BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.82_1 (41 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.82_1 Length = 41 Score = 84.0 bits (206), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MPQRYRDTSLLSKKTEVINGETPLLSKRTEVITGINRVMPE 41 MPQRYRDTSLLSKKTEVINGETPLLSKRTEVITGINRVMPE Sbjct: 1 MPQRYRDTSLLSKKTEVINGETPLLSKRTEVITGINRVMPE 41 >gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter asiaticus str. psy62] Length = 389 Score = 21.2 bits (43), Expect = 3.1, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 11/19 (57%) Query: 8 TSLLSKKTEVINGETPLLS 26 TSLLSK G PLLS Sbjct: 312 TSLLSKSIYNTTGNIPLLS 330 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.130 0.349 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,814 Number of Sequences: 1233 Number of extensions: 426 Number of successful extensions: 4 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 41 length of database: 328,796 effective HSP length: 15 effective length of query: 26 effective length of database: 310,301 effective search space: 8067826 effective search space used: 8067826 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 31 (16.5 bits)