RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= 537021.9.peg.817_1 (148 letters) >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} (A:) Length = 89 Score = 30.1 bits (68), Expect = 0.12 Identities = 10/40 (25%), Positives = 17/40 (42%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 K+ ++ LL F +L + A L +G + A L Sbjct: 29 KTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLF 68 >3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* (A:304-377) Length = 74 Score = 30.0 bits (68), Expect = 0.14 Identities = 10/40 (25%), Positives = 21/40 (52%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 SI +++ F TL + A + L+++ IG++ A + Sbjct: 22 LSIGYNVVRMFKTLDQISKASVEDLKKVEGIGEKRARAIS 61 >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} (A:) Length = 78 Score = 29.3 bits (66), Expect = 0.23 Identities = 8/40 (20%), Positives = 18/40 (45%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 + LLK L G+ A + + ++ I + +A ++ Sbjct: 34 PKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 73 >1vpy_A Protein (hypothetical protein EF0366); structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.52A {Enterococcus faecalis V583} (A:) Length = 289 Score = 28.8 bits (64), Expect = 0.35 Identities = 13/79 (16%), Positives = 21/79 (26%), Gaps = 16/79 (20%) Query: 2 EDFRMS-KAPSKDSHLDYIGHHNRLRDRFLQKGENALAYYEI---------LELILFRLI 51 E+FR K S I + + + E A+ E L L + Sbjct: 69 ENFRFVXKVYS------GISCQGEWQTYYASEEEXITAFLESXAPLIESKKLFAFLVQFS 122 Query: 52 PRKDTKSIAKALLKRFATL 70 A L++ Sbjct: 123 GTFGCTKENVAYLQKIRHW 141 >3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus} (A:) Length = 226 Score = 28.3 bits (62), Expect = 0.49 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 + KALL F ++ + A + LQ N I + VA ++ Sbjct: 183 EKRKKALLNYFGSVKKMKEATVEELQRAN-IPRAVAEKIY 221 >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} (A:1-167) Length = 167 Score = 27.2 bits (60), Expect = 0.87 Identities = 15/68 (22%), Positives = 25/68 (36%), Gaps = 3/68 (4%) Query: 27 DRFLQKGENALAYYEILELILFRLIPRKDTKSIAKALLKRFATLGGVFGAPLHLLQEINR 86 +L K L +LE + R + R + + + A L+LLQE Sbjct: 101 ADYLIKPLEDL---AVLEHSVRRALDRAYLRVENQRYRDKLEAANRELQASLNLLQEDQN 157 Query: 87 IGKRVALE 94 G++V Sbjct: 158 AGRQVQXN 165 >2oas_A ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein structure initiative; HET: COA; 2.40A {Shewanella oneidensis mr-1} (A:1-181) Length = 181 Score = 26.5 bits (58), Expect = 1.5 Identities = 10/56 (17%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Query: 52 PRKDTKSIAKA--LLKRFATL--GGVFGAPLHLLQEINRIGKRVALELKLVSVASQ 103 P +S +A L++ TL P LL + + + + L+ + ++ Sbjct: 2 PAIVCQSALEAVSLIRSGETLWTHSXGATPKVLLDALAKHALTLD-NITLLQLHTE 56 >2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A (A:157-220) Length = 64 Score = 26.1 bits (58), Expect = 2.0 Identities = 6/33 (18%), Positives = 13/33 (39%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGK 89 K L++ F +L + A L + + + Sbjct: 22 PIRKKKLIEHFGSLENIRSASLEEIARVIGSTE 54 >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} (A:) Length = 63 Score = 25.7 bits (57), Expect = 2.5 Identities = 5/37 (13%), Positives = 11/37 (29%), Gaps = 1/37 (2%) Query: 60 AKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 ++L+ + + L I A +L Sbjct: 17 CRSLMHHVKNIAELAALSQDELTSIL-GNAANAKQLY 52 >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} (A:) Length = 431 Score = 25.5 bits (54), Expect = 2.9 Identities = 5/27 (18%), Positives = 8/27 (29%), Gaps = 3/27 (11%) Query: 14 SHLDYIGHHNRLRDRFLQKGENALAYY 40 H D+IG+ +Y Sbjct: 389 DHSDFIGNDALDTKHS---AIELTNFY 412 >3elq_A Arylsulfate sulfotransferase; beta propeller, protein-substrate complex, periplasm, transesterification, phenol, bacteria; 2.00A {Escherichia coli} PDB: 3ett_A* 3ets_A* (A:110-198,A:496-571) Length = 165 Score = 24.8 bits (54), Expect = 4.6 Identities = 9/32 (28%), Positives = 15/32 (46%) Query: 68 ATLGGVFGAPLHLLQEINRIGKRVALELKLVS 99 L V + L EI+ K V +E+ ++S Sbjct: 114 IHLFDVGQPTVGKLNEIDYKTKEVKVEIDVLS 145 >2iuj_A Lipoxygenase L-5; dioxygenase, metal-binding, oxidoreductase, soybean lipoxygenase-B, fatty acid biosynthesis, lipid synthesis; 2.4A {Glycine max} (A:1-166) Length = 166 Score = 24.8 bits (54), Expect = 5.3 Identities = 3/43 (6%), Positives = 13/43 (30%) Query: 53 RKDTKSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALEL 95 + ++ +G L + + ++++L Sbjct: 18 MQKNVLDINSITSVDGIVGTGLDFLGSALDTVTFLASSISIQL 60 >3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} (A:520-634) Length = 115 Score = 24.0 bits (52), Expect = 8.4 Identities = 10/38 (26%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Query: 31 QKGENALAYYEILELILFRLIPRKDT-KSIAKALLKRF 67 Q E L Y++L I + I + + + ALL Sbjct: 7 QTDERDLXPYDVLARIERKAIKERLSPVQVYTALLTEG 44 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.326 0.141 0.417 Gapped Lambda K H 0.267 0.0657 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,106,621 Number of extensions: 44696 Number of successful extensions: 143 Number of sequences better than 10.0: 1 Number of HSP's gapped: 143 Number of HSP's successfully gapped: 21 Length of query: 148 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 67 Effective length of database: 2,217,844 Effective search space: 148595548 Effective search space used: 148595548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.2 bits)