RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= 537021.9.peg.816_1
         (97 letters)



>gnl|CDD|178801 PRK00024, PRK00024, hypothetical protein; Reviewed.
          Length = 224

 Score =  151 bits (384), Expect = 4e-38
 Identities = 46/97 (47%), Positives = 63/97 (64%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD  N +IADE    GT++   V+ REIV+R L+L+A ++IL HNHPSG+P PS ADI
Sbjct: 128 LFLDTKNRVIADEELFIGTLNSSIVHPREIVKRALKLNAAALILAHNHPSGDPEPSQADI 187

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T+ +      L I + DHIIIG   +VSF    ++
Sbjct: 188 LITKRLKEAGELLGIRLLDHIIIGDGEYVSFAERGLL 224


>gnl|CDD|161955 TIGR00608, radc, DNA repair protein radc.  This family is based on
           the phylogenomic analysis of JA Eisen (1999, Ph.D.
           Thesis, Stanford University).
          Length = 218

 Score =  120 bits (303), Expect = 6e-29
 Identities = 48/92 (52%), Positives = 65/92 (70%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFLD+ N LIA EV   GT++HVPV+ REI +  L+LSA+++IL HNHPSG P+PS  DI
Sbjct: 122 LFLDRKNRLIAKEVVFIGTVNHVPVHPREIFKEALKLSASALILAHNHPSGEPSPSQEDI 181

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFK 92
            +T+ +      L I + DH+IIGK  +VSF+
Sbjct: 182 LITERLRKAAELLGIELLDHLIIGKGRYVSFR 213


>gnl|CDD|180248 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional.
          Length = 441

 Score = 27.2 bits (61), Expect = 1.0
 Identities = 9/16 (56%), Positives = 11/16 (68%), Gaps = 1/16 (6%)

Query: 2   FLDKHNIL-IADEVQS 16
             DK+ IL I DEVQ+
Sbjct: 250 LADKYGILLIDDEVQT 265


>gnl|CDD|180011 PRK05319, rplD, 50S ribosomal protein L4; Provisional.
          Length = 205

 Score = 26.6 bits (60), Expect = 1.4
 Identities = 5/19 (26%), Positives = 11/19 (57%)

Query: 70  LNPLNIIVHDHIIIGKDAF 88
           LN  +++  D +++ K A 
Sbjct: 179 LNVYDLLRADKVVLTKAAV 197


>gnl|CDD|178231 PLN02624, PLN02624, ornithine-delta-aminotransferase.
          Length = 474

 Score = 26.7 bits (59), Expect = 1.4
 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 1/15 (6%)

Query: 3   LDKHNIL-IADEVQS 16
             KHN+L IADE+Q+
Sbjct: 254 CSKHNVLMIADEIQT 268


>gnl|CDD|181227 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated.
          Length = 425

 Score = 25.9 bits (57), Expect = 2.1
 Identities = 10/14 (71%), Positives = 12/14 (85%), Gaps = 1/14 (7%)

Query: 4   DKHNI-LIADEVQS 16
           D+H I LIADEVQ+
Sbjct: 230 DEHGIMLIADEVQT 243


>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase.  This model
           describes the final step in the biosynthesis of
           ornithine from glutamate via the non-acetylated pathway.
           Ornithine amino transferase takes L-glutamate
           5-semialdehyde and makes it into ornithine, which is
           used in the urea cycle, as well as in the biosynthesis
           of arginine. This model includes low-GC bacteria and
           eukaryotic species. The genes from two species are
           annotated as putative acetylornithine aminotransferases
           - one from Porphyromonas gingivalis, and the other from
           Staphylococcus aureus. After homology searching using
           BLAST it was determined that these two sequences were
           most closely related to ornithine aminotransferases.
           This model's seed includes one characterized hit, from
           Bacillus subtilis.
          Length = 401

 Score = 25.7 bits (57), Expect = 2.7
 Identities = 9/14 (64%), Positives = 12/14 (85%), Gaps = 1/14 (7%)

Query: 4   DKHNIL-IADEVQS 16
            KHN+L IADE+Q+
Sbjct: 217 TKHNVLLIADEIQT 230


>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional.
          Length = 421

 Score = 25.5 bits (56), Expect = 3.2
 Identities = 10/14 (71%), Positives = 12/14 (85%), Gaps = 1/14 (7%)

Query: 4   DKHNIL-IADEVQS 16
           D+H IL IADEVQ+
Sbjct: 229 DEHGILLIADEVQT 242


>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional.
          Length = 395

 Score = 25.4 bits (56), Expect = 3.5
 Identities = 7/14 (50%), Positives = 10/14 (71%), Gaps = 1/14 (7%)

Query: 4   DKHNIL-IADEVQS 16
            +H +L I DEVQ+
Sbjct: 210 KQHGLLLIVDEVQT 223


>gnl|CDD|180820 PRK07064, PRK07064, hypothetical protein; Provisional.
          Length = 544

 Score = 25.3 bits (56), Expect = 4.0
 Identities = 9/20 (45%), Positives = 11/20 (55%)

Query: 6  HNILIADEVQSRGTIDHVPV 25
          HN+ I D +  RG I  VP 
Sbjct: 28 HNMPILDAIGRRGKIRFVPA 47


>gnl|CDD|179453 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.
          Length = 396

 Score = 25.1 bits (56), Expect = 4.2
 Identities = 8/16 (50%), Positives = 11/16 (68%), Gaps = 1/16 (6%)

Query: 2   FLDKHNIL-IADEVQS 16
             D++ IL I DEVQ+
Sbjct: 211 LCDENGILLILDEVQT 226


>gnl|CDD|162521 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent.  The
           annotation of Botryococcus braunii as lactate
           dehydrogenase appears top be in error. This was
           initially annotated as MDH by Swiss-Prot and then
           changed. The rationale for either of these annotations
           is not traceable.
          Length = 305

 Score = 24.8 bits (54), Expect = 4.7
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 27  IREIVQRCLELSATSIILVHNHP 49
           +RE+  R +E S   II+V ++P
Sbjct: 98  VREVTGRIMEHSPNPIIVVVSNP 120


>gnl|CDD|181002 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional.
          Length = 425

 Score = 24.7 bits (54), Expect = 5.2
 Identities = 10/14 (71%), Positives = 12/14 (85%), Gaps = 1/14 (7%)

Query: 4   DKHNI-LIADEVQS 16
           D+H I LIADEVQ+
Sbjct: 229 DQHGILLIADEVQT 242


>gnl|CDD|149285 pfam08145, BOP1NT, BOP1NT (NUC169) domain.  This N terminal domain
           is found in BOP1-like WD40 proteins.
          Length = 259

 Score = 24.5 bits (54), Expect = 6.4
 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 3/19 (15%)

Query: 22  HVPVY---IREIVQRCLEL 37
            VP Y   I+E  +RCL+L
Sbjct: 209 KVPAYEKFIKERFERCLDL 227


>gnl|CDD|183870 PRK13145, araD, L-ribulose-5-phosphate 4-epimerase; Provisional.
          Length = 234

 Score = 24.4 bits (53), Expect = 6.6
 Identities = 14/40 (35%), Positives = 18/40 (45%)

Query: 9   LIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNH 48
           L  DEV      +   V I E  +R L+  A   I+V NH
Sbjct: 132 LTKDEVNGAYEKETGSVIIEEFEKRGLDPMAVPGIVVRNH 171


>gnl|CDD|131309 TIGR02256, ICE_VC0181, integrative and conjugative element protein,
           VC0181 family.  This uncharacterized protein is found in
           several Proteobacteria, among them Rhizobium sp. NGR234,
           Vibrio cholerae, Myxococcus xanthus, and E. coli strain
           ECOR31. In the latter, it is part of an integrative and
           conjugative element that is readily induced to excise
           and circularize.
          Length = 131

 Score = 24.1 bits (52), Expect = 8.4
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 46  HNHPSGNPNPSDADINMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
           H HP   P PS  D    + II +   + ++    I+  K+A++  K  R I
Sbjct: 80  HTHPEDQPEPSWTDRRSWRTIIRSPEAMLLL----IVGRKEAWIGQKTRRAI 127


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.324    0.142    0.413 

Gapped
Lambda     K      H
   0.267   0.0621    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,588,173
Number of extensions: 87720
Number of successful extensions: 175
Number of sequences better than 10.0: 1
Number of HSP's gapped: 174
Number of HSP's successfully gapped: 26
Length of query: 97
Length of database: 5,994,473
Length adjustment: 65
Effective length of query: 32
Effective length of database: 4,589,953
Effective search space: 146878496
Effective search space used: 146878496
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.3 bits)