HHsearch alignment for GI: peg_888 and conserved domain: PRK00091

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.
Probab=100.00  E-value=0  Score=458.66  Aligned_cols=213  Identities=38%  Similarity=0.618  Sum_probs=201.8

Q ss_pred             HHHHH-HHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHHHH
Q ss_conf             46899-99963994089789327999996172448899989999999999962235556655311623202357015699
Q 537021.9.peg.8    2 LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQR   80 (217)
Q Consensus         2 ~~k~~-e~~~r~kiPIiVGGTglY~~all~g~~~~p~~~~~ir~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~R   80 (217)
T Consensus        82 a~~~i~~i~~~~kiPIiVGGTglYl~aLl~g~~~~p~~~~~ir~~l~~~~~~~g~~~l~~~L~~~Dp~~a~~I~~nd~~R  161 (304)
T PRK00091         82 ALAAIEDITARGKLPILVGGTGLYFKALLEGLSFLPPADPEVRAELEALAAEEGWEALHAELAEIDPVAAARIHPNDPQR  161 (304)
T ss_pred             HHHHHHHHHHCCCCCEEECCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHCHHHHHHCCCCCHHH
T ss_conf             99999999976998789808389999997187778888989999999999975899999999875999996159861267


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             99999998534887467754154567770010000107867899999997776542113456777751138631013442
Q 537021.9.peg.8   81 IARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMK  160 (217)
Q Consensus        81 i~RaLEi~~~tGk~~s~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~R~~~Ml~~GlieEv~~L~~~~~~~~~~~~~  160 (217)
T Consensus       162 l~RAlEv~~~tGk~~s~~~~~~~~~--~~~~~~~i~L~~~r~~L~~rI~~R~~~Mi~~GlieEv~~L~~~~~~~~~~~~~  239 (304)
T PRK00091        162 IIRALEVYELTGKPLSELQKTPGKA--LPYDVLIIGLDPDREVLYERINQRFDQMLEEGLLEEVRALLAGGLHPDLPAMR  239 (304)
T ss_pred             HHHHHHHHHHHCCCHHHHHCCCCCC--CCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCHHHHH
T ss_conf             9999999999799789985037889--87662899968999999999999999999868999999999769973046773


Q ss_pred             CCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHCC
Q ss_conf             06856778986789998999999999999888887688628887531169830104
Q 537021.9.peg.8  161 AIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL  216 (217)
Q Consensus       161 ~IGYke~~~yL~g~~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~~~~~w~~~~~~d~i  216 (217)
T Consensus       240 aIGykE~~~yL~g~~s~~e~~~~i~~~Tr~yAKRQ~TWfr~~~~i~w~~~~~~~~~  295 (304)
T PRK00091        240 AIGYREVWEYLDGEISLEEAVEKIKQATRQYAKRQLTWFRRQPDIHWLDAEALDKV  295 (304)
T ss_pred             CCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCCHHHH
T ss_conf             43899999998699999999999999999999999997289999867799776899