RPSBLAST alignment for GI: peg_816 and conserved domain: PRK00024

>gnl|CDD|178801 PRK00024, PRK00024, hypothetical protein; Reviewed. Length = 224
 Score =  151 bits (384), Expect = 4e-38
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +IADE    GT++   V+ REIV+R L+L+A ++IL HNHPSG+P PS ADI
Sbjct: 128 LFLDTKNRVIADEELFIGTLNSSIVHPREIVKRALKLNAAALILAHNHPSGDPEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DHIIIG   +VSF    ++
Sbjct: 188 LITKRLKEAGELLGIRLLDHIIIGDGEYVSFAERGLL 224