HHsearch results for GI: peg_888 and protein with PDBid: 3exa_A

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A
Probab=100.00  E-value=0  Score=440.34  Aligned_cols=211  Identities=30%  Similarity=0.515  Sum_probs=194.2

Q ss_pred             HHHHH-HHHHCCCCEEEECCCCHHHHHHHCCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHHH
Q ss_conf             46899-99963994089789327999996172448-89998999999999996223555665531162320235701569
Q 537021.9.peg.8    2 LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQ   79 (217)
Q Consensus         2 ~~k~~-e~~~r~kiPIiVGGTglY~~all~g~~~~-p~~~~~ir~~~~~~~~~~g~~~l~~~L~~~DP~~a~~i~~nd~~   79 (217)
                      +.+.| ++++||++||||||||||++||++|+++. |+.++.++.+++...+..|.+.+|++|+++||++|++||+||++
T Consensus        81 a~~~i~~i~~r~k~PIlVGGTglYl~aLl~g~~~~~~~~~~~~r~~l~~~~~~~g~~~l~~~L~~~Dp~~a~~i~~nd~~  160 (322)
T 3exa_A           81 ATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYR  160 (322)
T ss_dssp             HHHHHHHHHHTTCEEEEESCCHHHHHHHHHTCCCCCCBCCHHHHHHHHHHHHHSCHHHHHHHHHTTCHHHHTTSCTTCHH
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHCHHHHHHCCCCCHH
T ss_conf             99999999976998099948388999998185455445998999999999997283999999987594988633866207


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             99999999853488746775415456777001000010786789999999777654211345677775113863101344
Q 537021.9.peg.8   80 RIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIM  159 (217)
Q Consensus        80 Ri~RaLEi~~~tGk~~s~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~R~~~Ml~~GlieEv~~L~~~~~~~~~~~~  159 (217)
                      ||+|||||+..||+++|+++.+.+.. ...+++++|+|.+||+.||+||++||+.||++||++||+.|+++++ .+.+++
T Consensus       161 Ri~RAlEv~~~tg~~~s~~~~~~~~~-~~~~~~~~i~L~~~r~~L~~rI~~Rv~~Ml~~GlieEv~~L~~~~~-~~~~~~  238 (322)
T 3exa_A          161 RVIRALEIIKLTGKTVTEQARHEEET-PSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGI-RDCQSV  238 (322)
T ss_dssp             HHHHHHHHHHHTC---------------CCSEEEEEEEECCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHTTC-CSSTGG
T ss_pred             HHHHHHHHHHHCCCCHHHHHHCCCCC-CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCC-CCCCHH
T ss_conf             89999999997068888986325578-8876438999716558789999999999997786899999986255-545400


Q ss_pred             HCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
Q ss_conf             2068567789867899989999999999998888876886288875311698301
Q 537021.9.peg.8  160 KAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID  214 (217)
Q Consensus       160 ~~IGYke~~~yL~g~~~~~e~~e~~~~~Tr~yAKRQ~TWfr~~~~~~w~~~~~~d  214 (217)
                      +||||||+.+||+|++++++|++.++++||||||||+||||++++++|++.++.+
T Consensus       239 ~aIGYkE~~~yL~g~~s~ee~ie~i~~~Tr~yAKRQ~TWfR~~~~i~w~d~~~~~  293 (322)
T 3exa_A          239 QAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVD  293 (322)
T ss_dssp             GSTTTHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHTSTTEEEEECTTCC
T ss_pred             CEEEHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEECCCCCC
T ss_conf             0022999999986999999999999999999999999981899998265698738