RPSBLAST alignment for GI: peg_816 and conserved domain: TIGR00608

>gnl|CDD|161955 TIGR00608, radc, DNA repair protein radc. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 218
 Score =  120 bits (303), Expect = 6e-29
 Identities = 48/92 (52%), Positives = 65/92 (70%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIA EV   GT++HVPV+ REI +  L+LSA+++IL HNHPSG P+PS  DI
Sbjct: 122 LFLDRKNRLIAKEVVFIGTVNHVPVHPREIFKEALKLSASALILAHNHPSGEPSPSQEDI 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
            +T+ +      L I + DH+IIGK  +VSF+
Sbjct: 182 LITERLRKAAELLGIELLDHLIIGKGRYVSFR 213