Query 537021.9.peg.818_1 Match_columns 44 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 06:12:42 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_818.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG0427 ACH1 Acetyl-CoA hydrol 18.4 73 0.0019 16.1 1.7 30 2-31 62-91 (501) 2 pfam01341 Glyco_hydro_6 Glycos 17.9 91 0.0023 15.6 2.1 30 15-44 74-115 (295) 3 pfam11183 PmrD Polymyxin resis 11.2 59 0.0015 16.5 -0.4 26 4-29 37-62 (82) 4 COG5603 TRS20 Subunit of TRAPP 11.2 92 0.0023 15.6 0.6 26 18-43 49-74 (136) 5 KOG2315 consensus 11.0 56 0.0014 16.6 -0.5 20 18-38 316-335 (566) 6 pfam07911 DUF1677 Protein of u 8.5 84 0.0021 15.8 -0.4 26 9-34 8-39 (90) 7 TIGR01538 portal_SPP1 phage po 8.2 1.4E+02 0.0034 14.8 0.5 43 1-43 196-242 (477) 8 pfam08952 DUF1866 Domain of un 7.8 2.4E+02 0.006 13.6 1.6 22 23-44 48-69 (145) 9 PRK11548 hypothetical protein; 7.6 2.1E+02 0.0053 13.9 1.3 22 5-26 92-113 (113) 10 PRK03719 ecotin precursor; Pro 7.6 1.7E+02 0.0043 14.3 0.8 21 7-28 66-86 (167) No 1 >COG0427 ACH1 Acetyl-CoA hydrolase [Energy production and conversion] Probab=18.45 E-value=73 Score=16.06 Aligned_cols=30 Identities=23% Similarity=0.514 Sum_probs=26.8 Q ss_pred CEEEEEECCCCCCCCCCCEEEECCCHHHHH Q ss_conf 717998607743322231012243067765 Q 537021.9.peg.8 2 PMHFLLFEGSDLADDCDAQYSLNGNLLKGL 31 (44) Q Consensus 2 pmhfllfegsdladdcdaqyslngnllkgl 31 (44) ++++.+|.|-.++.|+|..|..+|.+.+-. T Consensus 62 ~l~i~~~~gas~~~~~~~~~~~a~~~~~r~ 91 (501) T COG0427 62 DLRVLLFTGASIGADEDLKLAEAGEVIRRA 91 (501) T ss_pred CEEEEEEECCCCCCCHHHHHHCCCCHHHHC T ss_conf 658999942656851454442254254418 No 2 >pfam01341 Glyco_hydro_6 Glycosyl hydrolases family 6. Probab=17.94 E-value=91 Score=15.59 Aligned_cols=30 Identities=40% Similarity=0.638 Sum_probs=22.2 Q ss_pred CCCCCEEEECCC------------HHHHHHHHCCCCEEEEEC Q ss_conf 222310122430------------677654105860231419 Q 537021.9.peg.8 15 DDCDAQYSLNGN------------LLKGLCSFGNLPIVKFIE 44 (44) Q Consensus 15 ddcdaqyslngn------------llkglcsfgnlpivkfie 44 (44) .||.+++|--|. +-.++-.+|+.+||-.|| T Consensus 74 RDC~a~~S~Gg~~~~~~Y~~~Id~ia~~i~~y~~~~~vviiE 115 (295) T pfam01341 74 RDCAALASNGGAAGLAAYKTYIDPIAAGLKKYGDVRIVVVIE 115 (295) T ss_pred CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEC T ss_conf 986765579998877999999999999987558974699977 No 3 >pfam11183 PmrD Polymyxin resistance protein PmrD. PmrB forms a two-component system (TCS) with PmrA that allows Gram-negative bacteria to survive the cationic antimicrobial peptide polymyxin G. The TCS is linked to another one via the polymyxin resistance protein PmrD. PmrD is the first protein identified to mediate the connectivity between the two TCSs. It binds to the N terminal domain of the PmrA response regulator which prevents its dephosphorylation, thereby promoting the the transcription of genes involved in polymyxin resistance. Probab=11.22 E-value=59 Score=16.50 Aligned_cols=26 Identities=35% Similarity=0.378 Sum_probs=20.3 Q ss_pred EEEEECCCCCCCCCCCEEEECCCHHH Q ss_conf 79986077433222310122430677 Q 537021.9.peg.8 4 HFLLFEGSDLADDCDAQYSLNGNLLK 29 (44) Q Consensus 4 hfllfegsdladdcdaqyslngnllk 29 (44) .|.+++|.-|..--||||-+|.|-.. T Consensus 37 ~~~l~~gDlLsPLkdA~YciNr~~~~ 62 (82) T pfam11183 37 DFALKVGDLLSPLQDALYCINREKLQ 62 (82) T ss_pred CCCCCCCCCCCCCHHHHHHHCCCCCC T ss_conf 35647654036012306565379775 No 4 >COG5603 TRS20 Subunit of TRAPP, an ER-Golgi tethering complex [Cell motility and secretion] Probab=11.16 E-value=92 Score=15.56 Aligned_cols=26 Identities=38% Similarity=0.540 Sum_probs=22.7 Q ss_pred CCEEEECCCHHHHHHHHCCCCEEEEE Q ss_conf 31012243067765410586023141 Q 537021.9.peg.8 18 DAQYSLNGNLLKGLCSFGNLPIVKFI 43 (44) Q Consensus 18 daqyslngnllkglcsfgnlpivkfi 43 (44) +-|+|.|.-.++-+-+||.|-|-.+| T Consensus 49 ~lqwsvN~~Y~~~~d~f~~l~IsAYi 74 (136) T COG5603 49 WLQWSVNTSYFDCLDSFGDLRISAYI 74 (136) T ss_pred HHHHHHHHHHHHHHHHHCCEEEEEEE T ss_conf 98987623788888750776899998 No 5 >KOG2315 consensus Probab=10.98 E-value=56 Score=16.60 Aligned_cols=20 Identities=45% Similarity=0.836 Sum_probs=15.1 Q ss_pred CCEEEECCCHHHHHHHHCCCC Q ss_conf 310122430677654105860 Q 537021.9.peg.8 18 DAQYSLNGNLLKGLCSFGNLP 38 (44) Q Consensus 18 daqyslngnllkglcsfgnlp 38 (44) ++-|+-+||++ -+|.||||| T Consensus 316 ~~~fnp~g~ii-~lAGFGNL~ 335 (566) T KOG2315 316 TAFFNPHGNII-LLAGFGNLP 335 (566) T ss_pred CEEECCCCCEE-EEEECCCCC T ss_conf 35777888889-995258887 No 6 >pfam07911 DUF1677 Protein of unknown function (DUF1677). The sequences found in this family are all derived from hypothetical plant proteins of unknown function. The region features a number of highly conserved cysteine residues. Probab=8.54 E-value=84 Score=15.75 Aligned_cols=26 Identities=35% Similarity=0.793 Sum_probs=19.5 Q ss_pred CCCCCCCCCCCEE------EECCCHHHHHHHH Q ss_conf 0774332223101------2243067765410 Q 537021.9.peg.8 9 EGSDLADDCDAQY------SLNGNLLKGLCSF 34 (44) Q Consensus 9 egsdladdcdaqy------slngnllkglcsf 34 (44) |--.+..+|.+.| ...|..+=|||+= T Consensus 8 eCCGl~EECT~~YI~~VR~~~~GrWvCGLC~E 39 (90) T pfam07911 8 ECCGLTEECTPEYIARVRARFSGKWVCGLCSE 39 (90) T ss_pred CCCCCCHHCCHHHHHHHHHHCCCEEHHHCCHH T ss_conf 17898523169999999988099733664599 No 7 >TIGR01538 portal_SPP1 phage portal protein, SPP1 family; InterPro: IPR006428 This group of sequences represent one of several distantly related families of phage portal protein. This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage head (capsid) and the tail proteins. It functions as a dodecamer of a single polypeptide of average mol. wt. of 40-90 kDa. . Probab=8.20 E-value=1.4e+02 Score=14.76 Aligned_cols=43 Identities=26% Similarity=0.413 Sum_probs=23.5 Q ss_pred CCEEEEEECCCCCCCCCCCEE-EECC-CHHHHH--HHHCCCCEEEEE Q ss_conf 971799860774332223101-2243-067765--410586023141 Q 537021.9.peg.8 1 MPMHFLLFEGSDLADDCDAQY-SLNG-NLLKGL--CSFGNLPIVKFI 43 (44) Q Consensus 1 mpmhfllfegsdladdcdaqy-slng-nllkgl--csfgnlpivkfi 43 (44) |+.|.+-|++.+-....+-.+ +-|+ |+-||- ..||.+||+.|- T Consensus 196 t~~~i~~y~~~~~~~~~~~~~~~~~~~~mtkGGqai~fG~vPiieF~ 242 (477) T TIGR01538 196 TDTKIVKYEKEDDVEEIAYSEGEYNPRNMTKGGQAILFGAVPIIEFK 242 (477) T ss_pred CCCEEEEEEECCCEEEEECCCCCCCHHHHCCCCCEEECCCCCEECCC T ss_conf 07458998414856775314432371231046634116873523121 No 8 >pfam08952 DUF1866 Domain of unknown function (DUF1866). This domain, found in Synaptojanin, has no known function. Probab=7.79 E-value=2.4e+02 Score=13.59 Aligned_cols=22 Identities=36% Similarity=0.794 Sum_probs=18.5 Q ss_pred ECCCHHHHHHHHCCCCEEEEEC Q ss_conf 2430677654105860231419 Q 537021.9.peg.8 23 LNGNLLKGLCSFGNLPIVKFIE 44 (44) Q Consensus 23 lngnllkglcsfgnlpivkfie 44 (44) +--.|+..+-+||..-.|+|++ T Consensus 48 l~~~Llq~l~~~GeViLvRfv~ 69 (145) T pfam08952 48 LIDELLQKLAEYGEVTLVRFVE 69 (145) T ss_pred HHHHHHHHHHHCCCEEEEEEEC T ss_conf 9999999986328289999848 No 9 >PRK11548 hypothetical protein; Provisional Probab=7.59 E-value=2.1e+02 Score=13.85 Aligned_cols=22 Identities=32% Similarity=0.480 Sum_probs=14.8 Q ss_pred EEEECCCCCCCCCCCEEEECCC Q ss_conf 9986077433222310122430 Q 537021.9.peg.8 5 FLLFEGSDLADDCDAQYSLNGN 26 (44) Q Consensus 5 fllfegsdladdcdaqyslngn 26 (44) .+.||+.++--.-|.+-||.|| T Consensus 92 tl~Fd~~~ll~~Id~~p~~~~~ 113 (113) T PRK11548 92 TLTFNSSGVLTNIDNKPALTGN 113 (113) T ss_pred EEEECCCCCEEECCCCCCCCCC T ss_conf 9998399978834897678899 No 10 >PRK03719 ecotin precursor; Provisional Probab=7.57 E-value=1.7e+02 Score=14.32 Aligned_cols=21 Identities=43% Similarity=0.683 Sum_probs=15.8 Q ss_pred EECCCCCCCCCCCEEEECCCHH Q ss_conf 8607743322231012243067 Q 537021.9.peg.8 7 LFEGSDLADDCDAQYSLNGNLL 28 (44) Q Consensus 7 lfegsdladdcdaqyslngnll 28 (44) |.-|-.+--||. +++|.|+|- T Consensus 66 l~iGkt~~vDCN-~~~l~G~Le 86 (167) T PRK03719 66 LLIGQTLEVDCN-QHRLGGELE 86 (167) T ss_pred EECCCEEEEECC-CCCCCCCCE T ss_conf 870667999636-731167214 Done!