HHsearch alignment for GI: peg_888 and conserved domain: pfam01715

>pfam01715 IPPT IPP transferase. This is a family of IPP transferases EC:2.5.1.8 also known as tRNA delta(2)-isopentenylpyrophosphate transferase. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37).
Probab=100.00  E-value=0  Score=458.58  Aligned_cols=208  Identities=40%  Similarity=0.666  Sum_probs=197.3

Q ss_pred             HHHHH-HHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHHHH
Q ss_conf             46899-99963994089789327999996172448899989999999999962235556655311623202357015699
Q 537021.9.peg.8    2 LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQR   80 (217)
Q Consensus         2 ~~k~~-e~~~r~kiPIiVGGTglY~~all~g~~~~p~~~~~ir~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~R   80 (217)
T Consensus        45 a~~~i~~i~~~~k~PIiVGGTglYl~all~g~~~~p~~~~~~r~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~R  124 (253)
T pfam01715        45 ALEAIAEIRARGKIPLLVGGTGLYFKALLDGLSDTPSADPKVRAKLEEQLEELGNDYLHAELASVDPEAAAKIHPNDGRR  124 (253)
T ss_pred             HHHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCCCHHH
T ss_conf             99999999966997289838089999997698778887777999999999985199999999874969785479643667


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             99999998534887467754154567770010000107867899999997776542113456777751138631013442
Q 537021.9.peg.8   81 IARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMK  160 (217)
Q Consensus        81 i~RaLEi~~~tGk~~s~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~R~~~Ml~~GlieEv~~L~~~~~~~~~~~~~  160 (217)
T Consensus       125 i~RAlEi~~~tGk~~s~~~~~~~~~--~~~~~~~i~l~~~r~~L~~rI~~Rv~~Ml~~GlieEv~~L~~~~~~~~~~~~~  202 (253)
T pfam01715       125 IVRALEVFYATGKPISEFQKEQKNA--LPYDIVQIGLARDREVLHERIARRVDDMLESGLVEEVKALYAQGLNEDLPSIR  202 (253)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHCCCC--CCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCHHHHH
T ss_conf             8999999999798889987433799--99877378837988999999999999998768999999999758996448773


Q ss_pred             CCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             068567789867899989999999999998888876886288875311698
Q 537021.9.peg.8  161 AIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS  211 (217)
Q Consensus       161 ~IGYke~~~yL~g~~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~~~~~w~~~~  211 (217)
T Consensus       203 aIGYkE~~~yl~g~~s~~e~~e~i~~~TrqyAKRQ~TWfr~~~~i~W~d~~  253 (253)
T pfam01715       203 AIGYKEFLLYLDGECTLEEAIERIIKATRQYAKRQMTWFRKDSQVHWLDIG  253 (253)
T ss_pred             CCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECC
T ss_conf             125999999985999999999999999999998889971899998045186