           ++T+ +   L  +++ V DH+I+G    +S 
Sbjct: 188 DLTKRLKEALMLVDVHVLDHVIVGDGEPLSM 218


>gi|242278123|ref|YP_002990252.1| DNA repair protein RadC [Desulfovibrio salexigens DSM 2638]
 gi|242121017|gb|ACS78713.1| DNA repair protein RadC [Desulfovibrio salexigens DSM 2638]
          Length = 225

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 50/94 (53%)

Query: 4   DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMT 63
           +  N +I  E  S GT+D   VY RE+V   L  +A+ +IL HNHP G+P+PS  D   T
Sbjct: 132 NNRNKVICWERLSEGTVDKTAVYPREVVALALRHNASGVILTHNHPGGDPSPSPEDTERT 191

Query: 64  QNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             I      + I + DH+I+  D F SFK    +
Sbjct: 192 MEIAALCQDMEIRLLDHVIVTADRFHSFKEAGYL 225


>gi|169335849|ref|ZP_02863042.1| hypothetical protein ANASTE_02275 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258587|gb|EDS72553.1| hypothetical protein ANASTE_02275 [Anaerofustis stercorihominis DSM
           17244]
          Length = 224

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I  E+ S GTI+   V++RE+ +  ++ +A SIIL HNHPSG+  PS  D 
Sbjct: 128 ILLNTKNMVIETELISIGTINTSLVHVREVFRNAIKKNANSIILAHNHPSGDSTPSIEDE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I V DH+IIGKD + SF    ++
Sbjct: 188 HLTKRLKDAGELIGIKVIDHVIIGKDNYFSFMEENML 224


>gi|238791279|ref|ZP_04634918.1| DNA repair protein [Yersinia intermedia ATCC 29909]
 gi|238729412|gb|EEQ20927.1| DNA repair protein [Yersinia intermedia ATCC 29909]
          Length = 152

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + ++A E   RGT++ V +Y REIV+  L  +A +IILVHNHPSG P PS AD 
Sbjct: 56  LLLDNQHRILAYEELFRGTLNAVSIYPREIVKLSLRYNAGAIILVHNHPSGEPEPSHADK 115

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  L++ V DH+I+     VS     ++
Sbjct: 116 EITNKLKSVLGLLDVQVLDHLIVAGTQVVSLAERGLV 152


>gi|298528608|ref|ZP_07016012.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
 gi|298512260|gb|EFI36162.1| DNA repair protein RadC [Desulfonatronospira thiodismutans ASO3-1]
          Length = 143

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%), Gaps = 1/97 (1%)

Query: 2   FL-DKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           FL D  N  ++ ++ S+GT+D  PV+ REI++  L   A+ +IL HNHP G+PNPS  D 
Sbjct: 47  FLVDNKNHFLSKKLISKGTVDQAPVFPREILRYALLKQASGLILSHNHPGGDPNPSVQDR 106

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            MT  I      L I + DH+I+ +    SF+   ++
Sbjct: 107 EMTARIKKAAILLGIRLLDHVIVSRTGHYSFQEHGLL 143


>gi|153940602|ref|YP_001392279.1| DNA repair protein RadC [Clostridium botulinum F str. Langeland]
 gi|166218778|sp|A7GHL9|Y3057_CLOBL RecName: Full=UPF0758 protein CLI_3057
 gi|152936498|gb|ABS41996.1| DNA repair protein, RadC family [Clostridium botulinum F str.
           Langeland]
 gi|295320272|gb|ADG00650.1| DNA repair protein, RadC family [Clostridium botulinum F str.
           230613]
          Length = 228

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+        GT++   V+ REI    ++ +  SII+ HNHPSG+P PS  DI
Sbjct: 132 LILNTKNIVKYIRDVFIGTLNSSIVHPREIFCEAIKKNGASIIICHNHPSGDPTPSKEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + I + DHIIIG++ +VS K    I
Sbjct: 192 NITLRLKECGKLIGIDLLDHIIIGENKYVSMKEKGTI 228


>gi|28189070|dbj|BAC56220.1| putative DNA repair protein [Streptococcus suis]
          Length = 226

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I+ +    G+++      REI+   ++  ATSII+VHNHPSG+  PS  D+
Sbjct: 129 LYLNTQNQIISQKTIFIGSVNRSIAEPREILHYAVKCMATSIIIVHNHPSGSVQPSRNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKESCEKLGLVLLDHLIVGNKDYYSFREE 222


>gi|224370717|ref|YP_002604881.1| RadC3 [Desulfobacterium autotrophicum HRM2]
 gi|223693434|gb|ACN16717.1| RadC3 [Desulfobacterium autotrophicum HRM2]
          Length = 279

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++A E+   G++    VY RE++ + LE  A ++I  HNHPSG  +PS  D+
Sbjct: 171 IFLDAKNRVLASEILFEGSLSSSAVYPREVIAKALEHRAAALIFAHNHPSGETSPSPEDL 230

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L    I VH+H+I G + F SF    II
Sbjct: 231 AITRRLFFALAHAGITVHEHLITGGERFYSFADQGII 267


>gi|225011591|ref|ZP_03702029.1| DNA repair protein RadC [Flavobacteria bacterium MS024-2A]
 gi|225004094|gb|EEG42066.1| DNA repair protein RadC [Flavobacteria bacterium MS024-2A]
          Length = 232

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L++ N L+     S+G I    V +R   +R  E+ AT +IL HNHPSG   PS +D 
Sbjct: 136 LYLNQSNRLLEKYRLSKGGITQTTVDLRLAFKRAFEVGATGLILAHNHPSGGLTPSSSDE 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+        +++ + DH+I+ K  + SF    ++
Sbjct: 196 QITRKFKLAAASVDLRILDHLIVSKKGYFSFADEGLL 232


>gi|15644305|ref|NP_229357.1| DNA repair protein RadC [Thermotoga maritima MSB8]
 gi|6685843|sp|Q9X1P3|Y1557_THEMA RecName: Full=UPF0758 protein TM_1557
 gi|4982124|gb|AAD36623.1|AE001801_10 DNA repair protein [Thermotoga maritima MSB8]
          Length = 222

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD    +I +   + GT D   ++ R++ +  +  +A+ +I+VHNHPSG+P PS  D 
Sbjct: 126 ICLDTKLNVIGENTLTVGTSDRSLIHPRDVFRTAIRANASGVIVVHNHPSGDPTPSKEDR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +      L + + DH+I+ +  + SF+   
Sbjct: 186 LITERLKQAGEILGVSLVDHVIVSRRGYFSFREEG 220


>gi|108804367|ref|YP_644304.1| DNA repair protein RadC [Rubrobacter xylanophilus DSM 9941]
 gi|122975977|sp|Q1AVT6|Y1530_RUBXD RecName: Full=UPF0758 protein Rxyl_1530
 gi|108765610|gb|ABG04492.1| DNA repair protein RadC [Rubrobacter xylanophilus DSM 9941]
          Length = 227

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N +I     S GT+    V+ RE+ +  +  SA S++L HNHPSG   PS  D 
Sbjct: 132 VLLNTKNEVIEAPTISVGTLSSSLVHPREVFKPAIRASAASVVLAHNHPSGRVEPSREDR 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I V DH+I+G + + S K   ++
Sbjct: 192 EVTGRVAEAGGIIGIEVLDHVIVG-EGYFSMKEHGML 227


>gi|229552057|ref|ZP_04440782.1| DNA repair protein RadC [Lactobacillus rhamnosus LMS2-1]
 gi|229314574|gb|EEN80547.1| DNA repair protein RadC [Lactobacillus rhamnosus LMS2-1]
          Length = 236

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 58/92 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I +++ + GT+D      R + +  L+LSAT++I+VHNHPSG+P+PS AD 
Sbjct: 138 LFLDVKNQIITEQIVAIGTVDSALADPRVVFREALKLSATNLIMVHNHPSGDPSPSQADR 197

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
           + T         L + + DH+IIG+ ++ SF 
Sbjct: 198 DTTTRFQLAAALLGMHLLDHLIIGRQSYYSFA 229


>gi|78042658|ref|YP_359204.1| DNA repair protein RadC [Carboxydothermus hydrogenoformans Z-2901]
 gi|123577004|sp|Q3AF80|Y341_CARHZ RecName: Full=UPF0758 protein CHY_0341
 gi|77994773|gb|ABB13672.1| DNA repair protein RadC [Carboxydothermus hydrogenoformans Z-2901]
          Length = 226

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 57/96 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N L  + + + G ++H  V   +I +  +++ A ++I+ HNHPSG+P PS  DI
Sbjct: 130 LYLNTKNQLCGENIVAIGGVNHAGVSPGDIFREAVKIGAYAVIIAHNHPSGDPTPSKEDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           + T  +      L I + DHII+G++ ++S K  R+
Sbjct: 190 DFTGRVKKASEILGIKLLDHIILGENKYISMKAERL 225


>gi|154253862|ref|YP_001414686.1| DNA repair protein RadC [Parvibaculum lavamentivorans DS-1]
 gi|154157812|gb|ABS65029.1| DNA repair protein RadC [Parvibaculum lavamentivorans DS-1]
          Length = 164

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +F+D  + ++A E   RGTI+   V+ R IVQR LEL+A ++IL H HPSG   PS AD 
Sbjct: 68  VFMDSLHQVLAYEPMFRGTINSATVHARVIVQRALELNAAAVILSHQHPSGATEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+    SF    ++
Sbjct: 128 ALTQQLQAALALIDVRVLDHIIVGQGIPYSFAEHGLL 164


>gi|295094836|emb|CBK83927.1| DNA replication and repair protein RadC [Coprococcus sp. ART55/1]
          Length = 242

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L  D  + LI D   S GT++   +  RE+    L   A  IILVHNHPSG+P PS  DI
Sbjct: 146 LMFDAKHKLIKDVRISEGTVNSSMLSPREVFVEALRYDAVYIILVHNHPSGDPTPSGQDI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      + I + DHII+G + +VS     I+
Sbjct: 206 DITREMDRAGELIGIELSDHIILGNNCYVSLAERGIL 242


>gi|253751831|ref|YP_003024972.1| DNA repair protein RadC [Streptococcus suis SC84]
 gi|253753654|ref|YP_003026795.1| DNA repair protein RadC [Streptococcus suis P1/7]
 gi|253755465|ref|YP_003028605.1| DNA repair protein RadC [Streptococcus suis BM407]
 gi|18253151|dbj|BAB83962.1| putative DNA repair protein [Streptococcus suis]
 gi|251816120|emb|CAZ51743.1| DNA repair protein RadC [Streptococcus suis SC84]
 gi|251817929|emb|CAZ55707.1| DNA repair protein RadC [Streptococcus suis BM407]
 gi|251819900|emb|CAR45944.1| DNA repair protein RadC [Streptococcus suis P1/7]
 gi|292558401|gb|ADE31402.1| putative DNA repair protein [Streptococcus suis GZ1]
 gi|319758183|gb|ADV70125.1| DNA repair protein RadC [Streptococcus suis JS14]
          Length = 226

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I+ +    G+++      REI+   ++  ATSII+VHNHPSG+  PS  D+
Sbjct: 129 LYLNTQNQIISQKTIFIGSVNRSIAEPREILHYAVKCMATSIIIVHNHPSGSVQPSRNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKESCEKLGLVLLDHLIVGNKDYYSFREE 222


>gi|148270365|ref|YP_001244825.1| DNA repair protein RadC [Thermotoga petrophila RKU-1]
 gi|281412671|ref|YP_003346750.1| DNA repair protein RadC [Thermotoga naphthophila RKU-10]
 gi|166218798|sp|A5IM26|Y1235_THEP1 RecName: Full=UPF0758 protein Tpet_1235
 gi|147735909|gb|ABQ47249.1| DNA repair protein RadC [Thermotoga petrophila RKU-1]
 gi|281373774|gb|ADA67336.1| DNA repair protein RadC [Thermotoga naphthophila RKU-10]
          Length = 222

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD    +I +   + GT D   ++ R++ +  +  +A+ +I+VHNHPSG+P PS  D 
Sbjct: 126 ICLDTKLNVIGENTLTVGTSDRSLIHPRDVFRTAIRANASGVIVVHNHPSGDPTPSKEDR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +      L + + DH+I+ +  + SF+   
Sbjct: 186 LITERLKQAGEILGVSLVDHVIVSRRGYFSFREEG 220


>gi|70726267|ref|YP_253181.1| hypothetical protein SH1266 [Staphylococcus haemolyticus JCSC1435]
 gi|123660411|sp|Q4L700|Y1266_STAHJ RecName: Full=UPF0758 protein SH1266
 gi|68446991|dbj|BAE04575.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 228

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 52/96 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  NI+I +E   +GT++   ++ RE+ +  +  S+ +II++HNHPSG+  PS  DI
Sbjct: 128 LLLNSKNIVIKEETIYKGTLNSSVIHPREVFKAAIRASSNAIIVLHNHPSGDVTPSKEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
             T  +      L I V DHIIIG   + S      
Sbjct: 188 ETTIRLKECGELLGIQVLDHIIIGDQKYASLVEEGY 223


>gi|28189083|dbj|BAC56230.1| putative DNA repair protein [Streptococcus suis]
          Length = 226

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G+++      REI+   ++  ATS+I+VHNHPSG+ +PS  D+
Sbjct: 129 LYLNTQNQIIKQETIFIGSVNRSIAEPREILHHAIKCMATSVIIVHNHPSGSVHPSKNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKQSCEVLGLVLLDHLIVGNKNYYSFREE 222


>gi|260881538|ref|ZP_05404673.2| DNA repair protein RadC [Mitsuokella multacida DSM 20544]
 gi|260848721|gb|EEX68728.1| DNA repair protein RadC [Mitsuokella multacida DSM 20544]
          Length = 226

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N ++     S G++    V+ RE+    +  +A S+ILVHNHPSG+PNPS  D+
Sbjct: 129 LLLNTKNHILGLRDVSIGSLSASVVHPREVFAMAIRYAAASMILVHNHPSGDPNPSREDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L+I V DHII+G + F+S K   +I
Sbjct: 189 AITDRLVKAGRILDIPVLDHIILGDNRFLSLKEKGMI 225


>gi|28189075|dbj|BAC56224.1| putative DNA repair protein [Streptococcus suis]
          Length = 226

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G+++      REI+   ++  ATS+I+VHNHPSG+ +PS  D+
Sbjct: 129 LYLNTQNQIIKQETIFIGSVNRSIAEPREILHHAIKCMATSVIIVHNHPSGSVHPSKNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKQSCEVLGLVLLDHLIVGNKNYYSFREE 222


>gi|170289009|ref|YP_001739247.1| DNA repair protein RadC [Thermotoga sp. RQ2]
 gi|170176512|gb|ACB09564.1| DNA repair protein RadC [Thermotoga sp. RQ2]
          Length = 215

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD    +I +   + GT D   ++ R++ +  +  +A+ +I+VHNHPSG+P PS  D 
Sbjct: 119 ICLDTKLNVIGENTLTVGTSDRSLIHPRDVFRTAIRANASGVIVVHNHPSGDPTPSKEDR 178

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
            +T+ +      L + + DH+I+ +  + SF+   
Sbjct: 179 LITERLKQAGEILGVSLVDHVIVSRRGYFSFREEG 213


>gi|28189079|dbj|BAC56227.1| putative DNA repair protein [Streptococcus suis]
          Length = 226

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I  E    G+++      REI+   ++  ATS+I+VHNHPSG+ +PS  D+
Sbjct: 129 LYLNTQNQIIKQETIFIGSVNRSIAEPREILHHAIKCMATSVIIVHNHPSGSVHPSKNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKQSCEVLGLVLLDHLIVGNKNYYSFREE 222


>gi|297618163|ref|YP_003703322.1| DNA repair protein RadC [Syntrophothermus lipocalidus DSM 12680]
 gi|297146000|gb|ADI02757.1| DNA repair protein RadC [Syntrophothermus lipocalidus DSM 12680]
          Length = 166

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N + A +V S G++    V+ RE+ +  +  S+ S+I +HNHPSG+P PS  DI
Sbjct: 70  LYLNSGNQVTAAQVVSIGSLSSTVVHPREVFKTAILTSSMSVIAIHNHPSGDPEPSSEDI 129

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     L I V DHI+IG   F S +G++ I
Sbjct: 130 AVTKQLVEAGKILGIKVLDHIVIGNKRFWSMRGMKQI 166


>gi|254518121|ref|ZP_05130177.1| DNA repair protein RadC [Clostridium sp. 7_2_43FAA]
 gi|226911870|gb|EEH97071.1| DNA repair protein RadC [Clostridium sp. 7_2_43FAA]
          Length = 152

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N   +    S G+++   V+ RE+ +  +  ++ +II+ HNHPSG+  PS  DI
Sbjct: 55  VCLDNKNQPTSINTVSVGSLNSSIVHPREVFKVAILSNSANIIVYHNHPSGDVTPSKEDI 114

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKD-AFVSFKGLR 95
           N+T+ +      L I + DHII+G + ++ SFK   
Sbjct: 115 NITERLKEAGKILGIELIDHIIVGSNSSYYSFKEKG 150


>gi|256819754|ref|YP_003141033.1| DNA repair protein RadC [Capnocytophaga ochracea DSM 7271]
 gi|256581337|gb|ACU92472.1| DNA repair protein RadC [Capnocytophaga ochracea DSM 7271]
          Length = 225

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I       G I H  V +R + +  LE  A ++ILVHNHPSG+  PS  DI
Sbjct: 129 LYLNSTNRVIHKARLFSGGITHTTVDVRLLFKTALEQGAIALILVHNHPSGSTTPSKEDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ + T    L+I + DH+I+ +  ++SF   R+
Sbjct: 189 ELTQRVKTAGEMLDIKLLDHVIVTEKEYLSFLDERL 224


>gi|237747755|ref|ZP_04578235.1| DNA repair protein radC [Oxalobacter formigenes OXCC13]
 gi|229379117|gb|EEO29208.1| DNA repair protein radC [Oxalobacter formigenes OXCC13]
          Length = 224

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI      RGT+    VY RE+V+  L  ++ S+I  HNHPSG  +PS+AD 
Sbjct: 128 LHLDIKNKLIECSEMFRGTLSQTSVYPREVVKAALANNSASVIFAHNHPSGKADPSNADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +   L  ++I V DHII+      SF     +
Sbjct: 188 TLTHALKQALGLVDIRVLDHIIVAGKNTYSFAEYGFL 224


>gi|222142629|ref|YP_002559384.1| hypothetical protein MCCL_plsB0053 [Macrococcus caseolyticus
           JCSC5402]
 gi|222121398|dbj|BAH18731.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 150

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 47/94 (50%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  N +        GTI+  P++ RE+ Q  +  S  SIIL H HPS +P PS  D   
Sbjct: 56  LNTKNEITFVYTVFIGTINMSPIHPREVFQVAILNSCASIILAHCHPSDDPTPSSEDREA 115

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           T+        L I V DHII+ + ++ SF+   +
Sbjct: 116 TKRFEECGELLGIPVLDHIIVTESSYFSFRENNL 149


>gi|107102082|ref|ZP_01366000.1| hypothetical protein PaerPA_01003131 [Pseudomonas aeruginosa PACS2]
 gi|134095214|ref|YP_001100289.1| RadC family DNA repair protein [Herminiimonas arsenicoxydans]
 gi|133739117|emb|CAL62166.1| putative DNA repair protein RadC [Herminiimonas arsenicoxydans]
          Length = 164

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E   RGTI+   VY R +VQR LEL A +++  H HPSG   PS AD 
Sbjct: 68  VFLDSMHQVLAYEPMFRGTINSTAVYPRVVVQRVLELKAAAVVFAHQHPSGVTEPSSADR 127

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DHII+G+    SF    ++
Sbjct: 128 ALTQQLQAALALIDVRVLDHIIVGQGIPYSFAEHSLL 164


>gi|330971404|gb|EGH71470.1| DNA repair protein RadC [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 162

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  +  ++ E    G+ID   VY REIV R L  +A ++I  HNHPSG   PS AD 
Sbjct: 66  VCLDARHRTLSFEKVFFGSIDSASVYPREIVIRALACNAAAVIFAHNHPSGCAEPSQADR 125

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +   L  + + V DH ++G+   VS   +  +
Sbjct: 126 NLTAQLKNALALVEVRVLDHFVVGEGKPVSLAEMGWL 162


>gi|291546142|emb|CBL19250.1| DNA replication and repair protein RadC [Ruminococcus sp. SR1/5]
          Length = 235

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/96 (40%), Positives = 60/96 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD HN L  +++ SRGT++   +  RE+    ++  A ++ILVHNHP G+P+PS AD+
Sbjct: 135 MMLDGHNHLSGEQLLSRGTVNATLITPREVFVEAVKYRAVNLILVHNHPGGDPSPSQADL 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ I      L I + DHIIIG   +VSF+   I
Sbjct: 195 DVTERIYHCGELLGIHLLDHIIIGDHRYVSFREKGI 230


>gi|225419747|ref|ZP_03762050.1| hypothetical protein CLOSTASPAR_06085 [Clostridium asparagiforme
           DSM 15981]
 gi|225041614|gb|EEG51860.1| hypothetical protein CLOSTASPAR_06085 [Clostridium asparagiforme
           DSM 15981]
          Length = 231

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD    L+ D + SRGT++   +  RE++   L   A +++LVHNHPSG+P PS  DI
Sbjct: 135 MFLDTKQALLKDVLLSRGTVNASVLSPREVLIEALRCRAVTMVLVHNHPSGDPTPSREDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ I      + I + DHI+IG   ++SF+   ++
Sbjct: 195 NLTRRICEAGGLVGIPLIDHIVIGDLRYLSFREQNLL 231


>gi|33152085|ref|NP_873438.1| DNA repair protein [Haemophilus ducreyi 35000HP]
 gi|33148307|gb|AAP95827.1| conserved possible DNA repair protein [Haemophilus ducreyi 35000HP]
          Length = 157

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LF D  N LI  E    GTI+   ++ REIV++ LEL+++++IL HNHPSG   PS +D 
Sbjct: 61  LFWDTQNRLIRFEKLFFGTINQASIHPREIVKKALELNSSAVILTHNHPSGQVTPSQSDK 120

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T  I      +++ V DHII+      SF   +++
Sbjct: 121 QTTAKIKQACQLIDVNVLDHIIVSATDTYSFCMHQLM 157


>gi|119897428|ref|YP_932641.1| DNA repair protein RadC [Azoarcus sp. BH72]
 gi|166218773|sp|A1K4J9|Y1137_AZOSB RecName: Full=UPF0758 protein azo1137
 gi|119669841|emb|CAL93754.1| DNA repair protein radC homolog [Azoarcus sp. BH72]
          Length = 225

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/98 (36%), Positives = 52/98 (53%), Gaps = 1/98 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  N LI      RGT+    VY RE+V+  L+ +A ++I  HNHPSG   PS AD 
Sbjct: 128 LLLDARNTLIDAVDLFRGTLTQTSVYPREVVKLALDRNAAAVIFAHNHPSGAAEPSSADE 187

Query: 61  NMTQNIITTLNPLNIIVHDHIII-GKDAFVSFKGLRII 97
            +T+++   L  ++I V DH ++       SF    +I
Sbjct: 188 QLTRHLKDALALVDIRVLDHFVVPAHGKPTSFAERGLI 225


>gi|225010502|ref|ZP_03700973.1| DNA repair protein RadC [Flavobacteria bacterium MS024-3C]
 gi|225005331|gb|EEG43282.1| DNA repair protein RadC [Flavobacteria bacterium MS024-3C]
          Length = 231

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  N+LI   +  +G      V IR ++Q+ +   AT++I+ HNHP+GN  PS +D 
Sbjct: 135 LYLDNSNVLIERSLLGKGGFTATVVDIRLVLQQAIRWGATAMIVAHNHPTGNLKPSHSDK 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +      L+I + DHII+GK+ + SF    ++
Sbjct: 195 ALTQKLKEAAKVLDIKLLDHIIVGKNEYFSFADQNLL 231


>gi|182419744|ref|ZP_02950984.1| DNA repair protein [Clostridium butyricum 5521]
 gi|237666375|ref|ZP_04526360.1| DNA repair protein RadC [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182376292|gb|EDT73874.1| DNA repair protein [Clostridium butyricum 5521]
 gi|237657574|gb|EEP55129.1| DNA repair protein RadC [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 229

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 55/95 (57%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L   N +I  +    G++++  V+ REI +R +   + S+I+ HNHPSG+P PS  DIN+
Sbjct: 135 LSTKNTIIDAKDVFIGSLNNSIVHPREIFKRAITSHSASVIICHNHPSGDPTPSREDINI 194

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T  I      + I + DHIIIG + FVS K   +I
Sbjct: 195 TLRIKECGKIIGIPLIDHIIIGNNTFVSLKEKGLI 229


>gi|223932335|ref|ZP_03624338.1| DNA repair protein RadC [Streptococcus suis 89/1591]
 gi|302023854|ref|ZP_07249065.1| DNA repair protein RadC [Streptococcus suis 05HAS68]
 gi|28189065|dbj|BAC56216.1| putative DNA repair protein [Streptococcus suis]
 gi|223899016|gb|EEF65374.1| DNA repair protein RadC [Streptococcus suis 89/1591]
          Length = 226

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I+ +    G+++      REI+   ++  ATSII+VHNHPSG+  PS  D+
Sbjct: 129 LYLNTQNQIISQKTIFIGSVNRSIAEPREILHYAVKCMATSIIIVHNHPSGSVQPSRNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKESCEKLGLVLLDHLIVGNKDYYSFREE 222


>gi|269926735|ref|YP_003323358.1| DNA repair protein RadC [Thermobaculum terrenum ATCC BAA-798]
 gi|269790395|gb|ACZ42536.1| DNA repair protein RadC [Thermobaculum terrenum ATCC BAA-798]
          Length = 234

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 55/94 (58%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  N ++A     +G ++   +   ++ +  +  +A SIIL HNHPSG+P PS  D+  
Sbjct: 138 LNTKNQILAITEVYKGGLNSALIRPADVFKPAVRNNAASIILAHNHPSGDPTPSSEDVRT 197

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           T+++I     L+I V DHII+G++++ S +   +
Sbjct: 198 TESLIEAGKLLDIEVLDHIIVGRNSYTSMRRRHL 231


>gi|254520230|ref|ZP_05132286.1| DNA repair protein RadC [Clostridium sp. 7_2_43FAA]
 gi|226913979|gb|EEH99180.1| DNA repair protein RadC [Clostridium sp. 7_2_43FAA]
          Length = 229

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +I  +   +G+++   V+ REI +  L+ S++SII+ HNHPSG+P PS  DI
Sbjct: 133 IMLDTKNNIIGIKDVFKGSLNTSIVHPREIFKEALKKSSSSIIICHNHPSGDPTPSKEDI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      + + + DH+IIGK  FVS K   II
Sbjct: 193 NITLRLKECSKIIGVDLLDHLIIGKGKFVSLKEKGII 229


>gi|119503524|ref|ZP_01625607.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2080]
 gi|119460586|gb|EAW41678.1| DNA repair protein RadC [marine gamma proteobacterium HTCC2080]
          Length = 223

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 56/96 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD    L+A      GT++  PVY REIV   L++ A++II+ HNHPSG   PS ADI
Sbjct: 124 LFLDTQRQLLACRDMFFGTLNTAPVYPREIVAMALKMGASAIIVAHNHPSGCLAPSVADI 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T  +   L  ++I + DH+I+ +  ++S     +
Sbjct: 184 QLTDRLRRALGLIDIDLLDHLIVAQGRYLSMASEGL 219


>gi|73748411|ref|YP_307650.1| RadC family DNA repair protein [Dehalococcoides sp. CBDB1]
 gi|73660127|emb|CAI82734.1| DNA repair protein, RadC family [Dehalococcoides sp. CBDB1]
          Length = 219

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI     S G+++   V+ RE+ +  L  SA  +IL HNHPSG+  PS  DI
Sbjct: 123 LMLDVKSRLIRVGHISVGSLEASVVHPREVFKEALSASAAFVILAHNHPSGDTEPSHDDI 182

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            ++  +      + I V DHIIIG  +F S K   ++
Sbjct: 183 GLSARLREAGGIMGIEVLDHIIIGGQSFTSLKRQGLL 219


>gi|239828412|ref|YP_002951036.1| DNA repair protein RadC [Geobacillus sp. WCH70]
 gi|239808705|gb|ACS25770.1| DNA repair protein RadC [Geobacillus sp. WCH70]
          Length = 169

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N   A  +   G+++   V+ RE+ +  +  ++ SII+ HNHPS +P PS  DI
Sbjct: 73  VCLDTKNQPTAINICHIGSLNSSIVHPREVFKSAILSNSASIIVAHNHPSSDPTPSREDI 132

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I + DH+I+ ++ FVS K    I
Sbjct: 133 EVTKRLVEAGRIVGIELLDHLIVCEEKFVSLKEKGYI 169


>gi|325842730|ref|ZP_08167765.1| putative DNA repair protein RadC [Turicibacter sp. HGF1]
 gi|325489530|gb|EGC91895.1| putative DNA repair protein RadC [Turicibacter sp. HGF1]
          Length = 149

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 51/96 (53%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
            L+  N      V S G+++   V+ RE+ +  +  +A SII  HNHPSG   PSD DI 
Sbjct: 54  CLNTKNEPTNITVVSVGSLNKAIVHPREVFKTAILSNAASIIAFHNHPSGETTPSDQDIQ 113

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           +T  ++     L I + DH+IIG  +F+S K    +
Sbjct: 114 LTHRLVEAGELLGIKLLDHLIIGDGSFMSLKEKGYL 149


>gi|167630773|ref|YP_001681272.1| DNA repair protein radc [Heliobacterium modesticaldum Ice1]
 gi|167593513|gb|ABZ85261.1| DNA repair protein radc [Heliobacterium modesticaldum Ice1]
          Length = 223

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 56/95 (58%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L+  N +++ E  S G++    V+ RE+ +  +  SA +++L+HNHPSG+P PS  D  +
Sbjct: 129 LNTKNQVLSIEDISVGSLSSSIVHPRELFKVLIRKSAAAVVLIHNHPSGDPTPSREDREI 188

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ I+     L I + DH+IIG + + S K L  +
Sbjct: 189 TRRIVEAGRILGIEILDHVIIGDNRYSSLKELGYV 223


>gi|169825547|ref|YP_001695722.1| DNA repair protein radC-like protein [Lysinibacillus sphaericus
           C3-41]
 gi|168994824|gb|ACA42363.1| DNA repair protein radC-like protein [Lysinibacillus sphaericus
           C3-41]
          Length = 204

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + +I  E    G+++      REI++  L+ SA  II +HNH SG+  PS  D+
Sbjct: 108 LFLDTRSRVIKKETIFIGSLNSSIASPREIMRLALKYSAAGIICLHNHCSGDSEPSMQDL 167

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    + + + + DHI+IG + F S +   ++
Sbjct: 168 EVTRRLFEAGDLMGVELIDHIVIGNNEFTSIRENNLL 204


>gi|304395596|ref|ZP_07377479.1| DNA repair protein RadC [Pantoea sp. aB]
 gi|304356890|gb|EFM21254.1| DNA repair protein RadC [Pantoea sp. aB]
          Length = 155

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N L+A E    G+I    ++ RE+V+  L  +A + I  HNHPSG   PSDAD 
Sbjct: 59  VFLDNQNRLLAHETLFHGSITSTEIHPREVVKAALRHNAAAAIFAHNHPSGYAEPSDADR 118

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  + + V DH+I+G    VSF     +
Sbjct: 119 RITERLKNALALVEVRVLDHLIVGSKEIVSFAERGWL 155


>gi|219847704|ref|YP_002462137.1| DNA repair protein RadC [Chloroflexus aggregans DSM 9485]
 gi|254764430|sp|B8G568|Y777_CHLAD RecName: Full=UPF0758 protein Cagg_0777
 gi|219541963|gb|ACL23701.1| DNA repair protein RadC [Chloroflexus aggregans DSM 9485]
          Length = 229

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 53/96 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + +        G+++   + I E+ +  +  ++ +II+VHNHPSG   PS  DI
Sbjct: 131 VLLDTKHRVQQINTVYIGSLNSATIRIGEVFKEAVRRNSAAIIVVHNHPSGEATPSPEDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ ++     L+I V DH+IIG+  +VS +   I
Sbjct: 191 QVTRQLVAAGRLLDIEVLDHLIIGRGQYVSLRERGI 226


>gi|260061882|ref|YP_003194962.1| putative DNA repair protein [Robiginitalea biformata HTCC2501]
 gi|88786015|gb|EAR17184.1| putative DNA repair protein [Robiginitalea biformata HTCC2501]
          Length = 242

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +++    S+G +    V +R ++++ LEL A S++L HNHPSGN  PS AD 
Sbjct: 146 LYLNNANGVLSRFQLSKGGLTGTLVDVRLLLRKALELHAVSLVLAHNHPSGNLQPSKADR 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I      ++I V DH+I+G  A+ SF   +++
Sbjct: 206 QITRKIEKAARSMDIRVLDHLILGGTAYFSFADEQLL 242


>gi|90408646|ref|ZP_01216799.1| DNA repair protein RadC [Psychromonas sp. CNPT3]
 gi|90310253|gb|EAS38385.1| DNA repair protein RadC [Psychromonas sp. CNPT3]
          Length = 157

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FL+  + LI  +    GTID   +Y RE+++  L+L+A+++IL HNHPSG+  PSDADI
Sbjct: 62  MFLNSRHQLIEYKEIFHGTIDSAHIYPREMLKAVLKLNASTVILAHNHPSGSSVPSDADI 121

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ +   L  +++ V DH+I+G+ A  SF    ++
Sbjct: 122 AITQRLTKALELIDVRVLDHVIVGETA-TSFAEKGLL 157


>gi|146320931|ref|YP_001200642.1| DNA repair protein RadC [Streptococcus suis 98HAH33]
 gi|229485571|sp|A4W1K3|Y1084_STRS2 RecName: Full=UPF0758 protein SSU98_1084
 gi|145691737|gb|ABP92242.1| putative DNA repair protein [Streptococcus suis 98HAH33]
          Length = 246

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 56/94 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N +I+ +    G+++      REI+   ++  ATSII+VHNHPSG+  PS  D+
Sbjct: 129 LYLNTQNQIISQKTIFIGSVNRSIAEPREILHYAVKCMATSIIIVHNHPSGSVQPSRNDL 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
             T+N+  +   L +++ DH+I+G   + SF+  
Sbjct: 189 LFTENLKESCEKLGLVLLDHLIVGNKDYYSFREE 222


>gi|170693582|ref|ZP_02884740.1| DNA repair protein RadC [Burkholderia graminis C4D1M]
 gi|170141364|gb|EDT09534.1| DNA repair protein RadC [Burkholderia graminis C4D1M]
          Length = 254

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/96 (41%), Positives = 60/96 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  + LI  E  +RGT+  + VY REIV+R L L+A S+I+ HNHPSG   PS +D 
Sbjct: 158 LFLDARHRLIRSEESARGTLTRMAVYPREIVRRALALNAASLIVAHNHPSGAVQPSASDC 217

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           ++T+ +   L  +++ + DH++IG D+  SF     
Sbjct: 218 SLTRTLREALALIDVQLVDHLVIGADSVYSFARAGW 253


>gi|296313679|ref|ZP_06863620.1| DNA repair protein RadC [Neisseria polysaccharea ATCC 43768]
 gi|296839740|gb|EFH23678.1| DNA repair protein RadC [Neisseria polysaccharea ATCC 43768]
          Length = 225

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L++ N LIA    SRGT+    +YIREIV+  L+  A S+I+ HNHP G+P PS  DI
Sbjct: 128 LLLNRQNQLIAVRELSRGTVTENTIYIREIVKLALDEYADSLIIAHNHPGGSPEPSQEDI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ +   ++ +++ + DH I+   +  SF+ L ++
Sbjct: 188 MFTRRLAQAMSLVDVSLLDHFIVTSRSVCSFRQLGLM 224


>gi|160871642|ref|ZP_02061774.1| DNA repair protein RadC [Rickettsiella grylli]
 gi|159120441|gb|EDP45779.1| DNA repair protein RadC [Rickettsiella grylli]
          Length = 224

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  +  I  +    G+I+   VY RE++++  + +A ++IL HNHPSGN  PSDAD 
Sbjct: 128 LFLDNTHRFIFFKELFHGSINEATVYPRELIRQVYQHNAAAVILAHNHPSGNAKPSDADK 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +TQ I T L  +++ + DHIIIG     SF    ++
Sbjct: 188 RLTQEIKTILTAIDVRLLDHIIIGSGCITSFAAQGLL 224


>gi|258508259|ref|YP_003171010.1| DNA repair protein radC [Lactobacillus rhamnosus GG]
 gi|258539471|ref|YP_003173970.1| DNA repair protein radC [Lactobacillus rhamnosus Lc 705]
 gi|257148186|emb|CAR87159.1| DNA repair protein radC [Lactobacillus rhamnosus GG]
 gi|257151147|emb|CAR90119.1| DNA repair protein radC [Lactobacillus rhamnosus Lc 705]
 gi|259649577|dbj|BAI41739.1| DNA repair protein [Lactobacillus rhamnosus GG]
          Length = 222

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 58/92 (63%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I +++ + GT+D      R + +  L+LSAT++I+VHNHPSG+P+PS AD 
Sbjct: 124 LFLDVKNQIITEQIVAIGTVDSALADPRVVFREALKLSATNLIMVHNHPSGDPSPSQADR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
           + T         L + + DH+IIG+ ++ SF 
Sbjct: 184 DTTTRFQLAAALLGMHLLDHLIIGRQSYYSFA 215


>gi|295397226|ref|ZP_06807325.1| DNA repair protein RadC [Aerococcus viridans ATCC 11563]
 gi|294974535|gb|EFG50263.1| DNA repair protein RadC [Aerococcus viridans ATCC 11563]
          Length = 241

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/96 (38%), Positives = 59/96 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N ++ ++    G+++    + REI +  +  SA  II+ HNHPSGNP+PS ADI
Sbjct: 144 LYLNTKNQIVKEKTIFVGSLNASVAHPREIFKEGVRASAARIIVAHNHPSGNPSPSQADI 203

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
           N T+ +    + + I + DHII+G DAF+S +   I
Sbjct: 204 NFTRRLAEVGDLIGIEILDHIIVGGDAFLSLQEYGI 239


>gi|260890567|ref|ZP_05901830.1| DNA repair protein RadC [Leptotrichia hofstadii F0254]
 gi|260859809|gb|EEX74309.1| DNA repair protein RadC [Leptotrichia hofstadii F0254]
          Length = 239

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+  N L+ +E   RGTID   VYIRE++++ LE +A S+ILVHNHP+G+  PSD+DI
Sbjct: 143 LFLNTQNELLKEEELFRGTIDRSTVYIRELIKKILEYNAKSVILVHNHPAGSLRPSDSDI 202

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DH+II +  + SF    I+
Sbjct: 203 RLTKKVKEVFESLEIRLLDHLIISEKGYFSFLEGGIL 239


>gi|325479032|gb|EGC82133.1| DNA repair protein RadC [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 227

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 59/95 (62%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N++I+ E  S G +    V  RE+ +  ++ SA S+IL+HNHPSGNP PS  D 
Sbjct: 131 ILLDSKNVIISTETISVGDLSSTIVNPREVFKPAIKKSAKSVILIHNHPSGNPAPSMEDY 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           ++T+ +    + L+I V DHIIIG+D F SFK   
Sbjct: 191 HITKRLKEAGDILDIGVLDHIIIGRDDFYSFKKEG 225


>gi|108763923|ref|YP_630190.1| DNA repair protein RadC [Myxococcus xanthus DK 1622]
 gi|108467803|gb|ABF92988.1| DNA repair protein RadC [Myxococcus xanthus DK 1622]
          Length = 241

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L  +  N+L+ D   + GT++  PV  RE+    L   ATSI+L HNHPSG+P PS  D+
Sbjct: 127 LCFNARNVLVHDARVAEGTMNTCPVDPREVFAAALTSRATSIVLAHNHPSGDPEPSVQDL 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T++++     LNI V DH+++G   +VS     ++
Sbjct: 187 GLTRHLVAGAQLLNIKVLDHVVMGDGGYVSMLERGLM 223


>gi|145299092|ref|YP_001141933.1| RadC family DNA repair protein [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851864|gb|ABO90185.1| DNA repair protein, RadC family [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 163

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 56/97 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  + +I       GTID   VY RE+V+  L+ +A ++IL HNHPSG   PS ADI
Sbjct: 67  ILLDNQHRVIDTVDLIHGTIDSAAVYPREVVKTALKYNAAAVILAHNHPSGIAEPSRADI 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L+ + I V DH+++  +  VSF    +I
Sbjct: 127 QITERLQAALDFVEIRVLDHVVVAGEYSVSFAERGLI 163


>gi|196230018|ref|ZP_03128881.1| DNA repair protein RadC [Chthoniobacter flavus Ellin428]
 gi|196225615|gb|EDY20122.1| DNA repair protein RadC [Chthoniobacter flavus Ellin428]
          Length = 231

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 5/102 (4%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD   +LI  E  S G+++    + RE+ +  L  SA ++ILVHNHPSG+P PS AD 
Sbjct: 130 VLLDTKYLLIRVEEISHGSLNESIAHPREVFRPALIYSAYAVILVHNHPSGDPTPSSADH 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDA-----FVSFKGLRII 97
            +T+ ++     L I + DH+I+G        + SFK   II
Sbjct: 190 QLTRRLVQGAELLQIRLLDHVILGTGDNGRLPYFSFKEAGII 231


>gi|331091135|ref|ZP_08339977.1| hypothetical protein HMPREF9477_00620 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405357|gb|EGG84893.1| hypothetical protein HMPREF9477_00620 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 231

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    LI +   S+GT++   V  RE+    L+ +A SIIL+HNHPSG+P PS  DI
Sbjct: 135 LMLNTKARLIGETDISKGTVNASLVSPRELFIEALQKNAVSIILLHNHPSGDPTPSKEDI 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I    + + I + DHIIIG + ++S     ++
Sbjct: 195 LITKRIKEAGSLIGIELLDHIIIGNNCYISLAEKNLV 231


>gi|145219983|ref|YP_001130692.1| DNA repair protein RadC [Prosthecochloris vibrioformis DSM 265]
 gi|238685550|sp|A4SFD1|Y1178_PROVI RecName: Full=UPF0758 protein Cvib_1178
 gi|145206147|gb|ABP37190.1| DNA replication and repair protein RadC [Chlorobium phaeovibrioides
           DSM 265]
          Length = 223

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +   E  + GT++   ++ RE+ +  +  SA +IILVHNHPSG+  PS+AD 
Sbjct: 126 LHLNTKNQITKCEEVTIGTLNASLIHPREVFKAAIRESANAIILVHNHPSGDTEPSNADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +      + I + DH+IIGK  + SF+    +
Sbjct: 186 QVTNLLKQASAVIQIDLLDHVIIGKTGWYSFRENNQL 222


>gi|220932261|ref|YP_002509169.1| DNA repair protein RadC [Halothermothrix orenii H 168]
 gi|219993571|gb|ACL70174.1| DNA repair protein RadC [Halothermothrix orenii H 168]
          Length = 228

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 60/97 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +  D  N LIA    SRG +    V+ RE+ +  +  S+ ++ILVHNHPSG+P+PSD DI
Sbjct: 132 ILFDIKNQLIAISEISRGGLSSSIVHPREVFKEAIRRSSAAVILVHNHPSGDPSPSDEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T+ ++ +   L + V DHIIIG   ++S K   +I
Sbjct: 192 NVTRRLVDSGKILGVDVLDHIIIGDGVYLSMKKENLI 228


>gi|218282132|ref|ZP_03488431.1| hypothetical protein EUBIFOR_01006 [Eubacterium biforme DSM 3989]
 gi|218216925|gb|EEC90463.1| hypothetical protein EUBIFOR_01006 [Eubacterium biforme DSM 3989]
          Length = 224

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+LD  + LI+  V  +GT++   V+ RE+ +     +A S+++ HNHPSG+  PS AD 
Sbjct: 127 LYLDTKSKLISHRVLFKGTLNESVVHPREVFKEAFLQNANSVLIAHNHPSGDCTPSKADF 186

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     + + + DHII+ K+ + SFK  + +
Sbjct: 187 EVTYKMVHVAMTMGVCLVDHIIVCKNQYYSFKEHKYL 223


>gi|325661600|ref|ZP_08150224.1| hypothetical protein HMPREF0490_00958 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331084842|ref|ZP_08333930.1| hypothetical protein HMPREF0987_00233 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325472127|gb|EGC75341.1| hypothetical protein HMPREF0490_00958 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330410936|gb|EGG90358.1| hypothetical protein HMPREF0987_00233 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 231

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+    L+ +   S+GT++   +  RE+    L+ +A SIIL+HNHPSG+P PS  D+
Sbjct: 135 LMLNTKAKLLGETTISKGTVNASLLTPRELFIEALQKNAVSIILLHNHPSGDPTPSREDL 194

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ I    + + I + DHIIIG + ++SF    +I
Sbjct: 195 LITKRIKEAGSLIGIELLDHIIIGNNCYISFAEQELI 231


>gi|188992506|ref|YP_001904516.1| DNA repair protein radC homolog [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734266|emb|CAP52476.1| DNA repair protein radC homolog [Xanthomonas campestris pv.
           campestris]
          Length = 159

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/96 (42%), Positives = 58/96 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  + ++A E    GTID   ++ R + +R LEL+A ++IL HNHPSGNP PS+AD 
Sbjct: 63  VFLDNQHHILAAEHLFSGTIDGCEIHPRVVAKRALELNAAAVILFHNHPSGNPEPSEADR 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +TQ +   L  L+I V DH++IG    VS      
Sbjct: 123 KVTQRLQEALGLLDIRVLDHLVIGGQKSVSLAARGW 158


>gi|153953499|ref|YP_001394264.1| DNA repair protein RadC [Clostridium kluyveri DSM 555]
 gi|219854121|ref|YP_002471243.1| hypothetical protein CKR_0778 [Clostridium kluyveri NBRC 12016]
 gi|189029393|sp|A5N6I5|Y865_CLOK5 RecName: Full=UPF0758 protein CKL_0865
 gi|254764433|sp|B9E004|Y778_CLOK1 RecName: Full=UPF0758 protein CKR_0778
 gi|146346380|gb|EDK32916.1| DNA repair protein RadC-like protein [Clostridium kluyveri DSM 555]
 gi|219567845|dbj|BAH05829.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 228

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I  +    GT++   V+ REI    ++ ++ SIIL HNHPSG+P+PS+ D+
Sbjct: 132 ILLNTKNMVIGIKNVFIGTLNSSIVHPREIFFYAIKKNSASIILCHNHPSGDPSPSNEDV 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +      L I + DH+IIG   F+S K   I+
Sbjct: 192 NVTFRLKKCGELLGIQLVDHLIIGNGIFISLKEKGIL 228


>gi|317123022|ref|YP_004103025.1| DNA repair protein RadC [Thermaerobacter marianensis DSM 12885]
 gi|315593002|gb|ADU52298.1| DNA repair protein RadC [Thermaerobacter marianensis DSM 12885]
          Length = 351

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 58/97 (59%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  + ++  ++ S GT++   V+ RE+ +  +   A ++ILVHNHPSG+P PS  D+
Sbjct: 252 VLLNTKHYVLGVDLISIGTLNGSMVHPREVFRAAVRRGAAALILVHNHPSGDPTPSPEDV 311

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ ++     + I V DH+IIG   ++S +   ++
Sbjct: 312 QVTRRLVEAGRIMGIDVLDHVIIGNQRYISLREAGLV 348


>gi|325849901|ref|ZP_08170940.1| DNA repair protein RadC [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325479925|gb|EGC83008.1| DNA repair protein RadC [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 226

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N++I+ E+ S G ++   V  RE     +  SA +II VHNHPSGN NPS  D 
Sbjct: 130 ILLDTKNVIISKELISTGDLNSSIVNPRECFIAAVRKSANAIIFVHNHPSGNCNPSRNDK 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L+I V DHI+IG   + SFK   ++
Sbjct: 190 IITDRLVQAGKILDISVLDHIVIGNGKYFSFKKECLM 226


>gi|323699098|ref|ZP_08111010.1| DNA repair protein RadC [Desulfovibrio sp. ND132]
 gi|323459030|gb|EGB14895.1| DNA repair protein RadC [Desulfovibrio desulfuricans ND132]
          Length = 229

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD  N ++A E  S+GT +   ++ REI    L+L AT++ILVHNHP G  +PS ADI
Sbjct: 133 VFLDTKNRVMAWEQMSKGTTNATAIFPREIAAAALKLEATNVILVHNHPGGGSDPSGADI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  ++     L+I V DHII+    + SF     +
Sbjct: 193 LLTDKVVEACASLDIAVRDHIIVTDHDYYSFNEFGRL 229


>gi|148654928|ref|YP_001275133.1| DNA repair protein RadC [Roseiflexus sp. RS-1]
 gi|166218791|sp|A5URD0|Y767_ROSS1 RecName: Full=UPF0758 protein RoseRS_0767
 gi|148567038|gb|ABQ89183.1| DNA repair protein RadC [Roseiflexus sp. RS-1]
          Length = 233

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   +    G++    V I EI +  + L++ SII+VHNHPSG+P PS  D+
Sbjct: 133 ICLDTKNRVQKIQTVYIGSLHTSMVRIGEIFKEPIRLNSASIIVVHNHPSGDPTPSPEDV 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRI 96
            +T+ II     L+I V DH++IG   FVS +   +
Sbjct: 193 VVTRQIIEAGRLLDIDVLDHLVIGAGRFVSMRERGL 228


>gi|59714363|ref|YP_207137.1| DNA repair protein RadC [Vibrio fischeri ES114]
 gi|59482640|gb|AAW88249.1| DNA repair protein RadC [Vibrio fischeri ES114]
          Length = 165

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 52/97 (53%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L LD  + LI     S G+I    VY RE+++  L  +A ++I  HNHPSG   PSDAD 
Sbjct: 69  LMLDNQHRLIKFVEHSVGSISSASVYPREVLKSVLHYNAAAVIFAHNHPSGVAEPSDADR 128

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  + + L  +++ V DH +IG    VSF     I
Sbjct: 129 RITARLSSALELIDVKVLDHFVIGVGETVSFAKRGWI 165


>gi|332188698|ref|ZP_08390412.1| DNA repair RadC family protein [Sphingomonas sp. S17]
 gi|332011262|gb|EGI53353.1| DNA repair RadC family protein [Sphingomonas sp. S17]
          Length = 229

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 66/97 (68%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N+LI DE+   G+ID  PVYIRE+++R ++  + ++ILVHNHPSG+P+PS ADI
Sbjct: 133 LHLNTRNMLIRDELMGEGSIDQAPVYIREVIRRAIDFGSAALILVHNHPSGDPSPSRADI 192

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ I      L I VHDH+IIG    VS +   +I
Sbjct: 193 DVTRAIAEAGKRLGITVHDHLIIGTSGHVSLRAQGLI 229


>gi|293406039|ref|ZP_06650027.1| DNA repair protein [Escherichia coli FVEC1412]
 gi|291426883|gb|EFE99913.1| DNA repair protein [Escherichia coli FVEC1412]
          Length = 155

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 54/89 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  N LIA E    GTI+   V+ RE+++R L  +A +++L HNHPSG   PS AD 
Sbjct: 67  LYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADR 126

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFV 89
            +T+ ++  L  ++I V DH+I+G     
Sbjct: 127 LITERLVQALGLVDIRVPDHLIVGGSQVF 155


>gi|89895926|ref|YP_519413.1| hypothetical protein DSY3180 [Desulfitobacterium hafniense Y51]
 gi|219670358|ref|YP_002460793.1| DNA repair protein RadC [Desulfitobacterium hafniense DCB-2]
 gi|122481851|sp|Q24SM3|Y3180_DESHY RecName: Full=UPF0758 protein DSY3180
 gi|254789647|sp|B8FVF5|Y4352_DESHD RecName: Full=UPF0758 protein Dhaf_4352
 gi|89335374|dbj|BAE84969.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219540618|gb|ACL22357.1| DNA repair protein RadC [Desulfitobacterium hafniense DCB-2]
          Length = 227

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 55/95 (57%)

Query: 3   LDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINM 62
           L   N ++     S G+++   V+ RE  +  +  ++ +IIL+HNHPSG+P PS  DI++
Sbjct: 133 LSTKNHVLGISSISVGSLNSSLVHPRECFKEAIRRNSNAIILLHNHPSGDPTPSSEDIDV 192

Query: 63  TQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           T+ +      L I V DH+IIG + ++S K   I+
Sbjct: 193 TRRLSDGGQILGIEVLDHVIIGDNRYISLKERGIL 227


>gi|189184090|ref|YP_001937875.1| DNA repair protein RadC [Orientia tsutsugamushi str. Ikeda]
 gi|189180861|dbj|BAG40641.1| DNA repair protein RadC [Orientia tsutsugamushi str. Ikeda]
          Length = 226

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/97 (53%), Positives = 66/97 (68%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL+K NI+IADE+   GT+D  PVY REIV+R L   A++IILVHNHPSG P PS  DI
Sbjct: 130 LFLNKKNIIIADELHGIGTVDQTPVYPREIVKRALFHEASAIILVHNHPSGTPKPSAIDI 189

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  I+      +IIVHDH+II  + F SFK   ++
Sbjct: 190 EITTKIVEACKTFSIIVHDHVIICSNNFFSFKSNLLL 226


>gi|199597494|ref|ZP_03210923.1| DNA repair protein [Lactobacillus rhamnosus HN001]
 gi|199591517|gb|EDY99594.1| DNA repair protein [Lactobacillus rhamnosus HN001]
          Length = 222

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 57/92 (61%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +I +++ + GT+D      R + +  L+LSAT++I+VHNHPSG+P+PS AD 
Sbjct: 124 LFLDVKNQIITEQIVAIGTVDSALADPRVVFREALKLSATNLIMVHNHPSGDPSPSQADR 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
           + T         L + + DH+IIG+  + SF 
Sbjct: 184 DTTTRFQLAAALLGMHLLDHLIIGRQTYYSFA 215


>gi|303241148|ref|ZP_07327656.1| DNA repair protein RadC [Acetivibrio cellulolyticus CD2]
 gi|302591275|gb|EFL61015.1| DNA repair protein RadC [Acetivibrio cellulolyticus CD2]
          Length = 226

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 53/97 (54%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD  N +   E+   GTI+  PVY R +V+  +   A S+IL HNHP G+ NPS ADI
Sbjct: 125 ICLDSQNKVNYSELVHEGTINEAPVYPRLLVEAAIRHKANSVILAHNHPGGSLNPSRADI 184

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             T+ I   L  ++I V DHII+    + SF     +
Sbjct: 185 EATRTICNALESISIKVIDHIIVCGGKYYSFAENGRM 221


>gi|168187572|ref|ZP_02622207.1| DNA repair protein [Clostridium botulinum C str. Eklund]
 gi|169294516|gb|EDS76649.1| DNA repair protein [Clostridium botulinum C str. Eklund]
          Length = 228

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N++I+ +  S G+++   V+ RE+    L+ ++ SI++ HNHPSG+P PS  DI
Sbjct: 132 IMLNTKNVVISCKDVSIGSLNSAIVHPREVFSEALKKNSASIVICHNHPSGDPTPSSEDI 191

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T+ +      L I + DH+IIG   ++S K   I+
Sbjct: 192 HVTKRLKKCGVILGIDLLDHLIIGHSNYISLKEKNIL 228


>gi|269958556|ref|YP_003328343.1| DNA repair protein RadC [Anaplasma centrale str. Israel]
 gi|269848385|gb|ACZ49029.1| DNA repair protein RadC [Anaplasma centrale str. Israel]
          Length = 230

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 65/97 (67%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+K   +IADE+Q+ GTID  P+Y+RE+V++ L   A+ I++ HNHPSG+P PS ADI
Sbjct: 134 LYLNKKYRVIADEIQNTGTIDETPLYVREVVKKSLLHDASYIVVSHNHPSGDPKPSKADI 193

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           ++T  +      +NI++ DH+II      SFK   ++
Sbjct: 194 HITNRLQEACCSMNIVLVDHVIITPKRHYSFKTNGLL 230


>gi|154248875|ref|YP_001409700.1| DNA repair protein RadC [Fervidobacterium nodosum Rt17-B1]
 gi|154152811|gb|ABS60043.1| DNA repair protein RadC [Fervidobacterium nodosum Rt17-B1]
          Length = 225

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           +FLD    +I  +  S+GTI+    + R+I +  +  S+T IIL HNHPSG+P PS  DI
Sbjct: 124 IFLDTKLKVIGSKDVSKGTINSSMAHPRDIFREAILRSSTGIILAHNHPSGDPTPSKDDI 183

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94
            +T+ I      L I +HDH+IIG   F S +  
Sbjct: 184 ELTKKIKKAGELLGINLHDHVIIG-QTFYSLRQK 216


>gi|88606961|ref|YP_504859.1| DNA repair protein RadC [Anaplasma phagocytophilum HZ]
 gi|88598024|gb|ABD43494.1| DNA repair protein RadC [Anaplasma phagocytophilum HZ]
          Length = 232

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 64/97 (65%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+K   LIADEVQS GT+D  P+YIRE++++ L   A  I++ HNHPSG+P PS ADI
Sbjct: 136 LYLNKRYSLIADEVQSTGTVDETPLYIREVIRKALLCGAVYIVISHNHPSGDPKPSKADI 195

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           N+T  +    N ++I + DH+I+      SFK   ++
Sbjct: 196 NVTNKLRIACNSMDIELVDHVIVTSKRHYSFKTHGLL 232


>gi|218132457|ref|ZP_03461261.1| hypothetical protein BACPEC_00316 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992567|gb|EEC58569.1| hypothetical protein BACPEC_00316 [Bacteroides pectinophilus ATCC
           43243]
          Length = 246

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 54/97 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + LD    LI DE+ S GT++   V  REI    L   A  I+++HNHPSG+  PS  DI
Sbjct: 146 VMLDTKLRLIKDEIISTGTVNASIVSPREIFVAALRAGAVFIVMLHNHPSGDAEPSSNDI 205

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DHIIIG + FVS K   ++
Sbjct: 206 AITRRVQLAGEMLGISLIDHIIIGDNRFVSLKESGLM 242


>gi|294140110|ref|YP_003556088.1| DNA repair protein, RadC family [Shewanella violacea DSS12]
 gi|293326579|dbj|BAJ01310.1| DNA repair protein, RadC family [Shewanella violacea DSS12]
          Length = 158

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  + LI       GTID   VY RE+V+  LE++A ++I  HNHPSG   PS AD 
Sbjct: 63  MMLNSQHQLIEFRELFFGTIDAASVYPREVVKAVLEVNAAAVIFSHNHPSGESEPSQADK 122

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +   L  +++ V DHI+IG     SF    ++
Sbjct: 123 LITKKLTDALGLIDVRVLDHIVIGA-TPTSFAEKGLL 158


>gi|187929782|ref|YP_001900269.1| DNA repair protein RadC [Ralstonia pickettii 12J]
 gi|238691809|sp|B2UAP0|Y2712_RALPJ RecName: Full=UPF0758 protein Rpic_2712
 gi|187726672|gb|ACD27837.1| DNA repair protein RadC [Ralstonia pickettii 12J]
          Length = 224

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 58/94 (61%)

Query: 2   FLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADIN 61
           FLD  + LIA E   RGT+    VY REI +R L  +A ++IL HNHP+GN  PS++D+ 
Sbjct: 129 FLDVRHRLIAWEELFRGTLTEARVYPREIAKRALHHNAAAVILAHNHPTGNTEPSESDVI 188

Query: 62  MTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           +T+ +   L  L++IV DH+I+G++    F    
Sbjct: 189 LTRELCRALAMLDVIVLDHMIVGRNHVYGFLEHG 222


>gi|119357558|ref|YP_912202.1| DNA repair protein RadC [Chlorobium phaeobacteroides DSM 266]
 gi|229485547|sp|A1BHA1|Y1761_CHLPD RecName: Full=UPF0758 protein Cpha266_1761
 gi|119354907|gb|ABL65778.1| DNA replication and repair protein RadC [Chlorobium
           phaeobacteroides DSM 266]
          Length = 223

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 59/97 (60%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L L+  N +I +E  + GT++    + RE+ +  +  SA +IILVHNHPSG+  PS+AD 
Sbjct: 126 LHLNTKNQIIRNEQVTVGTLNASLAHPREVFKSAIRESAHAIILVHNHPSGDVEPSNADR 185

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +    + L I + DH+IIG D + SF+   ++
Sbjct: 186 QVTEILRQAGSFLQIDLLDHVIIGVDTWFSFREHSLL 222


>gi|256420577|ref|YP_003121230.1| DNA repair protein RadC [Chitinophaga pinensis DSM 2588]
 gi|256035485|gb|ACU59029.1| DNA repair protein RadC [Chitinophaga pinensis DSM 2588]
          Length = 237

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 51/97 (52%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           L+L+  + ++     S G I    V  + I +  LEL AT +IL HNHPSGN  PS ADI
Sbjct: 140 LYLNHASRVLQHRCISIGGITGTIVDPKVIFREALELGATQVILCHNHPSGNLRPSTADI 199

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L+I V DHII+ +  + S      I
Sbjct: 200 QITEKLKAAGRLLDISVLDHIIVSEAGYCSMVEEGFI 236


>gi|225572122|ref|ZP_03780986.1| hypothetical protein RUMHYD_00416 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040388|gb|EEG50634.1| hypothetical protein RUMHYD_00416 [Blautia hydrogenotrophica DSM
           10507]
          Length = 228

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           + L+  N  +A+ V + GT++   +  RE+    L   A +I+L+HNHPSG+P PS  DI
Sbjct: 131 VMLNTKNQYLAERVITTGTVNASLISARELFLEALRNKAVNILLIHNHPSGDPTPSREDI 190

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
             TQ I      L+I + DHI+IG   +VS +   +I
Sbjct: 191 LATQKIFQVGELLDIRLLDHIVIGDQRYVSMRSEGLI 227


>gi|55823375|ref|YP_141816.1| DNA repair protein RadC [Streptococcus thermophilus CNRZ1066]
 gi|73913743|sp|Q5LYU6|Y1465_STRT1 RecName: Full=UPF0758 protein str1465
 gi|55739360|gb|AAV63001.1| DNA repair protein [Streptococcus thermophilus CNRZ1066]
          Length = 228

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 37/95 (38%), Positives = 53/95 (55%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           ++LD  N +I  +    G +       REI+     L ATS+I+VHNHPSG   PS  DI
Sbjct: 129 IYLDTQNRIIQQKTVFIGGVRRSIAEPREILYYACHLMATSLIVVHNHPSGEAYPSRNDI 188

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLR 95
           + TQ I  + + L I + DH+I+GK  + SF+  R
Sbjct: 189 DFTQKIKRSCDDLGICLLDHLIVGKSTYYSFREER 223


>gi|329113315|ref|ZP_08242096.1| DNA repair protein RadC [Acetobacter pomorum DM001]
 gi|326697140|gb|EGE48800.1| DNA repair protein RadC [Acetobacter pomorum DM001]
          Length = 254

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 64/97 (65%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL++ + L+ D+V  +GT+DH PVY REIV R L+L AT ++LVHNHPSG+P PS  D+
Sbjct: 15