RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.873_1 (41 letters) >gnl|CDD|116940 pfam08359, TetR_C_4, YsiA-like protein, C-terminal region. The members of this family are thought to be TetR-type transcriptional regulators that bear particular similarity to YsiA, a hypothetical protein expressed by B. subtilis. Length = 133 Score = 24.3 bits (53), Expect = 7.8 Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 2 VVRAIEMRQSTIDGKLKLN 20 +V +E+RQS ++ + K+N Sbjct: 45 IVTQLELRQSNLELRQKIN 63 >gnl|CDD|150360 pfam09671, Spore_GerQ, Spore coat protein (Spore_GerQ). Members of this protein family are the spore coat protein GerQ of endospore-forming Firmicutes (low GC Gram-positive bacteria). This protein is cross-linked by a spore coat-associated transglutaminase. Length = 81 Score = 24.0 bits (52), Expect = 9.1 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 6 IEMRQSTIDGKLKLNTSPPYTVTCFLTFENATDYN 40 + + QS I+ L+LN T ++TFEN +++ Sbjct: 3 LPLEQSYIENILRLNRGK--QATVYMTFENNSEWG 35 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.133 0.390 Gapped Lambda K H 0.267 0.0694 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 605,850 Number of extensions: 18466 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's gapped: 30 Number of HSP's successfully gapped: 3 Length of query: 41 Length of database: 5,994,473 Length adjustment: 15 Effective length of query: 26 Effective length of database: 5,670,353 Effective search space: 147429178 Effective search space used: 147429178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.1 bits)