BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.885_1 (54 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.885_1 Length = 54 Score = 107 bits (268), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 54/54 (100%), Positives = 54/54 (100%) Query: 1 MDAGKLTSNINLTLTGITFNDKKIQELIREELRGCMTIKSGILSNRSAKIGVRD 54 MDAGKLTSNINLTLTGITFNDKKIQELIREELRGCMTIKSGILSNRSAKIGVRD Sbjct: 1 MDAGKLTSNINLTLTGITFNDKKIQELIREELRGCMTIKSGILSNRSAKIGVRD 54 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 23.9 bits (50), Expect = 0.58, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 20/35 (57%) Query: 15 TGITFNDKKIQELIREELRGCMTIKSGILSNRSAK 49 T I+FN K+++ ++ E G + S I+ + + K Sbjct: 153 TLISFNSKRLEMIVEEACSGLQDVSSKIVLSETYK 187 >gi|254780595|ref|YP_003065008.1| nucleoside-diphosphate-sugar epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 21.6 bits (44), Expect = 2.8, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 19 FNDKKIQELIREEL 32 F D+KI L+RE+L Sbjct: 49 FADQKINNLLREKL 62 >gi|254781161|ref|YP_003065574.1| glutamate--cysteine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 457 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Query: 5 KLTSNINLTLTGITFNDK-KIQEL 27 ++T N++L + G+ FN K K+ E+ Sbjct: 126 EITQNLDLGILGMGFNPKWKLDEM 149 >gi|254780970|ref|YP_003065383.1| phosphoribosylformylglycinamidine synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 737 Score = 20.4 bits (41), Expect = 6.7, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 10 INLTLTGITFNDKKIQELIREELRGCMTIKS 40 ++ ++ GIT NDK + + R E + IK+ Sbjct: 336 LHFSIIGITTNDKLFRVIHRGEEVANLPIKA 366 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.362 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,709 Number of Sequences: 1233 Number of extensions: 834 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 54 length of database: 328,796 effective HSP length: 26 effective length of query: 28 effective length of database: 296,738 effective search space: 8308664 effective search space used: 8308664 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)