BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.816_1 (97 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.816_1 Length = 97 Score = 194 bits (493), Expect = 3e-52, Method: Compositional matrix adjust. Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60 LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI Sbjct: 1 LFLDKHNILIADEVQSRGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADI 60 Query: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII Sbjct: 61 NMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGLRII 97 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 25.0 bits (53), Expect = 0.29, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 1 LFLDKHNILIADEVQSRGTIDHVPVYIREI 30 LFL KH + + + S+G I+ YIR + Sbjct: 6 LFLIKHKLKLHKNIMSKGKINESFWYIRTL 35 >gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 22.3 bits (46), Expect = 1.9, Method: Compositional matrix adjust. Identities = 10/38 (26%), Positives = 20/38 (52%) Query: 57 DADINMTQNIITTLNPLNIIVHDHIIIGKDAFVSFKGL 94 + I +I ++L ++I+H + IG D F +G+ Sbjct: 170 NCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGV 207 >gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 293 Score = 20.8 bits (42), Expect = 5.3, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 23/50 (46%) Query: 17 RGTIDHVPVYIREIVQRCLELSATSIILVHNHPSGNPNPSDADINMTQNI 66 RG I+ I I + + SAT++I+ + P G+ +A Q + Sbjct: 44 RGQIEDSQELIERIERISRDDSATALIVSLSSPGGSAYAGEAIFRAIQKV 93 >gi|254780420|ref|YP_003064833.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 20.4 bits (41), Expect = 6.2, Method: Composition-based stats. Identities = 6/14 (42%), Positives = 8/14 (57%) Query: 45 VHNHPSGNPNPSDA 58 V HP +P P D+ Sbjct: 365 VQYHPESSPGPQDS 378 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.142 0.413 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,847 Number of Sequences: 1233 Number of extensions: 2285 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 97 length of database: 328,796 effective HSP length: 61 effective length of query: 36 effective length of database: 253,583 effective search space: 9128988 effective search space used: 9128988 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)