RPSBLAST alignment of GI: peg_816 and MMDB domain: 2qlc_A_

>2qlc_A (A:) DNA repair protein RADC homolog; MCSG, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: DNA; 2.30A {Chlorobium tepidum tls}Length = 126
 Score =  104 bits (260), Expect = 5e-24
 Identities = 36/97 (37%), Positives = 57/97 (58%)

Query: 1   LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60
           LFL   N ++  E  + GT+    ++ REI +  +  SA SIILVHNHPSG+  PS+AD 
Sbjct: 30  LFLSTKNQILRHETITIGTLTASLIHPREIFKAAIRESAHSIILVHNHPSGDVQPSNADK 89

Query: 61  NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97
            +T  +    + L I + DH+I+G + + SF+   ++
Sbjct: 90  QVTSILKKAGDLLQIELLDHVIVGNNDWFSFRDHALL 126