HHsearch results for GI: peg_888 and protein with PDBid: 3crm_A

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A
Probab=100.00  E-value=0  Score=447.36  Aligned_cols=214  Identities=34%  Similarity=0.553  Sum_probs=195.5

Q ss_pred             HHHHH-HHHHCCCCEEEECCCCHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHHHH
Q ss_conf             46899-99963994089789327999996172448899989999999999962235556655311623202357015699
Q 537021.9.peg.8    2 LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQR   80 (217)
Q Consensus         2 ~~k~~-e~~~r~kiPIiVGGTglY~~all~g~~~~p~~~~~ir~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~R   80 (217)
                      +.+.+ +++++|++||||||||||++||++|+++.|++++++|++++......|.+.+|++|+++||++|++||+||++|
T Consensus        83 a~~~i~~i~~~gk~PIiVGGTglYl~aLl~g~~~~p~~~~~~r~~~~~~~~~~g~~~l~~~L~~iDp~~a~~i~~nd~~R  162 (323)
T 3crm_A           83 ALAAMAKATARGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESAARIHPNDPQR  162 (323)
T ss_dssp             HHHHHHHHHHTTCEEEEEESCHHHHHHHHCCC------------------------------------------------
T ss_pred             HHHHHHHHHHCCCCEEEECCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHCHHHHHHCCCCCHHH
T ss_conf             99999999835994089756139999998399778852166899999986523799999999875909885079665779


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCCCCC---------CCHHHEEEEECC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999985348874677541545677---------700100001078-6789999999777654211345677775113
Q 537021.9.peg.8   81 IARALEIKLVSGQSIIEFWKQAPNPFI---------PLESAHKIIILP-ERSALKERIRRRFTQMLESGAIDEIRSLMKM  150 (217)
Q Consensus        81 i~RaLEi~~~tGk~~s~~~~~~~~~~~---------~~~~~~~i~l~~-~r~~L~~rI~~R~~~Ml~~GlieEv~~L~~~  150 (217)
                      |+|||||+..||+++|+|+.+++.+..         ..+++++|++.+ ||+.||+||+.||+.||++||++||+.|+++
T Consensus       163 i~RAlEv~~~tGk~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~R~~L~~rI~~Rvd~Ml~~GlieEv~~l~~~  242 (323)
T 3crm_A          163 LMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHAR  242 (323)
T ss_dssp             -------------------------------------CSEEEEEEEECSSHHHHHHHHHHHHHHHHHTTHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHC
T ss_conf             99999999985987799886434554554433345788755899983778999999999999999985769999999862


Q ss_pred             C-CCCHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHC
Q ss_conf             8-6310134420685677898678999899999999999988888768862888753116983010
Q 537021.9.peg.8  151 N-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD  215 (217)
Q Consensus       151 ~-~~~~~~~~~~IGYke~~~yL~g~~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~~~~~w~~~~~~d~  215 (217)
                      + ++.++++++||||||+.+||+|++++++|++.++++||||||||+||||++.+++|++.++.|+
T Consensus       243 ~~~~~~~~~~~aIGYkE~~~yL~g~~s~~e~~e~i~~~TrqyAKRQ~TWfR~~~~i~w~d~~~~~~  308 (323)
T 3crm_A          243 SDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDN  308 (323)
T ss_dssp             TTCCTTSSGGGSTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHHHHHTCSSCEEEETTCSCH
T ss_pred             CCCCCCCCHHHEECHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECCCCHHH
T ss_conf             368878835533349999999859999999999999999999989999848999881347988157