RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.885_1 (54 letters) >gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1381 Score = 24.8 bits (54), Expect = 4.6 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 21 DKKIQELIREELRGCMTI 38 D IQ+ IREE + C + Sbjct: 1311 DALIQKTIREEFKDCTVL 1328 >gnl|CDD|147487 pfam05326, SVA, Seminal vesicle autoantigen (SVA). This family consists of seminal vesicle autoantigen and prolactin-inducible (PIP) proteins. Seminal vesicle autoantigen (SVA) is specifically present in the seminal plasma of mice. This 19-kDa secretory glycoprotein suppresses the motility of spermatozoa by interacting with phospholipid. PIP, has several known functions. In saliva, this protein plays a role in host defence by binding to microorganisms such as Streptococcus. PIP is an aspartyl proteinase and it acts as a factor capable of suppressing T-cell apoptosis through its interaction with CD4. Length = 124 Score = 24.7 bits (54), Expect = 5.9 Identities = 10/46 (21%), Positives = 22/46 (47%) Query: 6 LTSNINLTLTGITFNDKKIQELIREELRGCMTIKSGILSNRSAKIG 51 L+ N+ + T N+ + ++ ++ CM +K+ + SN K Sbjct: 34 LSLNLKVPSTANKNNEVTVTLTVKTNVKECMVVKAYLESNPPIKGS 79 >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13, is found in skeletal muscle, heart, lung, testis, pancreas, and small intestine. It regulates microtubule function by phosphorylating Tau. It activates the c-jun promoter and plays a role in G2 cell cycle arrest. It also controls the degration of c-Myb, which is associated with myeloid leukemia and poor prognosis in colorectal cancer. p38delta is the main isoform involved in regulating the differentiation and apoptosis of keratinocytes. Length = 342 Score = 24.5 bits (53), Expect = 5.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 16 GITFNDKKIQELIREELRGCMTIKSGILSNRSAKIG 51 G ++ K+Q L+ + L G I S + +R K G Sbjct: 111 GHPLSEDKVQYLVYQMLCGLKYIHSAGIIHRDLKPG 146 >gnl|CDD|147024 pfam04664, OGFr_N, Opioid growth factor receptor (OGFr) conserved region. Opioid peptides act as growth factors in neural and non-neural cells and tissues, in addition to serving in neurotransmission/neuromodulation in the nervous system. The Opioid growth factor receptor is an integral membrane protein associated with the nucleus. The conserved region is situated at the N-terminus of the member proteins with a series of imperfect repeats lying immediately to its C-terminus. Length = 214 Score = 24.3 bits (53), Expect = 7.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Query: 16 GITFNDKKIQELIREEL 32 GI ND+K E+IR Sbjct: 98 GIILNDRKTGEVIRASN 114 >gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 221 Score = 23.9 bits (52), Expect = 9.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 21 DKKIQELIREELRGCMTI 38 D IQ+ IRE + C + Sbjct: 175 DALIQKTIREAFKDCTVL 192 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.362 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 542,576 Number of extensions: 18222 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 7 Length of query: 54 Length of database: 6,263,737 Length adjustment: 27 Effective length of query: 27 Effective length of database: 5,680,294 Effective search space: 153367938 Effective search space used: 153367938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.5 bits)