BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.817_1 (148 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.817_1 Length = 148 Score = 303 bits (777), Expect = 6e-85, Method: Compositional matrix adjust. Identities = 148/148 (100%), Positives = 148/148 (100%) Query: 1 LEDFRMSKAPSKDSHLDYIGHHNRLRDRFLQKGENALAYYEILELILFRLIPRKDTKSIA 60 LEDFRMSKAPSKDSHLDYIGHHNRLRDRFLQKGENALAYYEILELILFRLIPRKDTKSIA Sbjct: 1 LEDFRMSKAPSKDSHLDYIGHHNRLRDRFLQKGENALAYYEILELILFRLIPRKDTKSIA 60 Query: 61 KALLKRFATLGGVFGAPLHLLQEINRIGKRVALELKLVSVASQRILKANWSIKKFLTPGQ 120 KALLKRFATLGGVFGAPLHLLQEINRIGKRVALELKLVSVASQRILKANWSIKKFLTPGQ Sbjct: 61 KALLKRFATLGGVFGAPLHLLQEINRIGKRVALELKLVSVASQRILKANWSIKKFLTPGQ 120 Query: 121 PCLISVERHYPMKNANNFAYCFSINIIF 148 PCLISVERHYPMKNANNFAYCFSINIIF Sbjct: 121 PCLISVERHYPMKNANNFAYCFSINIIF 148 >gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 25.0 bits (53), Expect = 0.64, Method: Compositional matrix adjust. Identities = 9/32 (28%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 52 PRKDTKSIAKALLKRFAT-LGGVFGAPLHLLQ 82 P++DT + K ++RF+ + G+ G P+ +++ Sbjct: 102 PKRDTPEVMKKFVQRFSDRIIGISGDPIDVMR 133 >gi|254780669|ref|YP_003065082.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Candidatus Liberibacter asiaticus str. psy62] Length = 301 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 113 KKFLTPGQPCLISVERHYPMKNANNFAYCFSINI 146 ++F+ PC I H M +A C S+NI Sbjct: 43 QRFVLIAGPCQIESHDHAFMIAEKLYAICQSLNI 76 >gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Score = 21.6 bits (44), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 120 QPCLISVERHYPMKNANNFAYCF 142 + C+ S E HY + NA++ + F Sbjct: 380 KTCVSSPEYHYNVVNADSLIHVF 402 >gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 21.2 bits (43), Expect = 8.2, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 34 ENALAYYEILELILFRLIPRK 54 EN L Y E+L + R+ PR+ Sbjct: 114 ENGLLYLELLRSVPERMKPRR 134 >gi|254780412|ref|YP_003064825.1| hypothetical protein CLIBASIA_01485 [Candidatus Liberibacter asiaticus str. psy62] Length = 94 Score = 21.2 bits (43), Expect = 9.4, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 9/47 (19%) Query: 54 KDTKSIAKALLKRFATLGGVFGAP---------LHLLQEINRIGKRV 91 K+ +S A+ ++R GV A HL +EI IGKR+ Sbjct: 28 KEAESFAQIKIQRTLNSMGVVRAEEIENVKRTTSHLREEITAIGKRL 74 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.141 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,568 Number of Sequences: 1233 Number of extensions: 3168 Number of successful extensions: 12 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 8 length of query: 148 length of database: 328,796 effective HSP length: 66 effective length of query: 82 effective length of database: 247,418 effective search space: 20288276 effective search space used: 20288276 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)