BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.888_1
         (217 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|315122496|ref|YP_004062985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495898|gb|ADR52497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 303

 Score =  330 bits (846), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 155/208 (74%), Positives = 181/208 (87%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K   LPIIVGGTGLYFRALTGQ S+MPEIP +IR+ +REKL++YG H+LHDELS +DS  
Sbjct: 96  KNGHLPIIVGGTGLYFRALTGQFSVMPEIPMSIRKNVREKLEKYGPHVLHDELSQIDSCA 155

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A++IH SDGQRIARALEIK+VSGQSI EFWKQ+ NP IP+ESA+KI+ILPERS LK++I 
Sbjct: 156 AQKIHLSDGQRIARALEIKMVSGQSITEFWKQSSNPIIPIESAYKIVILPERSYLKDKIS 215

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           +RF +ML+SGAIDEIRSLMKMNLSLDLPIMKAIGV DI+ALLKGEINY+ETL RGIIATN
Sbjct: 216 QRFKRMLDSGAIDEIRSLMKMNLSLDLPIMKAIGVWDIMALLKGEINYEETLLRGIIATN 275

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDLF 217
           +YAK+Q TW CHQ   DW +I+S DDL 
Sbjct: 276 QYAKKQITWFCHQLNEDWKKITSADDLL 303


>gi|227822565|ref|YP_002826537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           fredii NGR234]
 gi|227341566|gb|ACP25784.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           fredii NGR234]
          Length = 312

 Score =  204 bits (520), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 139/206 (67%), Gaps = 4/206 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MP IP  IR+ +RE+L+  G+  LH EL S D   A Q+
Sbjct: 109 LPVFVGGTGLYFKALTGGLSEMPAIPAHIRDALRERLRMEGAAALHAELQSRDPQTAEQL 168

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI--PLESAHKIIILPERSALKERIRRR 131
            P DGQRI RALE+   +G+  I  ++Q+  P I  P + A KI++LPER+ L  RI RR
Sbjct: 169 GPGDGQRIVRALEVIEATGKP-IRVYQQSRGPMIVDPTQ-ARKIVVLPERALLHSRIDRR 226

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML SGA++E+R+L+ + LS D+P+MKAIGV+ I A+L+GE++  E +  G  AT +Y
Sbjct: 227 FETMLASGAVEEVRALLALKLSPDMPVMKAIGVQQIAAMLEGEMSAAEVIATGAAATRQY 286

Query: 192 AKRQKTWLCHQFQADWIRISSIDDLF 217
           AKRQ TW  +Q    W RI+  DDL 
Sbjct: 287 AKRQMTWFRNQLDDSWQRIAQPDDLL 312


>gi|325293407|ref|YP_004279271.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           sp. H13-3]
 gi|325061260|gb|ADY64951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           sp. H13-3]
          Length = 298

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/203 (48%), Positives = 139/203 (68%), Gaps = 1/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
           R ++RF P+IVGGTGLYF+ALTG LS MP IP  IRE++R +L + GS +LH ELS  D 
Sbjct: 95  RRQQRF-PVIVGGTGLYFKALTGGLSDMPAIPDDIRERLRARLIEEGSTVLHAELSRCDP 153

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           ++A+ + P DGQRI RALE+   +G+SI+EF K +    +  + A K ++LPER  L +R
Sbjct: 154 LMAQGLQPGDGQRIVRALEVMEATGKSIMEFQKASGPMIVDPDRAEKFVVLPERPVLHDR 213

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I RRF  M+ESGA++E+++L+ +NL+ D   MKAIGV  I  +L G ++  E +++   A
Sbjct: 214 INRRFETMMESGAVEEVKALLALNLAPDATAMKAIGVSQIADMLAGGMSEAEVIEKSAAA 273

Query: 188 TNKYAKRQKTWLCHQFQADWIRI 210
           T +YAKRQ TW  +Q   DW RI
Sbjct: 274 TRQYAKRQMTWFRNQMGPDWARI 296


>gi|86358397|ref|YP_470289.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli
           CFN 42]
 gi|123511420|sp|Q2K6H4|MIAA_RHIEC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|86282499|gb|ABC91562.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CFN 42]
          Length = 297

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 136/198 (68%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MP+IP A+RE++R +L + G+  L+ ELS +D  +A  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPDIPEALREELRRRLVEEGTDALYAELSDVDPAMAAGL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI +F  ++    I  + A KI++LP+R+ L  RI  RF 
Sbjct: 159 NRQDGQRIVRALEVTKATGRSIADFQGRSGPVVIDADEARKIVVLPDRAVLHARINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA DE+++L+ + L  + P+MKAIGV  I A+LKGE+  DE L++G  AT +YAK
Sbjct: 219 KMLQQGAEDEVKALLALGLPAEAPVMKAIGVSQIAAMLKGEMTRDEVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDDSWQRLT 296


>gi|150397212|ref|YP_001327679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           medicae WSM419]
 gi|239977459|sp|A6UB14|MIAA_SINMW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150028727|gb|ABR60844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           medicae WSM419]
          Length = 305

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 140/204 (68%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+ VGGTGLYF+ALTG LS MPE+P AIR+++R++L + G+  LH ELS+LD   A+++
Sbjct: 99  MPVFVGGTGLYFKALTGGLSDMPEVPHAIRQRLRKRLMEEGAEALHYELSALDPETAQRV 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNP-FIPLESAHKIIILPERSALKERIRRRF 132
              DGQRI RALE+   +G+  I F++Q+  P  I    A KI++LPER  L  RI RRF
Sbjct: 159 RSGDGQRIVRALEVMEATGRP-IGFYQQSRGPVIIDATRARKIVVLPERPVLHSRINRRF 217

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML  GA++E+R+L+ ++L L++P MKAIGV+ I A+LKGE++  + ++ G   T +YA
Sbjct: 218 EAMLGMGAVEEVRALLALDLPLEMPAMKAIGVQQIAAMLKGEMSEAQAIEAGAAQTRQYA 277

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW  +Q    W RI + + L
Sbjct: 278 KRQMTWFRNQLDETWQRIDAAEAL 301


>gi|116252992|ref|YP_768830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|239977441|sp|Q1ME89|MIAA_RHIL3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115257640|emb|CAK08737.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 297

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 134/198 (67%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MPEIP  +REK+R +L Q G   LH EL+  D  +A  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPEIPETLREKLRTRLLQEGPDGLHAELAVADPAMAASL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI +F  ++    I    A KI++LP+R+ L +RI  RF 
Sbjct: 159 NRQDGQRIVRALEVMKATGRSIADFQGRSGPVIIDAAEARKIVVLPDRAVLHQRINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA DE+R+L+ +++  + P+MKAIGV  I+A+L+GE+   E L++G  AT +YAK
Sbjct: 219 KMLQQGAEDEVRALLALDMPAEAPVMKAIGVSQIVAMLRGEMTRGEVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDDSWERLT 296


>gi|13471468|ref|NP_103034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           loti MAFF303099]
 gi|21263781|sp|Q98KJ4|MIAA_RHILO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|14022210|dbj|BAB48820.1| tRNA isopentenyltransferase [Mesorhizobium loti MAFF303099]
          Length = 321

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/202 (48%), Positives = 136/202 (67%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+ VGGTGLYFRAL   +S MP+IP  IR++ R +LK+ G+  LH  L   DS  A Q+ 
Sbjct: 108 PVFVGGTGLYFRALAEGISEMPDIPPRIRDRWRYELKEQGAVKLHGLLLREDSRAAMQLK 167

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QRI RALE+   SG+SI+E+  +   P I  ++A  ++I P+R+AL +RI RRF Q
Sbjct: 168 PTDSQRIVRALEVLDASGRSILEWQAERGRPLIDRQTARFLVIEPDRAALVDRIERRFDQ 227

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML+ GA++E+R L  + L  DLP MKAIGVRD+ A + G++++ E ++R  IAT +YAKR
Sbjct: 228 MLDKGALEEVRQLAALGLDPDLPAMKAIGVRDLQAAMAGQLSFPEAIERAKIATRQYAKR 287

Query: 195 QKTWLCHQFQADWIRISSIDDL 216
           Q TW  HQ   +W R+   DDL
Sbjct: 288 QATWFRHQLGPEWQRLRPGDDL 309


>gi|222149076|ref|YP_002550033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           vitis S4]
 gi|239977161|sp|B9JXP7|MIAA_AGRVS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|221736061|gb|ACM37024.1| tRNA delta(2)-isopentenylpyrophosphate [Agrobacterium vitis S4]
          Length = 304

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 135/197 (68%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGTGLYF+ALTG LS MP IP A+R  +R++ +  G+  LH +L+  D  VA ++
Sbjct: 100 LPVIVGGTGLYFKALTGGLSDMPAIPEAVRVMLRQRERVEGAESLHRDLTLRDPTVAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P DGQRI RALE+  V+GQSI  F  ++    I  + A K+++LP+R  L +RI RRF 
Sbjct: 160 DPRDGQRIIRALEVLEVTGQSISVFQTRSGPMIIDPQRARKLVVLPDRKLLHDRINRRFA 219

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M++ GA++E+ +L+  NLSLD+P MKAIGV  I A+LKGEI+ ++ +++   AT +YAK
Sbjct: 220 MMMDEGAVEEVEALLAQNLSLDMPAMKAIGVSQIAAMLKGEISREDVIEKSSAATRQYAK 279

Query: 194 RQKTWLCHQFQADWIRI 210
           RQ TW  +Q    W R+
Sbjct: 280 RQMTWFRNQMNETWERV 296


>gi|110634094|ref|YP_674302.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           sp. BNC1]
 gi|123162267|sp|Q11HI8|MIAA_MESSB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110285078|gb|ABG63137.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Chelativorans
           sp. BNC1]
          Length = 292

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 127/192 (66%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRALT  LS MPEIP A+R + R++L + G   LH  L   D + A +I P
Sbjct: 96  IFVGGTGLYFRALTEGLSPMPEIPEAVRIRWRKRLAEEGGEALHRLLGEADPLAASRIRP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           SD QRI RALE+   SG+ I  +  QA +P + + S  KI+++P+R+ L  RI +RF QM
Sbjct: 156 SDSQRIVRALEVVEASGRPISYWQGQASHPLVDMTSCRKIVLMPDRNTLASRIEKRFDQM 215

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           L  GA++E++ L+ ++L   +P MKAIGVR+I A+L GEI+ DE   R I AT +YAKRQ
Sbjct: 216 LRHGAVEEVKQLLALDLPPSMPAMKAIGVREISAVLAGEISLDEAGSRAIAATRQYAKRQ 275

Query: 196 KTWLCHQFQADW 207
            TW  HQ   DW
Sbjct: 276 ITWFRHQLGPDW 287


>gi|241205500|ref|YP_002976596.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240859390|gb|ACS57057.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 297

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 134/198 (67%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MPEIP  +REK+R +L + G   L+ EL+  D  +A  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPEIPEVLREKLRTRLLEEGPDGLYSELAEADPAMAASL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI +F  ++    I  + A KI++LP+R+ L +RI  RF 
Sbjct: 159 NRQDGQRIVRALEVVKATGRSIADFQGRSGPVVIDADEARKIVVLPDRAVLHQRINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA  E+R+L+ ++L  + P+MKAIGV  I A+L+GE+  DE L++G  AT +YAK
Sbjct: 219 KMLQQGAEYEVRALLALDLPAEAPVMKAIGVSQITAMLRGEMTRDEVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDGSWERLT 296


>gi|15965871|ref|NP_386224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti 1021]
 gi|21263777|sp|Q92NR2|MIAA_RHIME RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|15075140|emb|CAC46697.1| Probable tRNA delta2-isopentenylpyrophosphate transferase
           [Sinorhizobium meliloti 1021]
          Length = 303

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 133/207 (64%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  LP+ VGGTGLYF+ALTG LS MPEIP   R+++R +L + G+  LH ELS+ D   
Sbjct: 96  KEGRLPVFVGGTGLYFKALTGGLSDMPEIPLETRKRLRTRLTEEGAEALHGELSARDPET 155

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A ++ PSDGQRI RALEI   +G+ I  + +      I    A KI++LPER  L  RI 
Sbjct: 156 AGRVRPSDGQRIVRALEIIEATGRPIGSYQQSRGPVIIDPARAQKIVVLPERPVLHGRID 215

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RRF  ML  GA++E+R+L+ + L  ++P+MKAIGV  I A+LKGE++  + ++ G  AT 
Sbjct: 216 RRFETMLARGAVEEVRALLALRLPPEMPVMKAIGVPQIAAMLKGEMSEKQVIEAGAAATR 275

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDL 216
           +YAKRQ TW  +Q    W RI   D L
Sbjct: 276 QYAKRQMTWFRNQLDETWQRIEDPDAL 302


>gi|307309628|ref|ZP_07589281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti BL225C]
 gi|307321767|ref|ZP_07601155.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti AK83]
 gi|306892589|gb|EFN23387.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti AK83]
 gi|306899963|gb|EFN30585.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti BL225C]
          Length = 302

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 133/207 (64%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  LP+ VGGTGLYF+ALTG LS MPEIP   R+++R +L + G+  LH ELS+ D   
Sbjct: 95  KEGRLPVFVGGTGLYFKALTGGLSDMPEIPLETRKRLRTRLTEEGAEALHGELSARDPET 154

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A ++ PSDGQRI RALEI   +G+ I  + +      I    A KI++LPER  L  RI 
Sbjct: 155 AGRVRPSDGQRIVRALEIIEATGRPIGSYQQSRGPVIIDPARAQKIVVLPERPVLHGRID 214

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RRF  ML  GA++E+R+L+ + L  ++P+MKAIGV  I A+LKGE++  + ++ G  AT 
Sbjct: 215 RRFETMLARGAVEEVRALLALRLPPEMPVMKAIGVPQIAAMLKGEMSEKQVIEAGAAATR 274

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDL 216
           +YAKRQ TW  +Q    W RI   D L
Sbjct: 275 QYAKRQMTWFRNQLDETWQRIEDPDAL 301


>gi|327189898|gb|EGE57029.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CNPAF512]
          Length = 297

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 133/198 (67%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MPEIP  +RE++R +L   G   LH EL ++D  ++  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPEIPEELREELRTRLIAEGPEGLHAELEAIDPAMSASL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI EF ++     I  + A KI++LP+R+ L  RI  RF 
Sbjct: 159 NRQDGQRIVRALEVIKATGRSITEFQRRRGPVLIDTDKARKIVVLPDRAVLHARINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA DE+R+L+ + L ++ P+MKAIGV  I A+LK E+  +E L++G  AT +YAK
Sbjct: 219 KMLQQGAEDEVRALLALGLPVEAPVMKAIGVSQIAAMLKDEMTREEVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDESWERLA 296


>gi|260462171|ref|ZP_05810415.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259032031|gb|EEW33298.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 321

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 134/202 (66%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI VGGTGLYFRAL   +S MP+IP  +R++ R +LK+ GS  LH  L   DS  A Q+ 
Sbjct: 108 PIFVGGTGLYFRALAEGISEMPDIPQQVRDRWRYELKEQGSVKLHGILLREDSRTAMQLK 167

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QRI RALE+   SG+SI+E+  +   P I  ++AH  +I P+R+ L +RI RRF Q
Sbjct: 168 PTDSQRIVRALEVLDASGRSILEWQAERGRPLIDRQTAHFRVIEPDRAVLVDRIERRFDQ 227

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML+ GA++E+R L  ++L  DLP MKAIGVR++   + G+ ++ E ++R  IAT +YAKR
Sbjct: 228 MLDKGALEEVRQLAALHLDPDLPAMKAIGVRELQGAMAGQSSFPEAIERAKIATRQYAKR 287

Query: 195 QKTWLCHQFQADWIRISSIDDL 216
           Q TW  HQ   +W R+   DDL
Sbjct: 288 QATWFRHQLGPEWQRLRPGDDL 309


>gi|159185023|ref|NP_355007.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           tumefaciens str. C58]
 gi|61228129|sp|P0A3Q5|MIAA_AGRT5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|61228130|sp|P0A3Q6|MIAA_RHIRD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|142240|gb|AAA22091.1| delta-2-isopentenyltransferase transfer RNA [Agrobacterium
           tumefaciens]
 gi|159140297|gb|AAK87792.2| tRNA delta(2)-isopentenylpyrophosphate [Agrobacterium tumefaciens
           str. C58]
          Length = 298

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 97/203 (47%), Positives = 133/203 (65%), Gaps = 1/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
           R + RF P+IVGGTGLYF+ALTG LS MP IP  +RE +R +L + G+  LH EL S D 
Sbjct: 95  RGEGRF-PVIVGGTGLYFKALTGGLSDMPAIPDDLREGLRARLIEEGAAKLHAELVSRDP 153

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
            +A+ + P DGQRI RALE+   +G+SI +F + +    I  E A K I+LPER  L +R
Sbjct: 154 SMAQMLQPGDGQRIVRALEVLEATGKSIRDFQRASGPMIIDPERAQKFIVLPERPVLHDR 213

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I RRF  M++SGA++E+++L+ +NL+ D   MKAIGV  I  +L G +   E +++   A
Sbjct: 214 INRRFEAMMDSGAVEEVQALLALNLAPDATAMKAIGVAQIADMLTGRMGAAEVIEKSAAA 273

Query: 188 TNKYAKRQKTWLCHQFQADWIRI 210
           T +YAKRQ TW  +Q   DW RI
Sbjct: 274 TRQYAKRQMTWFRNQMGDDWTRI 296


>gi|190892521|ref|YP_001979063.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CIAT 652]
 gi|239977440|sp|B3PTP8|MIAA_RHIE6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190697800|gb|ACE91885.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CIAT 652]
          Length = 297

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 131/198 (66%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MPEIP  +RE++R +L   G   LH EL ++D  ++  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPEIPEGLREELRMRLVAEGPEGLHAELEAIDPAMSASL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI EF ++     I  + A KI++LP+R+ L  RI  RF 
Sbjct: 159 NRQDGQRIVRALEVIKATGRSIAEFHRRLGPVLIDADEARKIVVLPDRAVLHARINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA  E+R+L+ + L    P+MKAIGV  I A+LKGE+  +E L++G  AT +YAK
Sbjct: 219 KMLQQGAESEVRALLALGLPAVAPVMKAIGVSQITAMLKGEMTREEVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDESWERLA 296


>gi|209550119|ref|YP_002282036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|239977442|sp|B5ZVU9|MIAA_RHILW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|209535875|gb|ACI55810.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 297

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 130/198 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MP+IP A+RE++R +L   G   LH EL+ +D  +A  +
Sbjct: 99  LPVFVGGTGLYFKALTGGLSDMPDIPEALREELRGRLLMEGPDRLHAELAEVDPAMAAGL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI +F  Q+    I    A KI++LPER+ L  RI  RF 
Sbjct: 159 NRQDGQRIVRALEVVKATGRSIADFQGQSGPVVIDAAQARKIVVLPERAVLHARINGRFE 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML   A DE+R+L+ + L  + P+MKAIGV  + A+L GE+  D+ L++G  AT +YAK
Sbjct: 219 KMLRERAEDEVRALLALGLPAEAPVMKAIGVSQMAAMLSGEMTRDDVLEKGAAATRQYAK 278

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 279 RQMTWFRNQMDESWERLT 296


>gi|218674370|ref|ZP_03524039.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli
           GR56]
          Length = 298

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 132/198 (66%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYF+ALTG LS MP IP A+R K+R +L + G   L+ EL ++D  ++  +
Sbjct: 100 LPVFVGGTGLYFKALTGGLSDMPAIPEALRGKLRMRLLEEGPEGLYAELDAIDPAMSASL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  DGQRI RALE+   +G+SI +F  ++    I  E A KI++LP R+ L  RI  RF 
Sbjct: 160 NRQDGQRIVRALEVIQATGRSIADFQGRSGPVLIDAEKARKIVVLPGRAILHARINGRFE 219

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML+ GA DE+R+L+ + L  + P+MKAIGV  I A+LKGE+  +E L++G  AT +YAK
Sbjct: 220 KMLQQGAEDEVRALLALGLPAEAPVMKAIGVSQIAAMLKGEMRREEVLEKGAAATRQYAK 279

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ TW  +Q    W R++
Sbjct: 280 RQMTWFRNQMDESWERLA 297


>gi|319782927|ref|YP_004142403.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317168815|gb|ADV12353.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 322

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 133/201 (66%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S MP+IP  +R++ R +LK+ G+  LH  L   DS  A  + P
Sbjct: 110 IFVGGTGLYFRALAEGISEMPDIPQRVRDRWRYELKEQGAVKLHSLLLREDSAAAMMLKP 169

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+   SG+SI+E+  +   P I  +SAH ++I P+R+AL  RI +RF QM
Sbjct: 170 TDSQRIVRALEVLDASGRSILEWQAERGQPLIDRQSAHFLVIEPDRAALVGRIDKRFDQM 229

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           L+ GA+DE++ L  + L  +LP MKAIGVR++ A + G I + E ++R  IAT +Y+KRQ
Sbjct: 230 LDKGALDEVKRLAALGLDPELPAMKAIGVRELQAAMAGGIGFPEAIERAKIATRQYSKRQ 289

Query: 196 KTWLCHQFQADWIRISSIDDL 216
            TW  HQ   +W+R+   DDL
Sbjct: 290 TTWFRHQLGPEWLRLHPGDDL 310


>gi|222086372|ref|YP_002544906.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           radiobacter K84]
 gi|221723820|gb|ACM26976.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           radiobacter K84]
          Length = 317

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (63%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+ VGGTGLYF+ALTG LS MP+IPT IR ++RE+L   G+  L+ EL   D   A  + 
Sbjct: 120 PVFVGGTGLYFKALTGGLSDMPDIPTEIRSRLRERLLAEGTDELYRELVLCDPTAAESLS 179

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             DGQRI RALE+   +GQSI  F  +     I  + A KI++LP+R+ L +RI  RF +
Sbjct: 180 SQDGQRIVRALEVIEATGQSIAAFQGKTGPVIIDADRARKIVVLPDRAVLHQRINGRFEK 239

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML  GA  E+++L+ + LS ++P+MKAIGV  I A+L+GE+   E L  G  AT +YAKR
Sbjct: 240 MLAMGAEAEVKALLALGLSPEMPVMKAIGVSQIAAMLRGEMTRAEVLDTGAAATRQYAKR 299

Query: 195 QKTWLCHQFQADWIRIS 211
           Q TW  +Q    W R+S
Sbjct: 300 QMTWFRNQMDESWERVS 316


>gi|239832268|ref|ZP_04680597.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824535|gb|EEQ96103.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           intermedium LMG 3301]
          Length = 335

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/211 (45%), Positives = 139/211 (65%), Gaps = 3/211 (1%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
           R K R  PI VGGTGLYFRAL G LS MPE+P  +R   R +++  G  +LH  L   D 
Sbjct: 120 RMKDR-TPIFVGGTGLYFRALLGGLSQMPEVPGDVRAYWRGRMETDGPELLHRILGERDP 178

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKE 126
            +A  + P+D QRI RALE+   +G+S++ +W+Q     I  E SAHKI++ P+R+ L E
Sbjct: 179 DMAATLQPADSQRIVRALEVLEGTGKSLL-YWQQTKGRAIVDENSAHKIVLAPDRAWLSE 237

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +RF  M ++GAIDE+++L+ ++L   LP MKAIGVR+I A L+G ++ +E ++R +I
Sbjct: 238 RIAQRFALMWDNGAIDEVKALLALDLDPGLPAMKAIGVREITAYLEGTMSREEAVERSVI 297

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           AT +YAKRQ TW  +Q  A W   ++ +D F
Sbjct: 298 ATRQYAKRQSTWFRNQLDASWSVHANSNDAF 328


>gi|239977339|sp|B9JGK2|MIAA_AGRRK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 298

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (63%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+ VGGTGLYF+ALTG LS MP+IPT IR ++RE+L   G+  L+ EL   D   A  + 
Sbjct: 101 PVFVGGTGLYFKALTGGLSDMPDIPTEIRSRLRERLLAEGTDELYRELVLCDPTAAESLS 160

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             DGQRI RALE+   +GQSI  F  +     I  + A KI++LP+R+ L +RI  RF +
Sbjct: 161 SQDGQRIVRALEVIEATGQSIAAFQGKTGPVIIDADRARKIVVLPDRAVLHQRINGRFEK 220

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML  GA  E+++L+ + LS ++P+MKAIGV  I A+L+GE+   E L  G  AT +YAKR
Sbjct: 221 MLAMGAEAEVKALLALGLSPEMPVMKAIGVSQIAAMLRGEMTRAEVLDTGAAATRQYAKR 280

Query: 195 QKTWLCHQFQADWIRIS 211
           Q TW  +Q    W R+S
Sbjct: 281 QMTWFRNQMDESWERVS 297


>gi|153009131|ref|YP_001370346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           anthropi ATCC 49188]
 gi|166215160|sp|A6WZW3|MIAA_OCHA4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151561019|gb|ABS14517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 308

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/211 (44%), Positives = 133/211 (63%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   K   PI VGGTGLYFRAL G LS MPE+P  +R   R +++  G   LH  LS  D
Sbjct: 91  QPAMKHRTPIFVGGTGLYFRALLGGLSQMPEVPGDVRAYWRGRMEMDGPENLHRLLSERD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
             +A  + P D QRI RALE+   +G+S++ + +      +   SA KI++LP+R+ L E
Sbjct: 151 PEMAATLQPFDSQRIVRALEVFEGTGKSLLVWQQTKGQALVDDHSARKIVLLPDRTWLSE 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RRF  M ++GAIDE+++L+ ++L   LP MKAIGVR+I A L+G ++ +E ++R +I
Sbjct: 211 RIARRFALMWDNGAIDEVKALLVLDLDPALPAMKAIGVREITAFLQGSMSREEAIERSVI 270

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           AT +YAKRQ TW  +Q    W   ++ DD F
Sbjct: 271 ATRQYAKRQSTWFRNQLDDSWCTHANSDDAF 301


>gi|163759000|ref|ZP_02166086.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hoeflea
           phototrophica DFL-43]
 gi|162283404|gb|EDQ33689.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hoeflea
           phototrophica DFL-43]
          Length = 302

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 125/200 (62%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +R +P++VGGTGLY RALTG LS MP IP  IR+ +R +L+  G   LH EL+ LD  +A
Sbjct: 101 RRAIPVVVGGTGLYLRALTGGLSDMPSIPVEIRDPLRARLEDEGIEPLHAELARLDPQMA 160

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
            ++ P+D QR+ RALE+   +GQSI  F  +     +    A  I++ P+R  L  RI  
Sbjct: 161 ERLRPADRQRVLRALEVVKATGQSISSFQGRGGPMIVDPSRARCIVLEPDRPVLHARINA 220

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF +M+E GA+DE+R L+ +N+    P MKAIGV  + A ++G  + DE ++R   AT +
Sbjct: 221 RFAKMVEQGALDEVRELISLNIPPQHPAMKAIGVAPLAAHIEGRTSLDEAIERSSAATRQ 280

Query: 191 YAKRQKTWLCHQFQADWIRI 210
           YAKRQ TW  +Q  A W R+
Sbjct: 281 YAKRQMTWFRNQLDASWQRL 300


>gi|304392183|ref|ZP_07374125.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ahrensia sp.
           R2A130]
 gi|303296412|gb|EFL90770.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ahrensia sp.
           R2A130]
          Length = 299

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 129/196 (65%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+ VGGTGLYF+A+   L+ +P I   IRE++R++    GS  +H EL ++D   A  +
Sbjct: 97  VPVFVGGTGLYFKAMLEGLAPVPTIDPQIREEVRQRSLIGGSAAMHGELETVDPDTAATV 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAP-NPFIPLESAHKIIILPERSALKERIRRRF 132
            P+D QRI RALE+KL +G+S+++F K+A  +P +   S    +++P+R+ L ERI  R 
Sbjct: 157 RPTDTQRICRALEVKLSTGRSLLDFRKEAKRDPLLTKHSVQSTVLMPDRAILHERIEARA 216

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             MLE+GA+DE+++++++NL  D  +M+AIGV  I A L GEI   E LQR   AT +YA
Sbjct: 217 VTMLENGALDEVKAIIRLNLPADATVMRAIGVPQITAFLNGEIGKVELLQRLQAATRQYA 276

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ T+   QF  DW+
Sbjct: 277 KRQSTFFRGQFGNDWV 292


>gi|254719425|ref|ZP_05181236.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|265984429|ref|ZP_06097164.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|306839201|ref|ZP_07472018.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp. NF
           2653]
 gi|264663021|gb|EEZ33282.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|306405748|gb|EFM62010.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp. NF
           2653]
          Length = 310

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 134/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSIRDPAIAATL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|306843272|ref|ZP_07475881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO2]
 gi|306286538|gb|EFM58121.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO2]
          Length = 310

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 134/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSIRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|306844289|ref|ZP_07476881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO1]
 gi|306275361|gb|EFM57102.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO1]
          Length = 310

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 134/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSVRDPAIAATL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+++L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVKALLALDLDPALPAMKAIGVREVSAFLAETMSREEVIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|254714428|ref|ZP_05176239.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
 gi|254717325|ref|ZP_05179136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261219154|ref|ZP_05933435.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261322216|ref|ZP_05961413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
 gi|260924243|gb|EEX90811.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261294906|gb|EEX98402.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
          Length = 310

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 133/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|148560416|ref|YP_001259286.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ovis
           ATCC 25840]
 gi|161619337|ref|YP_001593224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella canis
           ATCC 23365]
 gi|163843645|ref|YP_001628049.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           ATCC 23445]
 gi|225627843|ref|ZP_03785880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           str. Cudo]
 gi|254702113|ref|ZP_05163941.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|254704650|ref|ZP_05166478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|254708065|ref|ZP_05169893.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|254710436|ref|ZP_05172247.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|256031929|ref|ZP_05445543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|256061450|ref|ZP_05451594.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|256160127|ref|ZP_05457821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|256255333|ref|ZP_05460869.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|256369806|ref|YP_003107317.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           microti CCM 4915]
 gi|260169065|ref|ZP_05755876.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           F5/99]
 gi|260566104|ref|ZP_05836574.1| tRNA isopentenyltransferase [Brucella suis bv. 4 str. 40]
 gi|261222534|ref|ZP_05936815.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|261315566|ref|ZP_05954763.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261318005|ref|ZP_05957202.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|261325456|ref|ZP_05964653.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|261752683|ref|ZP_05996392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|261755343|ref|ZP_05999052.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|261758569|ref|ZP_06002278.1| tRNA isopentenyltransferase [Brucella sp. F5/99]
 gi|265989035|ref|ZP_06101592.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|265998499|ref|ZP_06111056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|294852717|ref|ZP_06793390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           NVSL 07-0026]
 gi|166201470|sp|A5VRD9|MIAA_BRUO2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081944|sp|A9M648|MIAA_BRUC2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081945|sp|B0CHH8|MIAA_BRUSI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148371673|gb|ABQ61652.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ovis
           ATCC 25840]
 gi|161336148|gb|ABX62453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella canis
           ATCC 23365]
 gi|163674368|gb|ABY38479.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           ATCC 23445]
 gi|225617848|gb|EEH14893.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           str. Cudo]
 gi|255999969|gb|ACU48368.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           microti CCM 4915]
 gi|260155622|gb|EEW90702.1| tRNA isopentenyltransferase [Brucella suis bv. 4 str. 40]
 gi|260921118|gb|EEX87771.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|261297228|gb|EEY00725.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|261301436|gb|EEY04933.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|261304592|gb|EEY08089.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261738553|gb|EEY26549.1| tRNA isopentenyltransferase [Brucella sp. F5/99]
 gi|261742436|gb|EEY30362.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|261745096|gb|EEY33022.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|262553123|gb|EEZ08957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|264661232|gb|EEZ31493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|294821306|gb|EFG38305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           NVSL 07-0026]
          Length = 310

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 133/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|23502261|ref|NP_698388.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           1330]
 gi|38258118|sp|Q8CY40|MIAA_BRUSU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|23348234|gb|AAN30303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           1330]
          Length = 310

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 133/204 (65%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|225852873|ref|YP_002733106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis ATCC 23457]
 gi|256113940|ref|ZP_05454728.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256263643|ref|ZP_05466175.1| tRNA isopentenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|265995287|ref|ZP_06107844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|254811014|sp|C0RE30|MIAA_BRUMB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|225641238|gb|ACO01152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis ATCC 23457]
 gi|262766400|gb|EEZ12189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263093697|gb|EEZ17702.1| tRNA isopentenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409413|gb|ADZ66478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis M28]
 gi|326539120|gb|ADZ87335.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis M5-90]
          Length = 310

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 132/204 (64%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|62290285|ref|YP_222078.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700207|ref|YP_414781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis biovar Abortus 2308]
 gi|189024518|ref|YP_001935286.1| tRNA isopentenyltransferase [Brucella abortus S19]
 gi|237815792|ref|ZP_04594789.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus str. 2308 A]
 gi|254689587|ref|ZP_05152841.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 6 str. 870]
 gi|254694077|ref|ZP_05155905.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254730618|ref|ZP_05189196.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 4 str. 292]
 gi|256257836|ref|ZP_05463372.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|260546827|ref|ZP_05822566.1| tRNA isopentenyltransferase [Brucella abortus NCTC 8038]
 gi|260755114|ref|ZP_05867462.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 6 str. 870]
 gi|260758333|ref|ZP_05870681.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 4 str. 292]
 gi|260884126|ref|ZP_05895740.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|261214373|ref|ZP_05928654.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|297248673|ref|ZP_06932391.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 5 str. B3196]
 gi|75505252|sp|Q57CB7|MIAA_BRUAB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123547603|sp|Q2YS31|MIAA_BRUA2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238689388|sp|B2S6L5|MIAA_BRUA1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|62196417|gb|AAX74717.1| MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616308|emb|CAJ11365.1| ATP/GTP-binding site motif A (P-loop):tRNA isopentenyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|189020090|gb|ACD72812.1| tRNA isopentenyltransferase [Brucella abortus S19]
 gi|237789090|gb|EEP63301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus str. 2308 A]
 gi|260095877|gb|EEW79754.1| tRNA isopentenyltransferase [Brucella abortus NCTC 8038]
 gi|260668651|gb|EEX55591.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 4 str. 292]
 gi|260675222|gb|EEX62043.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 6 str. 870]
 gi|260873654|gb|EEX80723.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|260915980|gb|EEX82841.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|297175842|gb|EFH35189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 5 str. B3196]
          Length = 310

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 132/204 (64%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|316934803|ref|YP_004109785.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris DX-1]
 gi|315602517|gb|ADU45052.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris DX-1]
          Length = 316

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (61%), Gaps = 1/198 (0%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LPI++GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH EL+  D   A +
Sbjct: 103 LLPILIGGTGLYFKALTRGLSAVPPVPAEVRDAVRLRLDRNGVLALHAELAGCDPEAAAR 162

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           + P+D  RIARALE+ L +G+ + E+ +QA  P +P +    + + P+R AL ERI  RF
Sbjct: 163 LAPADRTRIARALEVVLATGRPLTEWHRQASPPLLPPDEVAAVFLAPDREALYERIDSRF 222

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML++GA+DE+ +L +  L   LP MKA GV  +I  L+GEI  DE    G   T  YA
Sbjct: 223 AAMLQAGALDEVSALAERRLDPLLPAMKAHGVPALIRHLRGEIGLDEAAAIGAADTRHYA 282

Query: 193 KRQKTWLCHQF-QADWIR 209
           KRQ TW  HQ  +  W++
Sbjct: 283 KRQFTWFRHQLPEFRWVK 300


>gi|17986899|ref|NP_539533.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|256045023|ref|ZP_05447924.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|260565378|ref|ZP_05835862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991450|ref|ZP_06104007.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|21263771|sp|Q8YI29|MIAA_BRUME RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|17982540|gb|AAL51797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260151446|gb|EEW86540.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002234|gb|EEZ14809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
          Length = 310

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 131/204 (64%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A  +
Sbjct: 98  VPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIAAAL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L  RI RRF+
Sbjct: 158 QPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGVRIARRFS 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +YAK
Sbjct: 218 AMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TW  +Q   DW   +S +++F
Sbjct: 278 RQSTWFRNQLGEDWRVYASGEEVF 301


>gi|319408799|emb|CBI82456.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           schoenbuchensis R1]
          Length = 291

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 125/197 (63%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P IP AIREK R +L + G+  L+ EL  +D+++  +I P
Sbjct: 95  IFVGGTGLYFRALLEGISKIPSIPDAIREKWRMRLYKEGAESLYRELLQVDAVLCEKIAP 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+   +G+ +  + K+     I  + + KI+++P R  L ERI  RF  M
Sbjct: 155 QDGQRIVRALEVYESTGKRLSWWQKKKTKSLIAQDCSEKILLIPPRQLLYERINERFNHM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+ ++ K+ LS  LP MKAIGVR+++A L G  ++++ ++   + T +YAKRQ
Sbjct: 215 VERGVLEEVIAMKKLMLSPLLPAMKAIGVRELMAYLDGYKSFEDAIEEAKMQTRRYAKRQ 274

Query: 196 KTWLCHQFQADWIRISS 212
            TW  +QF   W  I S
Sbjct: 275 MTWFNNQFDDKWNLIYS 291


>gi|86750457|ref|YP_486953.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris HaA2]
 gi|123003955|sp|Q2IUR8|MIAA_RHOP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|86573485|gb|ABD08042.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris HaA2]
          Length = 310

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 116/191 (60%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LPI +GGTGLYF+ALT  LS++P +P  IR+ +R +L + G   LH EL+  D   A +
Sbjct: 88  LLPIFIGGTGLYFKALTRGLSLVPPVPAEIRDAVRLRLDRDGVAALHAELARHDPAAAER 147

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           + P+D  RIARALE+ L +G+ + ++  +A  P +P +    + + PER AL  RI  RF
Sbjct: 148 LAPADRSRIARALEVVLATGRPLADWHGEASPPLLPPDGVTAVFLAPEREALYARIDARF 207

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML +GA+DE+ +L +  L   LP MKA GV  +I  L+GEI+ DE    G   T  YA
Sbjct: 208 AAMLRAGALDEVAALAERRLDPLLPAMKAHGVPALIRHLRGEISLDEAAVIGAADTRHYA 267

Query: 193 KRQKTWLCHQF 203
           KRQ TW  HQ 
Sbjct: 268 KRQFTWFRHQL 278


>gi|39935099|ref|NP_947375.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris CGA009]
 gi|61214141|sp|Q6N874|MIAA_RHOPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|39648950|emb|CAE27471.1| tRNA isopentenyltransferase [Rhodopseudomonas palustris CGA009]
          Length = 321

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 120/202 (59%), Gaps = 1/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH EL+  D   A ++
Sbjct: 109 LPILIGGTGLYFKALTRGLSAVPPVPAEVRDAVRLRLDRDGVQALHAELARQDPEAAARL 168

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D  RIARALE+ L +G+ + ++ +Q   P +P +    + + P+R AL  RI  RF 
Sbjct: 169 APADRTRIARALEVVLATGRPLADWHQQTSPPLLPPDDVVAVFLAPDREALYARIDSRFA 228

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML+ GA+DE+ +L +  L   LP MKA GV  +I  L+GEI  +E    G   T  YAK
Sbjct: 229 AMLQGGALDEVAALAERQLDPLLPAMKAHGVPALIRHLRGEITLEEAASIGAADTRHYAK 288

Query: 194 RQKTWLCHQF-QADWIRISSID 214
           RQ TW  HQ  +  W+R    D
Sbjct: 289 RQFTWFRHQLPEFKWVRPEEAD 310


>gi|192290632|ref|YP_001991237.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris TIE-1]
 gi|239977476|sp|B3QCV7|MIAA_RHOPT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|192284381|gb|ACF00762.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 301

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 120/202 (59%), Gaps = 1/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH EL+  D   A ++
Sbjct: 89  LPILIGGTGLYFKALTRGLSAVPPVPAEVRDAVRLRLDRDGVQALHAELAGHDPEAAARL 148

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D  RIARALE+ L +G+ + ++ +Q   P +P +    + + P+R AL  RI  RF 
Sbjct: 149 APADRTRIARALEVVLATGRPLADWHQQTSPPLLPPDDVVAVFLAPDREALYARIDSRFA 208

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML+ GA++E+ +L +  L   LP MKA GV  +I  L+GEI  +E    G   T  YAK
Sbjct: 209 AMLQGGALNEVAALAERQLDPLLPAMKAHGVPALIRHLRGEITLEEAASIGAADTRHYAK 268

Query: 194 RQKTWLCHQF-QADWIRISSID 214
           RQ TW  HQ  +  W+R    D
Sbjct: 269 RQFTWFRHQLPEFKWVRPQEAD 290


>gi|114705931|ref|ZP_01438834.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Fulvimarina
           pelagi HTCC2506]
 gi|114538777|gb|EAU41898.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Fulvimarina
           pelagi HTCC2506]
          Length = 289

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 122/202 (60%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI  GGTGLYF+AL G L  MP++P  +R+K R +L + G   LH EL ++D + A +I
Sbjct: 74  LPIFCGGTGLYFKALLGLLDAMPQVPDTVRQKWRLRLAESGPKTLHCELQAVDPVAAGRI 133

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P DGQRI RALEI+  +G  +     +     +  +   KI++ P+R+ L+ERI +RF 
Sbjct: 134 EPQDGQRIVRALEIQEATGTPLSRLQARKGEGILDEDETLKIVLTPDRAVLRERIAKRFD 193

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +MLE+GA+DE+R  +         + KAIG  ++  +L G+    E  +R I  T +YAK
Sbjct: 194 RMLEAGAMDEVREYLSRRPDAGRFVEKAIGFTELSQVLAGQAAAAEAKERAITRTRQYAK 253

Query: 194 RQKTWLCHQFQADWIRISSIDD 215
           RQ+TW  HQF   W+R + ++D
Sbjct: 254 RQETWFRHQFDESWLRCADVED 275


>gi|163868685|ref|YP_001609897.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           tribocorum CIP 105476]
 gi|189081943|sp|A9IW77|MIAA_BART1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|161018344|emb|CAK01902.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           tribocorum CIP 105476]
          Length = 290

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/196 (40%), Positives = 121/196 (61%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P +P  +R+K R  L + G+  L+ +L  +D++VA +I  
Sbjct: 95  IFVGGTGLYFRALLEGISKIPHVPDVVRQKWRLLLNKEGAESLYRQLLQIDAVVAEKISS 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+   +G+ +  + KQ   P I    A KI+++  R+ L ERI +R   M
Sbjct: 155 QDGQRIVRALEVYDATGEKLSWWQKQKTTPLIAPSRAEKILLMRPRALLYERIHKRLDSM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+ ++ K+ LS  LP+MKAIG+ + +A L G  +++  L+     T +YAKRQ
Sbjct: 215 IERGVLEEVVAMKKLMLSPSLPVMKAIGIPEFMAYLDGYRSFENALEAAKTQTRRYAKRQ 274

Query: 196 KTWLCHQFQADWIRIS 211
            TW  HQF  +W+  S
Sbjct: 275 MTWFRHQFDEEWMLTS 290


>gi|312115008|ref|YP_004012604.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220137|gb|ADP71505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 316

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 118/191 (61%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LP+IVGGTGLYF+ALT  LS +PEIP  IR   R + +   +  LH ELS  D+  A  
Sbjct: 96  LLPVIVGGTGLYFKALTEGLSTIPEIPAEIRAHYRLRAETEPAEALHAELSRRDAATAAT 155

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           I PSD QRIARALE+   +G+ + ++  Q   P +    A  +++  +R+AL  R   RF
Sbjct: 156 IRPSDPQRIARALEVLEATGRPLADWHAQKEPPLLSAADALPVVVEIDRAALYRRCDERF 215

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            +M+E+GAI+E R++  ++L   LP M+A+G+  +IA  +GE++  +  +R   AT  YA
Sbjct: 216 DRMIEAGAIEEARAIDALHLDAALPAMRAVGLPPLIAFARGEVSLGDAAERAKTATRNYA 275

Query: 193 KRQKTWLCHQF 203
           KRQ TW+ + F
Sbjct: 276 KRQLTWIRNNF 286


>gi|90424747|ref|YP_533117.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisB18]
 gi|90106761|gb|ABD88798.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisB18]
          Length = 285

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 118/197 (59%), Gaps = 1/197 (0%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LPI VGG+GLYF+ALT  LS +P I   +RE +R +L+Q G   LH  L+  D   A +
Sbjct: 75  LLPIFVGGSGLYFKALTRGLSAVPAIAPQVREDVRARLEQGGVEALHAALARRDPTSAAR 134

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           ++P+D  R+ARALE+   +G+S+ ++ + A  P +P E    + + P+R  L  RI  RF
Sbjct: 135 LNPNDRSRVARALEVVEATGRSLTDWHRDALPPLLPPEQVTALFLAPQRDELYARIDARF 194

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML++GA+DE+ +L    L   LP MKA GV  +I  LKGEI+ DE    G   T  YA
Sbjct: 195 ELMLQAGALDEVAALAARKLDPLLPAMKAHGVPALIRHLKGEISRDEAASIGCADTRHYA 254

Query: 193 KRQKTWLCHQF-QADWI 208
           KRQ TW  HQ  + +W+
Sbjct: 255 KRQFTWFRHQLPEFEWV 271


>gi|239977575|sp|Q211Y8|MIAA_RHOPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 316

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 118/197 (59%), Gaps = 1/197 (0%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LPI VGG+GLYF+ALT  LS +P I   +RE +R +L+Q G   LH  L+  D   A +
Sbjct: 106 LLPIFVGGSGLYFKALTRGLSAVPAIAPQVREDVRARLEQGGVEALHAALARRDPTSAAR 165

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           ++P+D  R+ARALE+   +G+S+ ++ + A  P +P E    + + P+R  L  RI  RF
Sbjct: 166 LNPNDRSRVARALEVVEATGRSLTDWHRDALPPLLPPEQVTALFLAPQRDELYARIDARF 225

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML++GA+DE+ +L    L   LP MKA GV  +I  LKGEI+ DE    G   T  YA
Sbjct: 226 ELMLQAGALDEVAALAARKLDPLLPAMKAHGVPALIRHLKGEISRDEAASIGCADTRHYA 285

Query: 193 KRQKTWLCHQF-QADWI 208
           KRQ TW  HQ  + +W+
Sbjct: 286 KRQFTWFRHQLPEFEWV 302


>gi|49474431|ref|YP_032473.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           quintana str. Toulouse]
 gi|61214102|sp|Q6FZ96|MIAA_BARQU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49239935|emb|CAF26337.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           quintana str. Toulouse]
          Length = 295

 Score =  158 bits (399), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 125/201 (62%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   LS +P I  A+R+K R +L + G+  L+ +L  +D++ A +I  
Sbjct: 95  IFVGGTGLYFRALLEGLSEIPHISDAVRQKWRLRLDKEGAENLYRQLLRIDAVFAEKISS 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+ +  + K+   P I    + KI+++P R  L ERI +R   M
Sbjct: 155 QDGQRIIRALEVYDVTGKKLSWWQKKKTPPLISPNCSEKILLIPPRQWLYERIHKRLDNM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E GA++E+ ++ K+ LS  LP MKAIG+ +  A   G  ++++ L+     T +YAKRQ
Sbjct: 215 IERGALEEVFAMKKLMLSPFLPAMKAIGMPEFTAYFDGYKSFEDALEMAKTQTRRYAKRQ 274

Query: 196 KTWLCHQFQADWIRISSIDDL 216
            TW  +QF  +W  ISS +++
Sbjct: 275 MTWFRNQFDEEWTLISSCEEV 295


>gi|49475827|ref|YP_033868.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           henselae str. Houston-1]
 gi|61214108|sp|Q6G2T3|MIAA_BARHE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49238635|emb|CAF27879.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           henselae str. Houston-1]
          Length = 290

 Score =  157 bits (397), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 132/210 (62%), Gaps = 1/210 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +SK L  +  + L I VGGTGLYFRAL   +S +P+IP  +R+K R +L + G+  L+ +
Sbjct: 82  VSKLLMTFTSKSL-IFVGGTGLYFRALLEGISKIPDIPDVVRQKWRLRLDKEGAENLYRQ 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D+++A +I   DGQRI RALE+   + + +  + K+   P I    + K++++P R
Sbjct: 141 LWQVDAVLAEKISSQDGQRIVRALEVYDATDKKLSWWQKKKTTPLIARNCSEKLLLIPPR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M+E GA++E+ ++ K+ LS  LP MKAIG+ + IA L G+ +++E L
Sbjct: 201 QLLYERIHKRLDSMIEKGALEEVIAMKKLALSPLLPAMKAIGIPEFIAYLDGKQSFEEAL 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           +     T +YAKRQ TW  +QF  +W+ +S
Sbjct: 261 EMVKTQTRRYAKRQITWFRNQFDEEWMLLS 290


>gi|27381615|ref|NP_773144.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bradyrhizobium
           japonicum USDA 110]
 gi|46577024|sp|Q89G43|MIAA_BRAJA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|27354783|dbj|BAC51769.1| tRNA delta(2)-isopentenylpyrophosphate [Bradyrhizobium japonicum
           USDA 110]
          Length = 318

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 120/197 (60%), Gaps = 1/197 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI +GGTGLYF+ALT  LS++P IP  +RE +R +L++ G   LH EL++ D   A ++
Sbjct: 103 LPIFIGGTGLYFKALTAGLSVVPPIPAEVREDVRARLERNGVEALHAELAARDPRAAGRL 162

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  D  RIARALE+   +G+S++++ ++   P +P +S H + + P R  L  RI  RF 
Sbjct: 163 NLRDRTRIARALEVIEATGRSLLDWHQEGQPPLLPRDSFHAVFLAPGRDELYARIDARFD 222

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML +GA+ E+  L    L   LP MKA GV  +I  L+GE++ DE    G   T  YAK
Sbjct: 223 AMLGAGALREVERLAARQLDPLLPAMKAHGVPALIRHLRGELSLDEAATIGRADTRHYAK 282

Query: 194 RQKTWLCHQF-QADWIR 209
           RQ TW  HQ  + +W++
Sbjct: 283 RQFTWFRHQLPEFEWVK 299


>gi|240139402|ref|YP_002963877.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Methylobacterium extorquens AM1]
 gi|240009374|gb|ACS40600.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Methylobacterium extorquens AM1]
          Length = 278

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 120/197 (60%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFR+L   +S +PE+P AIR++IR +     +  LH  L+  D   A ++
Sbjct: 63  LPVFVGGTGLYFRSLDEGISDLPEVPDAIRQQIRAEADGQPTETLHAALALRDPESAERL 122

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRR 130
            PSD  R+ RALEI   +G+SI  F + + P P    PL    K+ +  ER AL++RI  
Sbjct: 123 RPSDRMRVMRALEIHAATGRSIGSFHEARVPGPLAGKPL---LKLFLATEREALRQRIDA 179

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M+E GA+DE+ +L +  L   LP+M+A GV  +IA L G I+ +E +QRG   T +
Sbjct: 180 RFVTMMEQGALDEVAALRERRLDPLLPVMRAHGVPGLIAHLDGTISREEAIQRGQGDTRR 239

Query: 191 YAKRQKTWLCHQFQADW 207
           YAKRQ TW  HQ   DW
Sbjct: 240 YAKRQFTWFRHQMGEDW 256


>gi|254561818|ref|YP_003068913.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Methylobacterium extorquens DM4]
 gi|254269096|emb|CAX25059.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Methylobacterium extorquens DM4]
          Length = 317

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFR+L   +S +PE+P AIR++IR +     +  LH  L+  D   A ++
Sbjct: 102 LPVFVGGTGLYFRSLDEGISDLPEVPDAIRQRIRAEADGQPTETLHAALALRDPESAERL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRR 130
            PSD  R+ RALEI   +G+SI  F + + P P    PL    K+ +  ER AL++RI  
Sbjct: 162 RPSDRMRVMRALEIHAATGRSIGSFHEARVPGPLAGKPL---LKLFLATEREALRQRIDA 218

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M+E GA+DE+ +L +  L   LP+M+A GV  +IA L G I+  E +QRG   T +
Sbjct: 219 RFVTMMEQGALDEVAALRERRLDPLLPVMRAHGVPGLIAYLDGTISRAEAIQRGQGDTRR 278

Query: 191 YAKRQKTWLCHQFQADW 207
           YAKRQ TW  HQ   DW
Sbjct: 279 YAKRQFTWFRHQMGEDW 295


>gi|299131886|ref|ZP_07025081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Afipia sp.
           1NLS2]
 gi|298592023|gb|EFI52223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Afipia sp.
           1NLS2]
          Length = 310

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 119/196 (60%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI +GGTGLYF+ALT  LS +P +P A+RE IR++L+Q G   L++EL   D   A ++
Sbjct: 92  LPIFIGGTGLYFKALTRGLSNVPPVPDAVREAIRQRLEQNGPEALYEELGKRDPEAAGRL 151

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D  RIARALE+   +G+ + E+      P +P +    + + P+R  + E+I RRF 
Sbjct: 152 KPRDRVRIARALEVVEATGRPLAEWHAHGLPPLLPPQGVVALFLAPDRKVVYEQIDRRFE 211

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M++ GA++E R+L    L   LP MKA GV  +I  L GE++ +E +  G I T  YAK
Sbjct: 212 SMMDRGALEEARALGSRGLDPLLPAMKAHGVPALIRHLAGELSREEAIAIGQIDTRHYAK 271

Query: 194 RQKTWLCHQF-QADWI 208
           RQ TW  HQ  + +W+
Sbjct: 272 RQFTWFRHQLPEFEWV 287


>gi|218530832|ref|YP_002421648.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium chloromethanicum CM4]
 gi|254811017|sp|B7KQF6|MIAA_METC4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218523135|gb|ACK83720.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium chloromethanicum CM4]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFR+L   +S +PE+P AIR++IR +     +  LH  L+  D   A+ +
Sbjct: 102 LPVFVGGTGLYFRSLDEGISDLPEVPDAIRQRIRAEADGQPTETLHAALALRDPESAQGL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRR 130
            PSD  R+ RALEI   +G+SI  F   + P P    PL    K+ +  ER AL++RI  
Sbjct: 162 RPSDRMRVMRALEIHAATGRSIGSFHDARVPGPLAGKPL---LKLFLTTEREALRQRIDA 218

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M+E GA+DE+ +L +  L   LP+M+A GV  + A L G I+ +E +QRG   T +
Sbjct: 219 RFVTMMEQGALDEVAALRERRLDPLLPVMRAHGVPGLTAYLDGTISREEAIQRGQGDTRR 278

Query: 191 YAKRQKTWLCHQFQADW 207
           YAKRQ TW  HQ   DW
Sbjct: 279 YAKRQFTWFRHQMGEDW 295


>gi|92118233|ref|YP_577962.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrobacter
           hamburgensis X14]
 gi|122417351|sp|Q1QJU5|MIAA_NITHX RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91801127|gb|ABE63502.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrobacter
           hamburgensis X14]
          Length = 317

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 118/190 (62%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI  GG+GLYF+ALT  LS +P IP+ +R+ +R +L++ G+  LH  L+  D   A+++
Sbjct: 105 LPIFAGGSGLYFKALTRGLSAVPPIPSQVRDDVRARLERDGAEALHAVLARRDPAAAQRL 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D  RIARALE+   +G+S+ ++ +    P +P +    I + P+R AL  RI  RF 
Sbjct: 165 KPRDRARIARALEVVEATGRSLTDWHRDGLPPLLPPDKVRAIFLAPDREALYARIDARFG 224

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML +GA++E+R+L + +L   LP MKA GV  ++  L+GEI+ +E  + G   T  YAK
Sbjct: 225 AMLAAGALEEVRALAERHLDPLLPAMKAHGVPALMRHLRGEISLEEAAEIGRADTRHYAK 284

Query: 194 RQKTWLCHQF 203
           RQ TW  HQ 
Sbjct: 285 RQFTWFRHQL 294


>gi|209884423|ref|YP_002288280.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oligotropha
           carboxidovorans OM5]
 gi|239977425|sp|B6JB74|MIAA_OLICO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|209872619|gb|ACI92415.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oligotropha
           carboxidovorans OM5]
          Length = 305

 Score =  154 bits (389), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 116/196 (59%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI +GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH+EL+  D   A ++
Sbjct: 92  LPIFIGGTGLYFKALTRGLSDVPPVPDEVRQGVRARLDRDGPEALHEELARRDPQAAARL 151

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D  RIARALE+   +G+ + ++      P +P E    + + P+R+AL ERI RRF 
Sbjct: 152 KPRDRVRIARALEVVEATGRPLADWHAHGLPPLLPAEGVTALFLAPDRAALYERIDRRFE 211

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M  SGA+ E  +L +  L   LP MKA GV  +I  L GE+  +E +  G I T  YAK
Sbjct: 212 VMAASGALAEAEALGRRGLDPLLPAMKAHGVPALIRHLAGELTREEAIAIGQIDTRHYAK 271

Query: 194 RQKTWLCHQF-QADWI 208
           RQ TW  HQ  + +WI
Sbjct: 272 RQFTWFRHQLPEFEWI 287


>gi|85708517|ref|ZP_01039583.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. NAP1]
 gi|85690051|gb|EAQ30054.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. NAP1]
          Length = 319

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 125/205 (60%), Gaps = 6/205 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +    +PI+VGGTG+Y + L   ++ +PEI   +RE +R    Q     L  E    D +
Sbjct: 105 HANDLVPILVGGTGMYLKVLLEGIAPIPEIEPEVREVVRAMETQTAYAALQIE----DPV 160

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKER 127
            A ++ P D QRIARALE+K  +G ++ + W+QA    I  E A   I+++PER  + +R
Sbjct: 161 RAAELEPGDSQRIARALEVKRSTGVTLGD-WQQAKTGGIGDEVALTAIVMMPERQWVYDR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
              RF  M+E GA++E+ +L+  +LS +LP+M+AIGV +I AL++GE   DE ++ G  +
Sbjct: 220 CDARFAAMVEGGAVEEVEALLARDLSPELPVMRAIGVPEIAALIRGEATKDEAIEAGAQS 279

Query: 188 TNKYAKRQKTWLCHQFQADWIRISS 212
           T +YAKRQ TWL +Q   DW RI S
Sbjct: 280 TRQYAKRQFTWLRNQCPEDWKRIES 304


>gi|197287176|ref|YP_002153048.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis HI4320]
 gi|227357129|ref|ZP_03841498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis ATCC 29906]
 gi|238690095|sp|B4F265|MIAA_PROMH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194684663|emb|CAR46600.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis HI4320]
 gi|227162661|gb|EEI47628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis ATCC 29906]
          Length = 313

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 121/196 (61%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I +K  + G   +H EL+S+D + A++I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSANPEIRAEIEKKAAEQGWEAIHQELASVDPVAAKRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SG+S+ E   Q     +P +     I   +R+ L +RI  RF 
Sbjct: 161 HPNDPQRLSRALEVYLISGKSMTEL-TQISGEALPYDVYQFAIAPKDRNVLHQRIEARFK 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML  G  DE++SL  + +L  DLP ++ +G R + + L GEI+YDE + RGI AT + A
Sbjct: 220 QMLTCGFEDEVKSLYQRGDLHEDLPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQITWLRGWHDVHWL 295


>gi|90419208|ref|ZP_01227118.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336145|gb|EAS49886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 302

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 119/201 (59%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYF+AL G L  +PE+P  IRE+ R +L + G+  LH  L+  D   A++I
Sbjct: 95  LPILCGGTGLYFKALLGLLDDLPEVPPKIRERWRNRLAEEGAPALHALLARSDPSAAQRI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+DGQRI RALE+   +GQ +           +   +  K++  PERS L++ I  RF 
Sbjct: 155 DPADGQRIVRALEVGEAAGQPLSALQTGRRPGLLEPAACVKLVTAPERSVLRQTIAERFA 214

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           QM+ +GA++E+ +   +  ++D    KAIGV ++ A+L G +  D  + R    T +YAK
Sbjct: 215 QMMAAGALEEVAAFRTIPGAMDGSAAKAIGVAELSAVLDGTMARDVAVARAATRTRQYAK 274

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ+TW  HQF   W R+ + D
Sbjct: 275 RQETWFRHQFDPSWQRLPAPD 295


>gi|153874640|ref|ZP_02002782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beggiatoa sp.
           PS]
 gi|152068895|gb|EDN67217.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beggiatoa sp.
           PS]
          Length = 308

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 123/203 (60%), Gaps = 3/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF +L   LS +P     +R+ ++ + +Q G   LH  L+ +D   A++I
Sbjct: 94  IPLLVGGTMLYFHSLQQGLSTLPSANPQVRQHLKNEAEQIGWPALHQRLAKIDPQTAQRI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QRI RALEI   SGQ++  ++ +AP P    ES  K++I P ERS L  +I +RF
Sbjct: 154 HPNDAQRIGRALEIYEESGQTMSTWYAKAP-PQPWNESIIKLVIAPTERSVLHAKIAQRF 212

Query: 133 TQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE G I+E+R L +  +L+ DLP M+ +G R +   L GE+ YD   ++ IIAT + 
Sbjct: 213 HTMLEQGFIEEVRRLFEQGDLNPDLPAMRCVGYRQVWHYLAGELLYDNLPEKAIIATRQL 272

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL  Q  ADW      D
Sbjct: 273 AKRQMTWLRTQTDADWFDSDEPD 295


>gi|182679765|ref|YP_001833911.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|239977174|sp|B2IKE2|MIAA_BEII9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|182635648|gb|ACB96422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 302

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 112/190 (58%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI VGGTGLYF+ALT  LS +P +P +IR  +R   +   +  LH EL++ D  +A ++
Sbjct: 91  MPIFVGGTGLYFKALTQGLSDIPSVPDSIRADLRRHAEGCSTPELHRELAARDPEMAARL 150

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+ + +GQS+  F      P + +     + + P+R+ L  RI RRF 
Sbjct: 151 KPNDSQRILRALEVFVATGQSLAAFQNARSAPLLTMSEVLAVFLAPDRADLNRRIDRRFD 210

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLE GA+ E+  L    L   LP+M+A GV  ++  L+GEI+  E   RG + T  YAK
Sbjct: 211 TMLEQGALQEVERLGARGLDPSLPVMRAHGVPHLLRALRGEISLAEAADRGKLDTRHYAK 270

Query: 194 RQKTWLCHQF 203
           RQ T+  HQ 
Sbjct: 271 RQFTFARHQL 280


>gi|170750921|ref|YP_001757181.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|226704733|sp|B1M537|MIAA_METRJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|170657443|gb|ACB26498.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 308

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 111/195 (56%), Gaps = 2/195 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFRAL    S +P +P  +R ++R+  +   +  LH +L+  D   A ++
Sbjct: 101 LPVFVGGTGLYFRALEQGFSELPPVPDTVRARVRDAAEGRPTEALHADLARHDPEGAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQA-PNPFIPLESAHKIIILPERSALKERIRRRF 132
            PSD  R+ RALEI L +G+ I  F+    P P        +I + P+R+AL+ERI  RF
Sbjct: 161 RPSDRMRVMRALEIFLATGRPIASFYGDPVPGPLA-GRDLRRIFLAPDRAALRERIDARF 219

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+  GA+DE+  L    L   LP+M+A GV  +IA L G ++ DE + RG   T  YA
Sbjct: 220 RTMIAEGALDEVARLRARRLDPMLPVMRAHGVPGLIAHLDGALSLDEAIARGQADTRAYA 279

Query: 193 KRQKTWLCHQFQADW 207
           KRQ TW  HQ    W
Sbjct: 280 KRQLTWFRHQMGEAW 294


>gi|227326200|ref|ZP_03830224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 313

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADLAVRQRIEEQAKEIGWEAMHRQLSEIDPVAAIRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K + +  +P +  H+  I P  R  L ERI +RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTSGDA-LPYQ-VHQFAIAPATRELLHERIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLAAGFETEARTLFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|163852074|ref|YP_001640117.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium extorquens PA1]
 gi|226704731|sp|A9W640|MIAA_METEP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|163663679|gb|ABY31046.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium extorquens PA1]
          Length = 317

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFR+L   +S +PE+P A+R++IR +     +  LH  L+  D   A ++
Sbjct: 102 LPVFVGGTGLYFRSLDEGISDLPEVPDAVRQRIRIEADGQPTETLHAALALRDPESAERL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRR 130
            PSD  R+ RALEI   +G+SI  F + + P P    PL    K+ +  ER AL++RI  
Sbjct: 162 RPSDRMRVMRALEIHAATGRSIGSFHEARVPGPLAGKPL---LKLFLATEREALRQRIDA 218

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M+E GA+DE+ +L +  L   LP+M+A GV  +IA L G I+  E +QRG   T +
Sbjct: 219 RFVTMMEQGALDEVAALRERRLDPLLPVMRAHGVPGLIAHLDGTISRQEAIQRGQGDTRR 278

Query: 191 YAKRQKTWLCHQFQADW 207
           YAKRQ TW  HQ    W
Sbjct: 279 YAKRQFTWFRHQMGEAW 295


>gi|188582021|ref|YP_001925466.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium populi BJ001]
 gi|226704732|sp|B1ZDL3|MIAA_METPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|179345519|gb|ACB80931.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium populi BJ001]
          Length = 317

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 119/197 (60%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ VGGTGLYFR+L   +S +PE+P  IR++IR + +   +  LH  L+  D   A+++
Sbjct: 102 LPVFVGGTGLYFRSLEDGISDLPEVPEPIRQQIRAEAEGRPTEALHATLTLRDPKTAQRL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRR 130
            PSD  R+ RALEI   +G+SI  F + + P P    PL    K+ + PER  L+ RI  
Sbjct: 162 RPSDRMRVMRALEIFAATGRSIGSFQETRLPGPLAGRPL---LKVFLSPEREILRRRIDA 218

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M+E+GA+DE+ +L    L   LP+M+A GV  +IA L G ++ +E +QRG   T +
Sbjct: 219 RFVTMMENGALDEVAALRDRRLDPLLPVMRAHGVPGLIAHLDGALSREEAVQRGQGDTRR 278

Query: 191 YAKRQKTWLCHQFQADW 207
           YAKRQ TW  HQ    W
Sbjct: 279 YAKRQFTWFRHQMGEAW 295


>gi|329115606|ref|ZP_08244328.1| tRNA dimethylallyltransferase [Acetobacter pomorum DM001]
 gi|326695034|gb|EGE46753.1| tRNA dimethylallyltransferase [Acetobacter pomorum DM001]
          Length = 344

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 120/213 (56%), Gaps = 5/213 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q + +  LPI+ GGTG+Y  ALT  L+I+P+     R++ R+ + QYG+  LH  L  +D
Sbjct: 110 QAWAQNRLPILCGGTGMYLHALTHGLAIIPDTGDEARQEARQSVAQYGAPALHARLMEVD 169

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSAL 124
              A ++ P D QR++RA E+   +G  +  + KQ   P +P  +   + +   PER+ L
Sbjct: 170 PETACRLRPVDSQRVSRAWEVWRGTGHGLTWWHKQ---PGLPPAACRFVAVRLNPERAEL 226

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           + RI  RF  ML +GA+ E+R+L+   L   LP M+A GV ++ A+L+GEI   E  QR 
Sbjct: 227 RARIAARFENMLRNGAVAEVRTLLARKLDTSLPAMRAHGVPELSAMLRGEITEQEATQRA 286

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + AT +Y KRQ TW  H   A      ++D  F
Sbjct: 287 VQATGRYTKRQATWFAHHSLAKKGLECTVDASF 319


>gi|146342408|ref|YP_001207456.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bradyrhizobium
           sp. ORS278]
 gi|239977183|sp|A4YZB3|MIAA_BRASO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|146195214|emb|CAL79239.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) (Isopentenyl-diphosphate:tRNA
           isopentenyltransferase) (IPTase) (IPPT) [Bradyrhizobium
           sp. ORS278]
          Length = 308

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 115/196 (58%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+ +GGTGLYF+ALT  LS +P +P  IRE +R KL + G   LH EL+  D+  A ++
Sbjct: 98  LPVFIGGTGLYFKALTRGLSAVPPVPDDIREAVRLKLDRDGVEALHAELARRDAAAAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  D  RIARALE+   +G+ + ++  +   P +P E  H + I PER AL  RI  RF 
Sbjct: 158 NVRDRTRIARALEVIEATGRPLADWHAETTPPLLPPERTHALFIAPEREALYARIDARFE 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLE+GA+ E+  L    L   LP MKA GV  +I  L+GEI  +E    G   T  YAK
Sbjct: 218 TMLEAGALAEVERLAARGLDPLLPAMKAHGVPALIRYLRGEITREEAATIGKADTRHYAK 277

Query: 194 RQKTWLCHQF-QADWI 208
           RQ TW  HQ  + +W+
Sbjct: 278 RQFTWFRHQLPEFEWM 293


>gi|253991554|ref|YP_003042910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638432|emb|CAR67054.1| trna delta(2)-isopentenylpyrophosphate transferase (ec 2.5.1.8) (ip
           transferase) (isopentenyl-diphosphate:trna
           isopentenyltransferase (iptase) (ippt) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783004|emb|CAQ86169.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           asymbiotica]
          Length = 313

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 121/199 (60%), Gaps = 2/199 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR KI ++  + G  +LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPIIRAKIEQQAAEQGWDVLHQQLQKIDPVAALRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SG+++ E  K +    +P       I   +R  L +RI  RF 
Sbjct: 161 HPNDPQRLSRALEVFLISGKTLTELTKLS-GEDLPYRVYQFAIAPAKREILHQRIEARFH 219

Query: 134 QMLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLESG  +E ++L   N L +DLP ++ +G R + + L GEI+YDE + RGI AT + A
Sbjct: 220 QMLESGFEEEAKALYARNDLHVDLPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRIS 211
           KRQ TWL    Q  W+  S
Sbjct: 280 KRQMTWLRGWKQVHWLDSS 298


>gi|322831155|ref|YP_004211182.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rahnella sp.
           Y9602]
 gi|321166356|gb|ADW72055.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rahnella sp.
           Y9602]
          Length = 313

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 122/197 (61%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +RE+I ++  + G   LHD+L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPPADPVVRERIEKQAAEQGWEALHDQLRKIDPVAAMRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L  RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYR-VHQFAIAPTRRELLHARIEERF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           +QML +G  DE+R+L+ + +L  DLP ++ +G R + + L GE +YDE + RG+ AT + 
Sbjct: 219 SQMLSNGFEDEVRTLIARGDLHTDLPSIRCVGYRQMWSYLSGEFDYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL      +W+
Sbjct: 279 AKRQMTWLRGWESVEWL 295


>gi|296283979|ref|ZP_06861977.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citromicrobium
           bathyomarinum JL354]
          Length = 312

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGTGLY R L   ++ +P IP  +R+ +R       +     EL++ D     ++
Sbjct: 109 VPILVGGTGLYIRTLMEGIAPVPTIPADVRDAVR----ALPTPDAFAELATADPASHARL 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P D QRIARALE+   +G ++ E+ ++         +   +I+LPER  L  R   RF+
Sbjct: 165 NPGDTQRIARALEVVRATGLTLGEWQQRKEGGIADRVALSPVILLPEREWLYARCDARFS 224

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLE GA+ E+ +L+  +L  DLP+M+AIGVR+I   L+GE + +E ++ G  AT  YAK
Sbjct: 225 AMLEQGAVAEVEALLARDLDPDLPVMRAIGVREIAGWLRGECSREEMIETGQRATRNYAK 284

Query: 194 RQKTWLCHQFQADWIRISSIDDLF 217
           RQ TWL HQ   DW R+ +  D  
Sbjct: 285 RQYTWLRHQPPQDWPRVETAADAL 308


>gi|227115181|ref|ZP_03828837.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 313

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 120/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPPADPAVRQRIEEQAKEIGWEAMHRQLGEIDPVAAIRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K + +  +P +  H+  I P  R  L ERI +RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTSGDA-LPYQ-VHQFAIAPATRELLHERIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLAAGFETEARTLFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|261823152|ref|YP_003261258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           wasabiae WPP163]
 gi|261607165|gb|ACX89651.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           wasabiae WPP163]
          Length = 313

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 120/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADAAVRQRIEEQAKEVGWEAMHRQLSEIDPVAAIRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K + +  +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTSGDA-LPYQ-VHQFAIAPATRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLAAGFETEARILFTRQDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|217979346|ref|YP_002363493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylocella
           silvestris BL2]
 gi|239977415|sp|B8EQB8|MIAA_METSB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|217504722|gb|ACK52131.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylocella
           silvestris BL2]
          Length = 303

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI VGGTGLYF+ALT  LS +P +P  IR K+R + +   +  LH ELS+ D ++A ++
Sbjct: 97  LPIFVGGTGLYFKALTQGLSDIPAVPDDIRAKLRARTEGVAATELHAELSARDPLMAARL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QR+ RALE+   +G+S+  F  +   P +   +   I + PER+AL  RI  RF 
Sbjct: 157 RPSDPQRLLRALEVLEATGRSLASFQSRRGPPVLDPAATRAIFLSPERAALNLRIDERFE 216

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML SGA  E+ +L +  L   LP+M+A GV  +IA L+G+I  DE ++ G   T  YA+
Sbjct: 217 AMLASGAWAEVEALRRRGLDPALPLMRAHGVPHLIAHLEGKIPQDEAIRLGKRDTRAYAR 276

Query: 194 RQKTWLCHQF 203
           RQ T+  HQ 
Sbjct: 277 RQFTFARHQL 286


>gi|258542999|ref|YP_003188432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634077|dbj|BAI00053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637137|dbj|BAI03106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640189|dbj|BAI06151.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643246|dbj|BAI09201.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646301|dbj|BAI12249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649354|dbj|BAI15295.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652340|dbj|BAI18274.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655398|dbj|BAI21325.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 337

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q + +  LPI+ GGTG+Y  ALT  L+I+P+     R++ R+ + QYG+  LH  L  +D
Sbjct: 103 QVWAQNRLPILCGGTGMYLHALTNGLAIIPDTGEEARQEARQSVAQYGAPALHARLMEVD 162

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSAL 124
              A ++ P D QR++RA E+   +G  +  + KQ   P +P  +   + +   PER+ L
Sbjct: 163 PETASRLRPVDSQRVSRAWEVWRGTGHGLTWWHKQ---PGLPPAACRFVAVRLNPERAEL 219

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           + RI  RF  ML +GA+ E+++L+   L   LP M+A GV ++ A+L+GEI   E  QR 
Sbjct: 220 RARIAARFENMLRNGALAEVQALLARKLDTSLPAMRAHGVPELSAMLRGEITEQEATQRA 279

Query: 185 IIATNKYAKRQKTWLCHQ 202
           + AT +Y KRQ TW  H 
Sbjct: 280 VQATGRYTKRQATWFAHH 297


>gi|85714708|ref|ZP_01045695.1| tRNA isopentenyltransferase [Nitrobacter sp. Nb-311A]
 gi|85698593|gb|EAQ36463.1| tRNA isopentenyltransferase [Nitrobacter sp. Nb-311A]
          Length = 314

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 117/197 (59%), Gaps = 1/197 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           L I VGG+GLYF+ALT  LS +P IP  +R+ +R +L++ G+  LH  L+  D   A+++
Sbjct: 105 LSIFVGGSGLYFKALTRGLSAVPPIPPQVRDDVRARLERDGAEALHAVLARCDPAAAQRL 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D  RIARALE+   +G+S+ ++ +    P +P      + + P+R AL  RI  RF 
Sbjct: 165 KPRDRVRIARALEVIEATGRSLTDWHRDGLPPLLPPRCVKAVFLAPDRDALYARIDARFG 224

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML +GA++E+ +L +  L   LP MKA GV  +I  L+GEI+  E  + G   T  YAK
Sbjct: 225 AMLTAGALEEVAALAQRRLDPLLPAMKAHGVPALIRHLRGEISLAEAAEIGRADTRHYAK 284

Query: 194 RQKTWLCHQF-QADWIR 209
           RQ TW  HQ  +  W+R
Sbjct: 285 RQFTWFRHQLPEFAWVR 301


>gi|271502154|ref|YP_003335180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech586]
 gi|270345709|gb|ACZ78474.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech586]
          Length = 313

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    +IR++I E+ +  G   LH +LS++D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADASIRQEIEERARTEGWEALHRQLSAIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K +    +P    H+  I P  R  L ERI  RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTS-GEALPYR-VHQFAIAPATRELLHERIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 RQMLESGFETEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|319405979|emb|CBI79611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella sp.
           AR 15-3]
          Length = 284

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/192 (39%), Positives = 119/192 (61%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P IP   REK R +L++ G+  L+ +L  +DS ++++I  
Sbjct: 88  IFVGGTGLYFRALLEGISEIPYIPDVCREKWRRRLQEEGAENLYRQLLQVDSALSKRICA 147

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R  L E I +R   M
Sbjct: 148 QDGQRIIRALEVYDVTGKTLSWWQKQKTTSLIAKDCSEKILLIPPRQQLYENINKRLDHM 207

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+  + ++ LS  LP MKAIG+ + IA L G ++++  ++     T +YAKRQ
Sbjct: 208 VEQGVLEEVFIIKQLMLSPLLPAMKAIGLSEFIAYLDGYLSFENAIETVKTKTRRYAKRQ 267

Query: 196 KTWLCHQFQADW 207
            TW  +Q   +W
Sbjct: 268 MTWFRNQLNEEW 279


>gi|283786850|ref|YP_003366715.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Citrobacter rodentium ICC168]
 gi|282950304|emb|CBG89951.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Citrobacter rodentium ICC168]
          Length = 316

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 121/188 (64%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++ ++ G   LH +L+++D + AR+I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAEEQGWEALHQQLATIDPVAARRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P    H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYH-VHQFAIAPASREVLHQRIAQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+G+I+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEVEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGDISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|50122855|ref|YP_052022.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|61214081|sp|Q6D066|MIAA_ERWCT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49613381|emb|CAG76832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 313

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 120/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +LS +D   A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPPADAAVRQRIEEQAKEIGWEAMHRQLSEIDPTAAIRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+  +SG ++ E  K + +  +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGNTLTELTKTSGDA-LPYQ-VHQFAIAPAMRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLAAGFETEARALFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|240850864|ref|YP_002972264.1| tRNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           grahamii as4aup]
 gi|240267987|gb|ACS51575.1| tRNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           grahamii as4aup]
          Length = 290

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 117/193 (60%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P +P  +R+K   +L + G   L+ +L  +D++VA++I  
Sbjct: 95  IFVGGTGLYFRALLEGISEIPHVPDVVRQKWLLRLDKEGVASLYRQLLQIDAVVAKKISS 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QRI RALE+   +G+++  + KQ   P I      KI+++P R  L ERI +R   M
Sbjct: 155 HDRQRIVRALEVYDATGKTLSWWQKQKTTPLIAPNFTEKILLMPPRPLLYERIHKRLDSM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E GA++E+  +  + LS  LP MKAIG+ + +A L G  +++  L+     T +YAKRQ
Sbjct: 215 IERGALEEVMIMKNLMLSPSLPAMKAIGIPEFMAYLDGYRSFENALEAVKTQTRRYAKRQ 274

Query: 196 KTWLCHQFQADWI 208
            TW  +QF  +W+
Sbjct: 275 MTWFRNQFDEEWM 287


>gi|328543005|ref|YP_004303114.1| tRNA dimethylallyltransferase [Polymorphum gilvum SL003B-26A1]
 gi|326412751|gb|ADZ69814.1| tRNA dimethylallyltransferase [Polymorphum gilvum SL003B-26A1]
          Length = 321

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 123/199 (61%), Gaps = 6/199 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGTGLYF+AL   L+ +P IP AIR + R   +  G+  +   L + D   A ++
Sbjct: 107 VPILVGGTGLYFKALIEGLAELPAIPEAIRARWRHVAETEGTEAIRAALRTRDPQAAERL 166

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH--KIIILPERSALKERIRRR 131
             +D QR+ RALE+   +G+++ + W+ A      L  A   ++++ P R+ L ERI RR
Sbjct: 167 --ADLQRLTRALEVVEATGRTLAD-WQAASQGAATLAEAETTRLVLAPPRAWLHERIARR 223

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
              MLE GAIDE+ +L+K  LS  LP M+AIGV++I A L  EI+ +E  +R  +AT +Y
Sbjct: 224 AEAMLEGGAIDEVAALLKRGLSPRLPAMRAIGVKEIAAHLAAEIDLEEAARRLTVATRQY 283

Query: 192 AKRQKTWLCHQFQADWIRI 210
           AKRQ+TW  +Q   DW R+
Sbjct: 284 AKRQETWFRNQM-GDWARL 301


>gi|326795797|ref|YP_004313617.1| tRNA dimethylallyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546561|gb|ADZ91781.1| tRNA dimethylallyltransferase [Marinomonas mediterranea MMB-1]
          Length = 310

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 119/186 (63%), Gaps = 1/186 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF AL   L+ MP+   AIR++I ++ + YG   LH ELS +D   A++IH
Sbjct: 96  PLLVGGTMMYFNALQKGLAEMPQSNEAIRDEIEQEARDYGWEHLHKELSRIDPESAKRIH 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ RALE+  VSG+++ E W +     +P    +  ++  ERS L  RI  RF Q
Sbjct: 156 PNDPQRLQRALEVYRVSGKTMTELWAKQEPQKLPFNMINLAVMPDERSILHRRIEERFHQ 215

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           M++ G ++E+  L  + +L+L+LP ++ +G R +   L+GE + D+ + +GI+AT + AK
Sbjct: 216 MMDLGFLNEVEDLYQRGDLTLELPSIRCVGYRQLWQYLEGEDSLDDAIFKGIVATRQLAK 275

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 276 RQLTWL 281


>gi|269468116|gb|EEZ79826.1| tRNA delta(2)-isopentenylpyrophosphate transferase [uncultured
           SUP05 cluster bacterium]
          Length = 308

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 118/188 (62%), Gaps = 5/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGT  YF AL   LS +PE  +A R+K  + L+  GS  LH +L+ +D   A +I
Sbjct: 97  LPILVGGTSFYFNALEHGLSNLPESTSASRQKFNQLLQDKGSAKLHQDLAKIDEKAALRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           HP+D QR+ RALE+  +SG+++ E    + P+   P++   KII++PERS L +RI  RF
Sbjct: 157 HPNDSQRVTRALEVFDLSGKTLSELQGNKKPSINYPIK---KIILMPERSELHQRIEARF 213

Query: 133 TQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M+++G +DE++ L +  NL+ DLP ++ +G R     L GE++    ++R IIAT + 
Sbjct: 214 LSMMDNGFLDEVKHLKQNPNLNEDLPSIRCVGYRQAWQYLNGEMDKPSMIERAIIATRQL 273

Query: 192 AKRQKTWL 199
            K Q TWL
Sbjct: 274 CKHQSTWL 281


>gi|319404480|emb|CBI78087.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 284

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 121/192 (63%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P+IP   ++K R +L++ G   L+ +L  +D+ ++++I  
Sbjct: 88  IFVGGTGLYFRALLEGISEIPDIPDVCQQKWRRRLQEEGVENLYRQLLQVDAELSKRICA 147

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R  L E I +R  +M
Sbjct: 148 QDGQRIIRALEVYDVTGKALSWWQKQETTSLIAKDCSEKILLIPPRQQLYENINKRLDRM 207

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+  + ++ LS  LP+MKAIG+ + IA L G ++++  ++     T +YAKRQ
Sbjct: 208 VEQGVLEEVLIIKQLMLSPLLPVMKAIGLPEFIAYLDGHLSFENAIETAKTKTRRYAKRQ 267

Query: 196 KTWLCHQFQADW 207
            TW  +Q   +W
Sbjct: 268 MTWFRNQLNEEW 279


>gi|90408488|ref|ZP_01216647.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Psychromonas sp. CNPT3]
 gi|90310420|gb|EAS38546.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Psychromonas sp. CNPT3]
          Length = 307

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 117/186 (62%), Gaps = 2/186 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LY+++L   LS +P+     R +I  +  Q G  ++HD+L+ +D + A +IH
Sbjct: 97  PLLVGGTMLYYKSLIDGLSPLPQACADTRAQIESEAAQLGWQVMHDKLAQIDPVAALRIH 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            +D QR++RALE+  +SG+S+ +  +    P IP       I   E++ L +RI +RF  
Sbjct: 157 VNDPQRLSRALEVYRISGKSMTDLTQIKSEP-IPFNVRQFAIAPQEKTTLHQRIEQRFIN 215

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE+G  DE+R L  + +L LDLP M+ +G R +   L+GEI++DE   RGI+AT + AK
Sbjct: 216 MLETGFEDEVRKLKARKDLHLDLPAMRCVGYRQMWQYLEGEIDHDEMQFRGIVATRQLAK 275

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 276 RQMTWL 281


>gi|319899128|ref|YP_004159221.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           clarridgeiae 73]
 gi|319403092|emb|CBI76650.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           clarridgeiae 73]
          Length = 291

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 118/192 (61%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL    S +P IP   R+K R +L++ G+  L+ +L  +D+ ++ +I  
Sbjct: 95  IFVGGTGLYFRALLEGFSEIPHIPDICRQKWRRRLQEEGAESLYRQLLHVDAALSERIVE 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+++  + KQ     I  +   KI+++P R  L ERI +R   M
Sbjct: 155 QDGQRIIRALEVYDVTGRTLSWWQKQKTTSLIAKDCLEKILLIPPRQQLYERINKRLDNM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G + E+ ++ ++ LS  LP MKAIG+ ++IA L G ++++  ++     T +YAKRQ
Sbjct: 215 VEQGVLQEVLAIRQLMLSPLLPAMKAIGLPELIAYLDGYLSFENAIETAKKQTRRYAKRQ 274

Query: 196 KTWLCHQFQADW 207
            TW  +Q   +W
Sbjct: 275 MTWFRNQLNGEW 286


>gi|167554134|ref|ZP_02347875.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205321593|gb|EDZ09432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 316

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQKTWL
Sbjct: 279 AKRQKTWL 286


>gi|90022313|ref|YP_528140.1| tRNA isopentenyltransferase [Saccharophagus degradans 2-40]
 gi|123395832|sp|Q21HA1|MIAA_SACD2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|89951913|gb|ABD81928.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Saccharophagus
           degradans 2-40]
          Length = 336

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 120/203 (59%), Gaps = 2/203 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT +YF+AL   LS MP    A+R +I ++  + G   LH EL+S+D   A  I
Sbjct: 112 IPVLAGGTMMYFKALLEGLSDMPASDPAVRAQIDKRASEEGWPALHSELASVDPETAANI 171

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+   RI+RALE+ ++SG+ +  +  QA N  I      +I + P ER+ L +RI +RF
Sbjct: 172 HPNHSHRISRALEVYVISGKRMSAWRGQANNGLIDTYDWVQICVAPRERTLLHQRIAQRF 231

Query: 133 TQMLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE G IDE+R+L   N L++D+P ++A+G R     L G  +YDE  ++GI AT + 
Sbjct: 232 DMMLEQGFIDEVRALYSRNDLNVDMPSIRAVGYRQAWDYLAGVSSYDEMREKGIAATRQL 291

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL      +WI     D
Sbjct: 292 AKRQFTWLRSWQGLEWIYTQDED 314


>gi|296100938|ref|YP_003611084.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055397|gb|ADF60135.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 316

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR KI +K  + G  +LH +L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEIRAKIEQKAAEQGWDVLHQQLAEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML S    E+R+L  + +L  D+P ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASDFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|298293072|ref|YP_003695011.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Starkeya
           novella DSM 506]
 gi|296929583|gb|ADH90392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Starkeya
           novella DSM 506]
          Length = 306

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 116/192 (60%), Gaps = 3/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLYF+ALT  LS MP IP  +RE++R       +  LH  L+S+D   A ++
Sbjct: 99  LPILIGGTGLYFKALTQGLSPMPAIPPEVRERVRAL--DLDAPALHARLASVDPETAARL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
            PSD QR+ RALE+   +G+ +  +  ++   P +P E A +I +  +R+AL+ RI  RF
Sbjct: 157 RPSDTQRLMRALEVFEATGRPLARWQAERTEPPVLPAEEAVRIFLATDRTALRTRIATRF 216

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E GA++E R+L+  NL  D  ++KA G+      L G I  DE ++  I+ T  YA
Sbjct: 217 HVMMEEGAMEEARALLARNLPADRTVLKAHGMPWFARHLAGGITLDEAIEGAILDTRHYA 276

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  HQ +
Sbjct: 277 KRQDTWFRHQLK 288


>gi|284006625|emb|CBA71886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Arsenophonus
           nasoniae]
          Length = 298

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 125/204 (61%), Gaps = 11/204 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I  + KQ G   +H  L  +D I A +I
Sbjct: 86  IPLLVGGTMLYFKALLDGLSPLPSADVTIRAEIELQAKQSGWGAIHKRLQEVDPISAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIILPERSALKERIRRR 131
           HP+D QR++RALE+ LVSG+S+ E  +  +A  P+  L+ A   I   +R  L +RI  R
Sbjct: 146 HPNDPQRLSRALEVFLVSGKSLTELTEIVEAELPYNVLQFA---ISPQDRKILHQRIEMR 202

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F QML +G  DE+ +L  + +L  DLP ++++G R + + L GEINYDE + RGI AT +
Sbjct: 203 FLQMLNAGFEDEVSALYARGDLHQDLPAIRSVGYRQMWSYLSGEINYDEMVYRGICATRQ 262

Query: 191 YAKRQKTWL-----CHQFQADWIR 209
            AKRQ TWL      H+  +D I+
Sbjct: 263 LAKRQITWLKGWKNVHRLDSDDIK 286


>gi|251788131|ref|YP_003002852.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya zeae
           Ech1591]
 gi|247536752|gb|ACT05373.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya zeae
           Ech1591]
          Length = 313

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/188 (43%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I E+ +  G   LH +LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADARVRQEIEERARNEGWEALHRQLSVIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K +    +P    H+  I P  R  L ERI  RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTS-GEALPYR-VHQFAIAPATRELLHERIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 RQMLESGFEAEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|253690083|ref|YP_003019273.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259495770|sp|C6DFJ8|MIAA_PECCP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|251756661|gb|ACT14737.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 313

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPPADAAVRQRIEEQAKEVGWEAMHRQLSEIDPVAAIRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K + +  +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTSGDA-LPYQ-VHQFAIAPATRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +    E R L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLAADFEREARLLFARQDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|158424199|ref|YP_001525491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azorhizobium
           caulinodans ORS 571]
 gi|229621752|sp|A8IAX3|MIAA_AZOC5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|158331088|dbj|BAF88573.1| tRNA isopentenyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 312

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 116/196 (59%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLYFRALT  L+ +PEIP  +R+++R   +   + +LH  L++ D   A ++
Sbjct: 102 LPIVIGGTGLYFRALTRGLAPIPEIPEEVRQRVRRMAEDEVTVVLHARLATRDPEAAVRL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D QRI RALE+   +GQ + ++ +    P +   SA + ++  ER  L+ RI RRF 
Sbjct: 162 QPQDRQRILRALEVFEATGQPLSQWQRATHRPVLEEASAVRFVLEVERETLRGRIDRRFE 221

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M+E+GA+ E+  L    L  D  I+KA G   +   L+GE++  + +  G   T +YAK
Sbjct: 222 TMMEAGALAEVERLAARELPADRTILKAHGAPALTRYLRGEMSRADAIAEGQNDTRRYAK 281

Query: 194 RQKTWLCHQFQADWIR 209
           RQ TW  HQ   DW+R
Sbjct: 282 RQVTWFRHQM-PDWMR 296


>gi|330831014|ref|YP_004393966.1| tRNA dimethylallyltransferase [Aeromonas veronii B565]
 gi|328806150|gb|AEB51349.1| tRNA dimethylallyltransferase [Aeromonas veronii B565]
          Length = 309

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    AIR  I E+  + G   LHDEL  +D +   +I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPSADPAIRAGIEEEAARCGWQALHDELVRIDPVAGARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L +RI +RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYRVLQFAIAPSDRAVLHQRIEQRFD 215

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +ML+ G   E+R+LM + +L  DLP ++ +G R +   L GE+ YDE   RGI+AT + A
Sbjct: 216 KMLQGGFEQEVRALMARGDLHPDLPSIRCVGYRQMWDYLCGEVGYDEMRYRGIVATRQLA 275

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 276 KRQMTWLRGWPDVTWL 291


>gi|261345216|ref|ZP_05972860.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rustigianii DSM 4541]
 gi|282566911|gb|EFB72446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rustigianii DSM 4541]
          Length = 313

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IRE I +   + G   +H  L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSASPEIRETIEQIAHEQGWGEIHRRLAEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SGQ++ E   Q     +P       I   +R  L ERI RRF 
Sbjct: 161 HPNDPQRLSRALEVYLISGQTLTEM-TQTAGTELPYNVFQFAIEPQDRKILHERIERRFH 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            MLE+G  +E+R+L  + +L +DLP ++ +G R + + L GEI+YDE + RGI AT + A
Sbjct: 220 LMLEAGFENEVRALYQRGDLHVDLPSIRCVGYRQMWSYLDGEIDYDEMVYRGICATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQVTWL 286


>gi|157147860|ref|YP_001455179.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           koseri ATCC BAA-895]
 gi|166198899|sp|A8AMN0|MIAA_CITK8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157085065|gb|ABV14743.1| hypothetical protein CKO_03664 [Citrobacter koseri ATCC BAA-895]
          Length = 316

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I ++  + G  +LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSAEPEIRARIEQQAAEQGWDVLHRQLQDIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|146310019|ref|YP_001175093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           sp. 638]
 gi|167011776|sp|A4W5R2|MIAA_ENT38 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145316895|gb|ABP59042.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           sp. 638]
          Length = 316

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R KI ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRAKIEQQAAEQGWSALHKQLEEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  D+P ++ +G R I + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQIWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|91976574|ref|YP_569233.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisB5]
 gi|123721912|sp|Q139A7|MIAA_RHOPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91683030|gb|ABE39332.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisB5]
          Length = 323

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 114/190 (60%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI VGGTGLYF+ALT  LS +P +   +R+ +R +L + G   LH EL+  D   A ++
Sbjct: 116 LPIFVGGTGLYFKALTRGLSAVPPVAAEVRDAVRLRLDRDGVLALHAELARHDPAGAARL 175

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D  RIARALE+ L +G+ + ++  QA  P +P E    + + PER AL  RI  RF 
Sbjct: 176 APADRSRIARALEVVLATGRPLADWHNQASPPLLPPEGFVAMFLAPEREALYGRIDARFA 235

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML++GA++E+ +L   NL   LP MKA GV  +I   +GE++ +E    G   T  YAK
Sbjct: 236 AMLQAGALEEVAALAARNLDPLLPAMKAHGVPALIRHFRGELSLEEAAAIGAADTRHYAK 295

Query: 194 RQKTWLCHQF 203
           RQ TW  HQ 
Sbjct: 296 RQFTWFRHQL 305


>gi|324112232|gb|EGC06210.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           fergusonii B253]
          Length = 316

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P   + +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADSEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|332160021|ref|YP_004296598.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664251|gb|ADZ40895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862096|emb|CBX72262.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica W22703]
          Length = 313

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 121/197 (61%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G  +LH +L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAAELGWEVLHQQLAEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYR-VHQFAIAPVSRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWGSVQWL 295


>gi|239977340|sp|A5EPC1|MIAA_BRASB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 305

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 113/196 (57%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI +GGTGLYF+ALT  LS +P +P  +RE +R +L + G   LH EL+  D+  A ++
Sbjct: 98  LPIFIGGTGLYFKALTRGLSAVPPVPDEVREAVRLRLDRDGVEALHAELARRDAAAAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  D  RIARALE+   +G+ + E+  +   P +P  S   + I PER AL  RI  RF 
Sbjct: 158 NVRDRTRIARALEVIEATGRPLAEWHAETTPPLLPEGSYRALFIAPEREALYARIDARFD 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML  GA++E+  L    L   LP MKA GV  +I  L+GEI  +E    G   T  YAK
Sbjct: 218 AMLADGALEEVARLAARGLDPLLPAMKAHGVPALIRHLRGEITREEAAMIGKADTRHYAK 277

Query: 194 RQKTWLCHQF-QADWI 208
           RQ TW  HQ  + DW+
Sbjct: 278 RQFTWFRHQLPEFDWL 293


>gi|307292651|ref|ZP_07572497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           chlorophenolicum L-1]
 gi|306880717|gb|EFN11933.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           chlorophenolicum L-1]
          Length = 314

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (59%), Gaps = 6/197 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I  AIR  IR           H  L+  D   A ++
Sbjct: 104 LPILVGGTGLYLRTLLDGIAPIPDIDPAIRAVIRAMPVADA----HAALAKEDPEAAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKERIRRRF 132
            P+D  R+ARALE+   +G+ + + W+Q  +  I    A   +I+LP R  L  R   RF
Sbjct: 160 APADTTRVARALEVVRSTGKPLAQ-WQQHKSGGIADRIALSPLILLPPRDWLTARCDLRF 218

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QM++SGA+ E+ +L+  NLS DLP+M+AIGV +I A L GEI+ D+ L+RG IAT +YA
Sbjct: 219 GQMVDSGAVAEVEALIARNLSPDLPVMRAIGVPEIAAWLAGEIDRDKMLERGRIATRQYA 278

Query: 193 KRQKTWLCHQFQADWIR 209
           KRQ TW   Q   +W R
Sbjct: 279 KRQYTWFSRQPPPEWPR 295


>gi|148257336|ref|YP_001241921.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bradyrhizobium
           sp. BTAi1]
 gi|146409509|gb|ABQ38015.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bradyrhizobium
           sp. BTAi1]
          Length = 265

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 113/196 (57%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI +GGTGLYF+ALT  LS +P +P  +RE +R +L + G   LH EL+  D+  A ++
Sbjct: 58  LPIFIGGTGLYFKALTRGLSAVPPVPDEVREAVRLRLDRDGVEALHAELARRDAAAAARL 117

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +  D  RIARALE+   +G+ + E+  +   P +P  S   + I PER AL  RI  RF 
Sbjct: 118 NVRDRTRIARALEVIEATGRPLAEWHAETTPPLLPEGSYRALFIAPEREALYARIDARFD 177

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML  GA++E+  L    L   LP MKA GV  +I  L+GEI  +E    G   T  YAK
Sbjct: 178 AMLADGALEEVARLAARGLDPLLPAMKAHGVPALIRHLRGEITREEAAMIGKADTRHYAK 237

Query: 194 RQKTWLCHQF-QADWI 208
           RQ TW  HQ  + DW+
Sbjct: 238 RQFTWFRHQLPEFDWL 253


>gi|154245603|ref|YP_001416561.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthobacter
           autotrophicus Py2]
 gi|238686711|sp|A7IFW1|MIAA_XANP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|154159688|gb|ABS66904.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthobacter
           autotrophicus Py2]
          Length = 316

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 117/199 (58%), Gaps = 1/199 (0%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
            LPI VGGTGLYFRALT  L+ +P +P  +R ++R   +   S  LH  L+ +D   A +
Sbjct: 102 LLPIFVGGTGLYFRALTQGLAEIPPVPETVRREVRGTAEGLDSLALHARLADMDPQSAAR 161

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           + P+D QR+ RALE+   +G+S+ ++ K AP P +      ++++  +R+ L++RI  RF
Sbjct: 162 LQPNDRQRVLRALEVITATGRSLSDWQKDAPRPVLDASRCVRLVLEVDRAVLRQRIDARF 221

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+  GA++E+R+L    L     ++KA G   +   L GE+  D+ +  G   T +YA
Sbjct: 222 EAMMAEGALEEVRALAARRLDPSRTVLKAHGAPALTRHLAGEMTLDDAIAEGQSDTRRYA 281

Query: 193 KRQKTWLCHQFQADWIRIS 211
           KRQ+T+  HQ  ADW R +
Sbjct: 282 KRQETFFRHQM-ADWPRAT 299


>gi|220926470|ref|YP_002501772.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium nodulans ORS 2060]
 gi|239977412|sp|B8IEX6|MIAA_METNO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219951077|gb|ACL61469.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium nodulans ORS 2060]
          Length = 303

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/195 (41%), Positives = 118/195 (60%), Gaps = 2/195 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLYF+AL   LS +P +P A+R  +R + +   +  LH +L+ LD   A +I
Sbjct: 94  LPIVVGGTGLYFKALLEGLSAIPPVPEAVRAAVRAQAEGRETASLHADLARLDPEGAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
            P D  R+ RALEI+  +G+ +  F   + P P   + +  K+ + P+R+ L+ RI  RF
Sbjct: 154 APGDRLRVLRALEIRAATGRPLSAFQGSRQPGPLAGV-ACEKLFLAPDRAGLRARIDARF 212

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E+GA+DE+R L   +L   LP+M+A GV  +IA L G +  +E + RG   T +YA
Sbjct: 213 LSMMEAGALDEVRRLRARHLDPMLPVMRAHGVPGLIAHLNGALTREEAVARGQADTRRYA 272

Query: 193 KRQKTWLCHQFQADW 207
           KRQ TW  HQ   DW
Sbjct: 273 KRQVTWFRHQVGEDW 287


>gi|212709952|ref|ZP_03318080.1| hypothetical protein PROVALCAL_01003 [Providencia alcalifaciens DSM
           30120]
 gi|212687361|gb|EEB46889.1| hypothetical protein PROVALCAL_01003 [Providencia alcalifaciens DSM
           30120]
          Length = 313

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 118/187 (63%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +RE I +  +++G   +H  L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSASPEVRETIEQIAQEHGWAEVHRRLADVDPVSAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SGQS+ E   Q     +P       I   +R  L ERI +RF 
Sbjct: 161 HPNDPQRLSRALEVYLISGQSLTEM-TQTAGTELPYNVFQFAIEPQDRKILHERIEQRFR 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML++G  DE+++L  + +L +DLP ++ +G R + + L GEI+YDE + RGI AT + A
Sbjct: 220 LMLDAGFEDEVKALYQRGDLHVDLPSIRCVGYRQMWSYLDGEIDYDEMVYRGICATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQITWL 286


>gi|216567|dbj|BAA00643.1| miaA protein [Escherichia coli]
          Length = 216

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 1   IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 60

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 61  HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 118

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 119 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 178

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 179 AKRQITWL 186


>gi|330991470|ref|ZP_08315421.1| tRNA dimethylallyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329761489|gb|EGG77982.1| tRNA dimethylallyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 324

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 111/187 (59%), Gaps = 3/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+  GGTG+YFRALT  L+ +P+ P AIR + R  + + G    H EL  LD+  A  +
Sbjct: 91  VPVFCGGTGMYFRALTDGLADIPQPPDAIRAQARAMVARLGPEGAHAELHELDAETASTL 150

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
            P+DGQRIARALE++L +G  +  + ++A  P  PL +    + L P R  L+  I RRF
Sbjct: 151 RPADGQRIARALEVRLATGHGLAWWRREAVLP--PLAARFIAVRLHPPRDMLRAAIARRF 208

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E GA+ E+  L++  L  DLP M+A GV ++ A+L+G +   +   R I  T +Y 
Sbjct: 209 HAMVEQGAMAEVAHLLEQGLPPDLPAMRAHGVPELAAVLRGGMTLADATARAITLTGQYT 268

Query: 193 KRQKTWL 199
           KRQ TW 
Sbjct: 269 KRQATWF 275


>gi|161505137|ref|YP_001572249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|189081959|sp|A9MFP1|MIAA_SALAR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160866484|gb|ABX23107.1| hypothetical protein SARI_03271 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 316

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G  +LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWELLHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|436154|gb|AAC43396.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli]
          Length = 216

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 117/187 (62%), Gaps = 4/187 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +IH
Sbjct: 2   PLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIH 61

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRFT 133
           P+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF 
Sbjct: 62  PNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRFH 119

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + A
Sbjct: 120 QMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLA 179

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 180 KRQITWL 186


>gi|332172029|gb|AEE21283.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 315

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 121/204 (59%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +Y++ALT  LS +P+  + +R +I ++ ++ G   LH EL  +D + A++I
Sbjct: 102 IPLLVGGTMMYYKALTDGLSTLPQADSLVRAEIEKQAQENGWQTLHQELQGIDPVSAQRI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ RALEI  +SG+S+ E       P  P + +   I   +R  L +RI +RF 
Sbjct: 162 HPNDPQRLTRALEIYRISGKSMTEL-SLNKQPSAPYQFSQFAIAPQDRHVLHDRIAQRFD 220

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML SG  DE+ +L K  +L LDLP M+ +G R +   L G  +Y E  ++G+ AT + A
Sbjct: 221 IMLNSGFEDEVATLRKREDLHLDLPSMRCVGYRQMWQYLDGNNSYQEMREKGLAATRQLA 280

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TWL       W+   S D+L
Sbjct: 281 KRQLTWLRSWQNLHWLDTFSKDNL 304


>gi|283834789|ref|ZP_06354530.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           youngae ATCC 29220]
 gi|291069035|gb|EFE07144.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           youngae ATCC 29220]
          Length = 316

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPDVRARIEQQAAERGWDALHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P E  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYE-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|307132705|ref|YP_003884721.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Dickeya dadantii 3937]
 gi|306530234|gb|ADN00165.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Dickeya dadantii 3937]
          Length = 313

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I E+ +  G   LH +LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADAQVRQEIEERARIEGWEALHRQLSVIDPVSAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K +    +P    H+  I P  R  L ERI  RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTS-GEALPYR-VHQFAIAPATRELLHERIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 RQMLESGFETEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL    +  W+
Sbjct: 279 AKRQMTWLRGWEEVCWL 295


>gi|255067650|ref|ZP_05319505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria sicca
           ATCC 29256]
 gi|255048124|gb|EET43588.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria sicca
           ATCC 29256]
          Length = 313

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 117/188 (62%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +YF ALT  L+ +PE   A+R +++E+ +QYG   L+  L ++D   A ++
Sbjct: 95  LPLIVGGTMMYFHALTEGLNDLPEADAAVRARLQEEKQQYGLVHLYQSLQTIDPETAGRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +   + +  +   PL+     +I   R+ L E I RRFT
Sbjct: 155 KPNDSQRIERALEVYRLTGKPLSAHFAEKADYTPPLDLCTTALIPENRALLHENIARRFT 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           QMLE G IDE+R+L +    L+ D+P M+ +G R     L+G  +YD  +++GI AT + 
Sbjct: 215 QMLEQGFIDEMRALRQKYPELTADMPAMRCVGYRQAWDYLEGLTDYDTFVEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|123440759|ref|YP_001004751.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|166217001|sp|A1JIR4|MIAA_YERE8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|122087720|emb|CAL10505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 313

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 121/197 (61%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAAELGWEALHQQLAEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYQ-VHQFAIAPVSRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWGSVQWL 295


>gi|183600312|ref|ZP_02961805.1| hypothetical protein PROSTU_03874 [Providencia stuartii ATCC 25827]
 gi|188020102|gb|EDU58142.1| hypothetical protein PROSTU_03874 [Providencia stuartii ATCC 25827]
          Length = 313

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 120/196 (61%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A R +I +  +Q G   +H  L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPATRAEIEKIAQQQGWGEIHRRLAEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SGQ++ E   Q     +P       I   +R  L +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVYLISGQTLTEM-TQTAGEELPYNVFQFAIAPQDRKILHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML++G  +E+R+L  + +L +DLP ++ +G R + + L+GE +YDE + RGI AT + A
Sbjct: 220 QMLDAGFEEEVRALYERGDLHVDLPSIRCVGYRQMWSYLEGETDYDEMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQITWLRSWENVHWL 295


>gi|261342832|ref|ZP_05970690.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cancerogenus ATCC 35316]
 gi|288314874|gb|EFC53812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cancerogenus ATCC 35316]
          Length = 316

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 119/188 (63%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R KI ++  + G  +LH +L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRAKIEQQAAEQGWDVLHKQLAQVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML S    E+R+L  + +L  D+P ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASDFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|85373931|ref|YP_457993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erythrobacter
           litoralis HTCC2594]
 gi|122544590|sp|Q2NAU5|MIAA_ERYLH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84787014|gb|ABC63196.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           litoralis HTCC2594]
          Length = 317

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 116/202 (57%), Gaps = 6/202 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGTGLY R L   ++ +P I  AIRE IR   +      L  E    D   ++++
Sbjct: 108 VPILVGGTGLYLRTLLEGIAPIPPIDAAIREAIRALPQDEARAALERE----DPDASKRL 163

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKERIRRRF 132
            P+D  R ARALE+   +G+++   W+Q     I    A H +I+LP+R  L  R  RRF
Sbjct: 164 APADAARTARALEVVRSTGRTLSN-WQQHKKGGIGDRVALHPLIMLPDRKWLYARCDRRF 222

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML+ GA  E+ +L+  +L   LP+M+AIGVR+I A LKGEI+  + +  G  AT  YA
Sbjct: 223 ELMLDRGAASEVETLLARDLDPSLPVMRAIGVREIAAWLKGEIDRPQMIASGQQATRNYA 282

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TW  HQ   DW RI + D
Sbjct: 283 KRQYTWFRHQPPPDWPRIETFD 304


>gi|319407473|emb|CBI81123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella sp.
           1-1C]
          Length = 291

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 120/192 (62%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P+IP   ++K R +L++ G   L+ +L  +D+ ++++I  
Sbjct: 95  IFVGGTGLYFRALLEGISEIPDIPDVCQQKWRHRLQEEGVENLYRQLLQVDAELSKRICA 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R  L E I +R  +M
Sbjct: 155 QDGQRIIRALEVYDVTGKTLSWWQKQETKSLIAKDCSEKILLIPPRQQLYENINKRLDRM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+  + ++ LS  LP MKAIG+ + IA L G ++++  ++     T +YAKRQ
Sbjct: 215 VEQGVLEEVLIIKQLMLSPLLPAMKAIGLPEFIAYLDGYLSFENAIETAKTKTRRYAKRQ 274

Query: 196 KTWLCHQFQADW 207
            TW  +Q   +W
Sbjct: 275 MTWFRNQLNEEW 286


>gi|311281277|ref|YP_003943508.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae SCF1]
 gi|308750472|gb|ADO50224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae SCF1]
          Length = 316

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I  +  + G + LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPDVRARIEREAAERGWNALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  D+P ++ +G R + + L+GEI+YDE + RGI AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|306815614|ref|ZP_07449763.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli NC101]
 gi|305851276|gb|EFM51731.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli NC101]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSVRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|170681902|ref|YP_001746566.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SMS-3-5]
 gi|218551441|ref|YP_002385233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           fergusonii ATCC 35469]
 gi|218702868|ref|YP_002410497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IAI39]
 gi|218707782|ref|YP_002415301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UMN026]
 gi|291285583|ref|YP_003502401.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. CB9615]
 gi|293402798|ref|ZP_06646895.1| miaA [Escherichia coli FVEC1412]
 gi|293407898|ref|ZP_06651738.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B354]
 gi|293417674|ref|ZP_06660296.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B185]
 gi|298378328|ref|ZP_06988212.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli FVEC1302]
 gi|300899709|ref|ZP_07117935.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 198-1]
 gi|300940658|ref|ZP_07155219.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 21-1]
 gi|331655999|ref|ZP_08356987.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M718]
 gi|331671321|ref|ZP_08372119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA280]
 gi|331681190|ref|ZP_08381827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H299]
 gi|226704725|sp|B7NTM7|MIAA_ECO7I RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704727|sp|B7NGA5|MIAA_ECOLU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704728|sp|B1LQJ1|MIAA_ECOSM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704729|sp|B7LLV3|MIAA_ESCF3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|170519620|gb|ACB17798.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SMS-3-5]
 gi|209750294|gb|ACI73454.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|218358983|emb|CAQ91643.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia fergusonii ATCC 35469]
 gi|218372854|emb|CAR20734.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli IAI39]
 gi|218434879|emb|CAR15817.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli UMN026]
 gi|284924353|emb|CBG37469.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli 042]
 gi|290765456|gb|ADD59417.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. CB9615]
 gi|291429713|gb|EFF02727.1| miaA [Escherichia coli FVEC1412]
 gi|291430392|gb|EFF03390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B185]
 gi|291472149|gb|EFF14631.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B354]
 gi|298280662|gb|EFI22163.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli FVEC1302]
 gi|300356720|gb|EFJ72590.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 198-1]
 gi|300454546|gb|EFK18039.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 21-1]
 gi|320660519|gb|EFX27980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|323189950|gb|EFZ75228.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli RN587/1]
 gi|323975488|gb|EGB70589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TW10509]
 gi|325499707|gb|EGC97566.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia fergusonii ECD227]
 gi|331046353|gb|EGI18443.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M718]
 gi|331071166|gb|EGI42523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA280]
 gi|331081411|gb|EGI52572.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H299]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|26251063|ref|NP_757103.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli CFT073]
 gi|191174522|ref|ZP_03036020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli F11]
 gi|218692505|ref|YP_002400717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ED1a]
 gi|227886786|ref|ZP_04004591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 83972]
 gi|300987264|ref|ZP_07178093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 45-1]
 gi|300988652|ref|ZP_07178792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 200-1]
 gi|301045957|ref|ZP_07193141.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 185-1]
 gi|331660746|ref|ZP_08361678.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA206]
 gi|33301389|sp|Q8CXV3|MIAA_ECOL6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977374|sp|B7MSY4|MIAA_ECO81 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|26111495|gb|AAN83677.1|AE016771_188 tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli CFT073]
 gi|190905202|gb|EDV64843.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli F11]
 gi|218430069|emb|CAR11059.2| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli ED1a]
 gi|227836359|gb|EEJ46825.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 83972]
 gi|300302040|gb|EFJ58425.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 185-1]
 gi|300305885|gb|EFJ60405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 200-1]
 gi|300407741|gb|EFJ91279.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 45-1]
 gi|307556338|gb|ADN49113.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli ABU 83972]
 gi|315293547|gb|EFU52899.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 153-1]
 gi|315299052|gb|EFU58306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 16-3]
 gi|324013813|gb|EGB83032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 60-1]
 gi|331051788|gb|EGI23827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA206]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|238787538|ref|ZP_04631336.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           frederiksenii ATCC 33641]
 gi|238724325|gb|EEQ15967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           frederiksenii ATCC 33641]
          Length = 298

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +RE+I ++  + G   LH +L+ +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLDGLSPLPSADPQVRERIEQQAAELGWEALHQQLAEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+ L+SG+++ E  K +          H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFLISGKTLTELTKISGETLA--YRVHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  D+P ++ +G R + + L GEI+Y+E + RGI AT + 
Sbjct: 204 HQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYNEMVYRGICATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQMTWLRGWGSVQWL 280


>gi|222035941|emb|CAP78686.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli LF82]
 gi|312948820|gb|ADR29647.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O83:H1 str. NRG 857C]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|145300255|ref|YP_001143096.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|239977182|sp|A4SR26|MIAA_AERS4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|142853027|gb|ABO91348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 310

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 121/197 (61%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    AIR ++ E+  + G   LHDEL  +D +   +I
Sbjct: 98  IPLLVGGTMLYFKALLEGLSPLPSADPAIRAELEEEAARLGWQALHDELVRIDPVAGARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P    H+  I P +R+ L +RI +RF
Sbjct: 158 HPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYR-VHQFAIAPSDRALLHKRIEQRF 215

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +ML+SG   E+R+L  + +L+  LP ++ +G R +   L GE+ YDE   RGI+AT + 
Sbjct: 216 DKMLQSGFEQEVRALYERGDLTPHLPAIRCVGYRQMWDYLAGEVEYDEMRYRGIVATRQL 275

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL    +  W+
Sbjct: 276 AKRQMTWLRGWPEVTWL 292


>gi|157963355|ref|YP_001503389.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           pealeana ATCC 700345]
 gi|239977454|sp|A8H8G7|MIAA_SHEPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157848355|gb|ABV88854.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           pealeana ATCC 700345]
          Length = 296

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 110/186 (59%), Gaps = 2/186 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIRE+I  + +  G   LHD+L  +D + A +IH
Sbjct: 87  PLLVGGTMMYFKALLEGLSPLPGADEAIREQIAAEAEAQGWQALHDQLREIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ARALE+  VSGQ++ E  K   + F P +     I   +R  L   I  RF  
Sbjct: 147 PNDPQRLARALEVYRVSGQTLTELTKTKSDVF-PYDVVQFAIAPSDRKVLHRAIETRFKA 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G   E+  L  + +L+LDLP M+ +G R     L GEI+YD  +++ I+AT + AK
Sbjct: 206 MLAQGFTSEVERLKARTDLNLDLPSMRCVGYRQCWQYLDGEIDYDTMVEKAIVATRQLAK 265

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 266 RQLTWL 271


>gi|87122646|ref|ZP_01078523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MED121]
 gi|86162104|gb|EAQ63392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MED121]
          Length = 296

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 117/186 (62%), Gaps = 1/186 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF AL   L+ MP+    +R+ I ++  ++G   LH EL  LD   A++IH
Sbjct: 87  PLLVGGTMMYFNALIKGLAKMPQANPEVRKDIEKEAAEFGWSHLHQELERLDPESAKRIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ RA+E+  +SG+S+ + W +        + A   ++  ERS L +RI++RF  
Sbjct: 147 PNDPQRLQRAIEVCRLSGRSMTDLWAEQQQSAGDYQFASIAVMPEERSVLHDRIQQRFDI 206

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           M+E G + E+ +L  + +L++D+P ++ +G R I A L GE + DE + RG++AT + AK
Sbjct: 207 MMEQGFLAEVEALYARGDLNVDMPSVRCVGYRQIWAYLAGECDLDEAIYRGVVATRQLAK 266

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 267 RQVTWL 272


>gi|238750070|ref|ZP_04611573.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia rohdei
           ATCC 43380]
 gi|238711614|gb|EEQ03829.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia rohdei
           ATCC 43380]
          Length = 298

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +L+ +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLDGLSPLPSADAQVRQRIEQQAAELGWEALHQQLAEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+ L+SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFLISGKTLTELTKIS-GETLPYR-VHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLAAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQMTWLRGWGSVQWL 280


>gi|152973041|ref|YP_001338187.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206577864|ref|YP_002240874.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae 342]
 gi|238892655|ref|YP_002917389.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262045397|ref|ZP_06018421.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288937530|ref|YP_003441589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           variicola At-22]
 gi|290512269|ref|ZP_06551636.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella sp.
           1_1_55]
 gi|330003343|ref|ZP_08304586.1| tRNA dimethylallyltransferase [Klebsiella sp. MS 92-3]
 gi|166198914|sp|A6TH86|MIAA_KLEP7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700799|sp|B5Y333|MIAA_KLEP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150957890|gb|ABR79920.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206566922|gb|ACI08698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae 342]
 gi|238544971|dbj|BAH61322.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037315|gb|EEW38562.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288892239|gb|ADC60557.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           variicola At-22]
 gi|289775264|gb|EFD83265.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella sp.
           1_1_55]
 gi|328537005|gb|EGF63295.1| tRNA dimethylallyltransferase [Klebsiella sp. MS 92-3]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G + LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWNALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  D+P ++ +G R + + L GEI YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLNGEIPYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|320655012|gb|EFX22973.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
          Length = 316

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|91213720|ref|YP_543706.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UTI89]
 gi|117626518|ref|YP_859841.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli APEC O1]
 gi|218561330|ref|YP_002394243.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli S88]
 gi|237703838|ref|ZP_04534319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           3_2_53FAA]
 gi|331650296|ref|ZP_08351368.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M605]
 gi|122421472|sp|Q1R389|MIAA_ECOUT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166198906|sp|A1AJ77|MIAA_ECOK1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704724|sp|B7MKX5|MIAA_ECO45 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91075294|gb|ABE10175.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli UTI89]
 gi|115515642|gb|ABJ03717.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli APEC O1]
 gi|218368099|emb|CAR05906.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli S88]
 gi|226901750|gb|EEH88009.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           3_2_53FAA]
 gi|281181267|dbj|BAI57597.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli SE15]
 gi|294492868|gb|ADE91624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IHE3034]
 gi|307629242|gb|ADN73546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UM146]
 gi|315288452|gb|EFU47850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 110-3]
 gi|323950760|gb|EGB46638.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H252]
 gi|323955458|gb|EGB51222.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H263]
 gi|331040690|gb|EGI12848.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M605]
          Length = 316

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|83312605|ref|YP_422869.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magneticum AMB-1]
 gi|123541025|sp|Q2W1G5|MIAA_MAGSA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|82947446|dbj|BAE52310.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magneticum AMB-1]
          Length = 315

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 111/197 (56%), Gaps = 1/197 (0%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++   LPI+ GGTGLY +A+   LS +PEIP +IR + R  L + G+   H+ L+  D +
Sbjct: 92  WQAGMLPILTGGTGLYLKAVMEGLSPIPEIPESIRAEARTLLAEMGNAAFHNRLAKHDPL 151

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           +A ++   + QR+ARA E+   +G+S+ E W+  P           +++ PER  L  + 
Sbjct: 152 MAERLDSGNSQRLARAWEVVTATGRSLAE-WQDEPREGAVEARWFSLVLDPERPRLYAQC 210

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF  M+ +GA+DE+R    + L  DLPI KA+G R++ A L GE + D  +     AT
Sbjct: 211 ESRFRAMVTAGALDEVRDFEALRLPPDLPIQKALGRRELAAHLAGETDLDTAIAAACQAT 270

Query: 189 NKYAKRQKTWLCHQFQA 205
             YAKRQ TW  HQ  A
Sbjct: 271 RNYAKRQGTWFRHQMMA 287


>gi|301023431|ref|ZP_07187214.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 69-1]
 gi|331665835|ref|ZP_08366729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA143]
 gi|300397018|gb|EFJ80556.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 69-1]
 gi|331056886|gb|EGI28880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA143]
          Length = 316

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|16131993|ref|NP_418592.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74314656|ref|YP_313075.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sonnei
           Ss046]
 gi|82546588|ref|YP_410535.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           Sb227]
 gi|89110891|ref|AP_004671.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|157157755|ref|YP_001465669.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E24377A]
 gi|157163634|ref|YP_001460952.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli HS]
 gi|170021819|ref|YP_001726773.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ATCC 8739]
 gi|170083617|ref|YP_001732937.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188495253|ref|ZP_03002523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 53638]
 gi|193066035|ref|ZP_03047093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E22]
 gi|193070867|ref|ZP_03051799.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E110019]
 gi|194434582|ref|ZP_03066839.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1012]
 gi|194439532|ref|ZP_03071606.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 101-1]
 gi|209921659|ref|YP_002295743.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SE11]
 gi|218556723|ref|YP_002389637.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IAI1]
 gi|218697920|ref|YP_002405587.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 55989]
 gi|238903278|ref|YP_002929074.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli BW2952]
 gi|253775204|ref|YP_003038035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037185|ref|ZP_04871262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           1_1_43]
 gi|254164100|ref|YP_003047208.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B str. REL606]
 gi|256019816|ref|ZP_05433681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sp.
           D9]
 gi|256025106|ref|ZP_05438971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           4_1_40B]
 gi|260847001|ref|YP_003224779.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|293476482|ref|ZP_06664890.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B088]
 gi|297517573|ref|ZP_06935959.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli OP50]
 gi|300816529|ref|ZP_07096750.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 107-1]
 gi|300821262|ref|ZP_07101410.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 119-7]
 gi|300906000|ref|ZP_07123724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 84-1]
 gi|300920805|ref|ZP_07137206.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 115-1]
 gi|300922423|ref|ZP_07138543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 182-1]
 gi|300929278|ref|ZP_07144754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 187-1]
 gi|300949130|ref|ZP_07163172.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 116-1]
 gi|300957830|ref|ZP_07170008.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 175-1]
 gi|301027993|ref|ZP_07191277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 196-1]
 gi|301302587|ref|ZP_07208717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 124-1]
 gi|301325934|ref|ZP_07219355.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 78-1]
 gi|301646616|ref|ZP_07246482.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 146-1]
 gi|307140865|ref|ZP_07500221.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|307314881|ref|ZP_07594473.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli W]
 gi|309796982|ref|ZP_07691382.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 145-7]
 gi|312965844|ref|ZP_07780070.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 2362-75]
 gi|331644918|ref|ZP_08346035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|331671076|ref|ZP_08371909.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA271]
 gi|331680301|ref|ZP_08380960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H591]
 gi|127087|sp|P16384|MIAA_ECOLI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123557917|sp|Q31TA1|MIAA_SHIBS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123615505|sp|Q3YUH2|MIAA_SHISS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011774|sp|A7ZV40|MIAA_ECO24 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011775|sp|A8A7R5|MIAA_ECOHS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081952|sp|B1IT35|MIAA_ECOLC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700798|sp|B6I275|MIAA_ECOSE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704726|sp|B7M8T1|MIAA_ECO8A RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229621758|sp|B1XDS2|MIAA_ECODH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977373|sp|B7LC30|MIAA_ECO55 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977571|sp|Q0SXB1|MIAA_SHIF8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|259495765|sp|C4ZR48|MIAA_ECOBW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|221046906|pdb|3FOZ|A Chain A, Structure Of E. Coli Isopentenyl-Trna Transferase In
           Complex With E. Coli Trna(Phe)
 gi|221046907|pdb|3FOZ|B Chain B, Structure Of E. Coli Isopentenyl-Trna Transferase In
           Complex With E. Coli Trna(Phe)
 gi|238537730|pdb|2ZXU|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe) And Dmaspp
 gi|238537731|pdb|2ZXU|B Chain B, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe) And Dmaspp
 gi|146860|gb|AAA24174.1| delta-2-isopentenyl pyrophosphate transferase [Escherichia coli]
 gi|537012|gb|AAA97067.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|1790613|gb|AAC77128.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|2506034|dbj|BAA22627.1| tRNA delta 2-isopentenylpyrophosphate transferase [Shigella
           flexneri]
 gi|73858133|gb|AAZ90840.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella sonnei Ss046]
 gi|81247999|gb|ABB68707.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella boydii Sb227]
 gi|85676922|dbj|BAE78172.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K12 substr. W3110]
 gi|157069314|gb|ABV08569.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli HS]
 gi|157079785|gb|ABV19493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E24377A]
 gi|169756747|gb|ACA79446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ATCC 8739]
 gi|169891452|gb|ACB05159.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188490452|gb|EDU65555.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 53638]
 gi|192926358|gb|EDV80994.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E22]
 gi|192955813|gb|EDV86284.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E110019]
 gi|194417167|gb|EDX33279.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1012]
 gi|194421531|gb|EDX37544.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 101-1]
 gi|209914918|dbj|BAG79992.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli SE11]
 gi|218354652|emb|CAV01642.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli 55989]
 gi|218363492|emb|CAR01146.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli IAI1]
 gi|226840291|gb|EEH72293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           1_1_43]
 gi|238860744|gb|ACR62742.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli BW2952]
 gi|242379693|emb|CAQ34517.1| tRNA(i[6]A37) synthase [Escherichia coli BL21(DE3)]
 gi|253326248|gb|ACT30850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253976001|gb|ACT41672.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B str. REL606]
 gi|253980157|gb|ACT45827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli BL21(DE3)]
 gi|257762148|dbj|BAI33645.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|260451002|gb|ACX41424.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli DH1]
 gi|291320935|gb|EFE60377.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B088]
 gi|299878903|gb|EFI87114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 196-1]
 gi|300315461|gb|EFJ65245.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 175-1]
 gi|300402167|gb|EFJ85705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 84-1]
 gi|300412228|gb|EFJ95538.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 115-1]
 gi|300421242|gb|EFK04553.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 182-1]
 gi|300451378|gb|EFK14998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 116-1]
 gi|300462771|gb|EFK26264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 187-1]
 gi|300526151|gb|EFK47220.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 119-7]
 gi|300530759|gb|EFK51821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 107-1]
 gi|300842112|gb|EFK69872.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 124-1]
 gi|300847287|gb|EFK75047.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 78-1]
 gi|301075163|gb|EFK89969.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 146-1]
 gi|306905684|gb|EFN36213.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli W]
 gi|308119395|gb|EFO56657.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 145-7]
 gi|309704676|emb|CBJ04026.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli ETEC H10407]
 gi|312289087|gb|EFR16981.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 2362-75]
 gi|315063485|gb|ADT77812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli W]
 gi|315138725|dbj|BAJ45884.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli DH1]
 gi|315255515|gb|EFU35483.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 85-1]
 gi|320173675|gb|EFW48865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae CDC 74-1112]
 gi|320180684|gb|EFW55611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           ATCC 9905]
 gi|320193551|gb|EFW68188.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli WV_060327]
 gi|323161960|gb|EFZ47832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E128010]
 gi|323166653|gb|EFZ52411.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sonnei
           53G]
 gi|323182277|gb|EFZ67687.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 1357]
 gi|323380436|gb|ADX52704.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli KO11]
 gi|323935401|gb|EGB31745.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E1520]
 gi|323940090|gb|EGB36284.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E482]
 gi|323946019|gb|EGB42056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H120]
 gi|323960320|gb|EGB55960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H489]
 gi|323965557|gb|EGB61011.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M863]
 gi|323970574|gb|EGB65833.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA007]
 gi|324019349|gb|EGB88568.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 117-3]
 gi|324118736|gb|EGC12628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E1167]
 gi|327250111|gb|EGE61830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli STEC_7v]
 gi|331035893|gb|EGI08131.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|331061665|gb|EGI33591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA271]
 gi|331071764|gb|EGI43100.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H591]
 gi|332087193|gb|EGI92327.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           3594-74]
 gi|332103307|gb|EGJ06653.1| tRNA delta-2-isopentenylpyrophosphate transferase [Shigella sp. D9]
          Length = 316

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|320187049|gb|EFW61760.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri CDC 796-83]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|161936198|ref|YP_153226.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|239977572|sp|Q5PL48|MIAA_SALPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977574|sp|B5BKI0|MIAA_SALPK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 121/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+   + D
Sbjct: 279 AKRQMTWLRGWEGGRWLDSENPD 301


>gi|237729104|ref|ZP_04559585.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter sp.
           30_2]
 gi|226908833|gb|EEH94751.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter sp.
           30_2]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWDALHRQLQDIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQVTWL 286


>gi|215489515|ref|YP_002331946.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O127:H6 str. E2348/69]
 gi|239977372|sp|B7UQI0|MIAA_ECO27 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|215267587|emb|CAS12042.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|170766722|ref|ZP_02901175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           albertii TW07627]
 gi|170124160|gb|EDS93091.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           albertii TW07627]
 gi|315617584|gb|EFU98190.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 3431]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQITWL 271


>gi|24115526|ref|NP_710036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 301]
 gi|30065543|ref|NP_839714.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 2457T]
 gi|27734420|sp|P59197|MIAA_SHIFL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24054853|gb|AAN45743.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 2a str. 301]
 gi|30043807|gb|AAP19526.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 2a str. 2457T]
 gi|281603633|gb|ADA76617.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2002017]
 gi|313646354|gb|EFS10816.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 2457T]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|187734140|ref|YP_001882862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           CDC 3083-94]
 gi|238691727|sp|B2TY46|MIAA_SHIB3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|187431132|gb|ACD10406.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           CDC 3083-94]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|330908513|gb|EGH37032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli AA86]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQITWL 271


>gi|194426673|ref|ZP_03059227.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B171]
 gi|194415412|gb|EDX31680.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B171]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|307825899|ref|ZP_07656114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylobacter
           tundripaludum SV96]
 gi|307733018|gb|EFO03880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylobacter
           tundripaludum SV96]
          Length = 317

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 119/202 (58%), Gaps = 1/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGT LYF  L   L+++PE    IR K+ + L+Q G  +LH  L+ +D   A +I
Sbjct: 98  IPILVGGTMLYFNVLNSGLAVLPEADADIRAKLDQDLEQLGKEVLHSRLADIDPESAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ RALE+  +SG+ +  F+  A    IP +    +I   +R+ L + I  RF 
Sbjct: 158 HPNDPQRVQRALEVYEISGKPLTSFFTAAQAQVIPYQKIKLVIAPQDRAILHDLIACRFK 217

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLE G IDE+ +L K  +L+  +P ++A+G R   + L+GE + +   ++ IIAT + A
Sbjct: 218 QMLEQGFIDEVEALYKRGDLTEKMPSIRAVGYRQAWSYLQGEYDLETMTEKAIIATRQLA 277

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL  +  A  ++    D
Sbjct: 278 KRQFTWLRRETDATSLQTGQQD 299


>gi|238795252|ref|ZP_04638835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           intermedia ATCC 29909]
 gi|238725420|gb|EEQ16991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           intermedia ATCC 29909]
          Length = 298

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +L+ +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPPADPQVRQRIEQQAAELGWEALHQQLTEVDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELTKVS-GETLPYR-VHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  DLP ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLDAGFETEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQMTWLRGWSSVQWL 280


>gi|110808089|ref|YP_691609.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 5 str. 8401]
 gi|110617637|gb|ABF06304.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 5 str. 8401]
 gi|320200699|gb|EFW75285.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli EC4100B]
 gi|332083722|gb|EGI88940.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 155-74]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQITWL 271


>gi|197365077|ref|YP_002144714.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|56130408|gb|AAV79914.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197096554|emb|CAR62164.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 121/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+   + D
Sbjct: 264 AKRQMTWLRGWEGGRWLDSENPD 286


>gi|161617630|ref|YP_001591595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161366994|gb|ABX70762.1| hypothetical protein SPAB_05493 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQMTWL 271


>gi|260599481|ref|YP_003212052.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           turicensis z3032]
 gi|260218658|emb|CBA33987.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           turicensis z3032]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I  +  + G   LH +L  +D + A++I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPTVRAEIERQAAEQGWDALHRKLQEIDPVAAQRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLAGEISYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|238910518|ref|ZP_04654355.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|321222674|gb|EFX47746.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
          Length = 301

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQMTWL 271


>gi|168244862|ref|ZP_02669794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|194448990|ref|YP_002048403.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|204927276|ref|ZP_03218478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205355118|ref|YP_002228919.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207859506|ref|YP_002246157.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|226700803|sp|B5R0N8|MIAA_SALEP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700804|sp|B5R9B8|MIAA_SALG2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238690634|sp|B4TFA5|MIAA_SALHS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977573|sp|A9N4Y5|MIAA_SALPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194407294|gb|ACF67513.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|204323941|gb|EDZ09136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205274899|emb|CAR39966.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205336321|gb|EDZ23085.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|206711309|emb|CAR35687.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|326630275|gb|EGE36618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|62182806|ref|YP_219223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|224586200|ref|YP_002639999.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|75505390|sp|Q57GM0|MIAA_SALCH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811019|sp|C0Q6C8|MIAA_SALPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|62130439|gb|AAX68142.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224470728|gb|ACN48558.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322717308|gb|EFZ08879.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|269137709|ref|YP_003294409.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda EIB202]
 gi|267983369|gb|ACY83198.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda EIB202]
 gi|304557763|gb|ADM40427.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda FL6-60]
          Length = 317

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 116/196 (59%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    A+R +I ++ ++ G   LH EL+ +D + A +I
Sbjct: 102 IPLLVGGTMLYYKALLEGLSPLPPADAAVRARIEQQAREQGWEALHRELARIDPVAAARI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  VSG ++ E   +     +P   +   I    R  L +RI  RF 
Sbjct: 162 HPNDPQRLSRALEVFFVSGNTLTEL-TRVSGEALPYAVSQFAIAPSSRELLHQRIALRFQ 220

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLE+G   E R L  + +L  DLP ++ +G R + + L GEI+YDE + RG+ AT + A
Sbjct: 221 QMLEAGFEQEARRLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLA 280

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 281 KRQMTWLRGWESVQWL 296


>gi|156932402|ref|YP_001436318.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           sakazakii ATCC BAA-894]
 gi|166198907|sp|A7MM88|MIAA_ENTS8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|156530656|gb|ABU75482.1| hypothetical protein ESA_00181 [Cronobacter sakazakii ATCC BAA-894]
          Length = 316

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I  +  + G   LH +L  +D + A++I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPTIRAEIERQAAEQGWDALHRKLQDIDPVAAQRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLAGEISYDEMVYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|37528401|ref|NP_931746.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|46576900|sp|Q7MAX8|MIAA_PHOLL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|36787839|emb|CAE16954.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) (Isopentenyl-diphosphate:tRNA
           isopentenyltransferase) (IPTase) (IPPT) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 313

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I ++  + G   LH +L  +D   A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSANPVIRAQIEQQAAEQGWDALHQQLQKIDPAAALRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+ L+SG+++ E         +P    H+  I P +R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFLISGKTLTEL-TTLSGESLPYR-VHQFAIAPAKRELLHQRIEARF 218

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QMLESG  +E+++L  + +L +DLP ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLESGFEEEVKALYARHDLHVDLPSIRCVGYRQMWSYLSGEIDYDEMIYRGICATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|194443718|ref|YP_002043615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|200388466|ref|ZP_03215078.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|226700805|sp|B4T2R6|MIAA_SALNS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194402381|gb|ACF62603.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|199605564|gb|EDZ04109.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
          Length = 316

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|115524199|ref|YP_781110.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisA53]
 gi|122296477|sp|Q07PK4|MIAA_RHOP5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115518146|gb|ABJ06130.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris BisA53]
          Length = 328

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 110/191 (57%), Gaps = 1/191 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI +GG+GLYF+ALT  LS +P I   +RE +RE+L + G   LH EL+  DS  A ++
Sbjct: 107 MPIFIGGSGLYFKALTRGLSAVPPIAPEVREAVRERLARDGVAALHAELARCDSEAAARL 166

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-PLESAHKIIILPERSALKERIRRRF 132
           + +D  R+ARALE+ + +G+    +  +A  P + P E    + + P+R AL  RI  RF
Sbjct: 167 NVADRSRVARALEVIIATGKPQAAWHAEALPPLLPPSEVLAAVFLAPQREALYARIDARF 226

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML  GA+DE+ +L    L   LP MKA GV  +I  L G ++ DE    G   T  YA
Sbjct: 227 ATMLAEGALDEVAALRARQLDPLLPAMKAHGVPALIRHLDGALSLDEAAAIGCADTRHYA 286

Query: 193 KRQKTWLCHQF 203
           KRQ TW  HQ 
Sbjct: 287 KRQFTWFRHQL 297


>gi|16767606|ref|NP_463221.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167995168|ref|ZP_02576258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168231395|ref|ZP_02656453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168239734|ref|ZP_02664792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168263288|ref|ZP_02685261.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464756|ref|ZP_02698659.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194470981|ref|ZP_03076965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737154|ref|YP_002117301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197265179|ref|ZP_03165253.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242420|ref|YP_002218244.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|17865738|sp|P37724|MIAA_SALTY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700802|sp|B5FRM7|MIAA_SALDC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238693675|sp|B4TSF1|MIAA_SALSV RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|16422920|gb|AAL23180.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|194457345|gb|EDX46184.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712656|gb|ACF91877.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195632695|gb|EDX51149.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197243434|gb|EDY26054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197287603|gb|EDY26995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197936936|gb|ACH74269.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205327103|gb|EDZ13867.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334313|gb|EDZ21077.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205347915|gb|EDZ34546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|261249451|emb|CBG27316.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267996691|gb|ACY91576.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301160849|emb|CBW20380.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312915458|dbj|BAJ39432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|322615522|gb|EFY12442.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618582|gb|EFY15471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622005|gb|EFY18855.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627729|gb|EFY24520.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631036|gb|EFY27800.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637745|gb|EFY34446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322642409|gb|EFY39013.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644022|gb|EFY40570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650490|gb|EFY46898.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322653545|gb|EFY49873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659731|gb|EFY55974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322662058|gb|EFY58274.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666193|gb|EFY62371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672613|gb|EFY68724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676043|gb|EFY72114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322680527|gb|EFY76565.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684579|gb|EFY80583.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323132698|gb|ADX20128.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192894|gb|EFZ78120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323197230|gb|EFZ82370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323201653|gb|EFZ86717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323206167|gb|EFZ91129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213176|gb|EFZ97978.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215549|gb|EGA00293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219534|gb|EGA04019.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227837|gb|EGA11991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323229007|gb|EGA13136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236381|gb|EGA20457.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323238714|gb|EGA22766.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323241835|gb|EGA25864.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323248016|gb|EGA31953.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254653|gb|EGA38464.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323258288|gb|EGA41965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323263566|gb|EGA47087.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265838|gb|EGA49334.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270282|gb|EGA53730.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326626049|gb|EGE32394.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 316

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|119946845|ref|YP_944525.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Psychromonas
           ingrahamii 37]
 gi|166216071|sp|A1SZL1|MIAA_PSYIN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|119865449|gb|ABM04926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Psychromonas
           ingrahamii 37]
          Length = 305

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 118/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LY++AL   LS +P     +R +I ++  + G   LHD+L  +D + A +IH
Sbjct: 97  PLLVGGTMLYYKALVDGLSPLPSANPKVRAQIEKEALENGWQALHDKLEQIDPVSAARIH 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            +D QR+ARALE+  +SG+S+ E  K   +P IP       I   E+S L  RI +RF  
Sbjct: 157 VNDPQRLARALEVFRISGKSLTELTKVKSDP-IPYNIKQFAIAPLEKSVLHARIEQRFEL 215

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLESG   E+R L  + +L LDLP M+ +G R +   L+G ++Y+E   RGI+AT + AK
Sbjct: 216 MLESGFEQEVRKLYQRGDLHLDLPSMRCVGYRQMWEYLQGTMDYEEMRFRGIVATRQLAK 275

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL       W+     D+ 
Sbjct: 276 RQMTWLRGWQNVTWLETGHADNF 298


>gi|197248461|ref|YP_002149274.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|226700801|sp|B5F386|MIAA_SALA4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|197212164|gb|ACH49561.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 316

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQKIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|238918367|ref|YP_002931881.1| tRNA delta(2) -isopentenylpyrophosphate transferase, putative
           [Edwardsiella ictaluri 93-146]
 gi|238867935|gb|ACR67646.1| tRNA delta(2) -isopentenylpyrophosphate transferase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 317

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 116/196 (59%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    A+R +I ++  + G  +LH EL+ +D + A +I
Sbjct: 102 IPLLVGGTMLYYKALLEGLSPLPPADDAVRARIEQQASEQGWEVLHRELARIDPVAAARI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  VSG ++ E   +     +P   +   I    R  L +RI  RF 
Sbjct: 162 HPNDPQRLSRALEVFFVSGNTLTEL-TRVSGEALPYAVSQFAIAPSRRELLHQRIALRFQ 220

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLE+G   E R L  + +L  DLP ++ +G R + + L GEI+YDE + RG+ AT + A
Sbjct: 221 QMLEAGFEQEARRLFARDDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQLA 280

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 281 KRQMTWLRGWESVQWL 296


>gi|15804760|ref|NP_290801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 EDL933]
 gi|15834401|ref|NP_313174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. Sakai]
 gi|168751479|ref|ZP_02776501.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4113]
 gi|168754740|ref|ZP_02779747.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4401]
 gi|168760410|ref|ZP_02785417.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4501]
 gi|168766448|ref|ZP_02791455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4486]
 gi|168774118|ref|ZP_02799125.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4196]
 gi|168780601|ref|ZP_02805608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4076]
 gi|168784806|ref|ZP_02809813.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC869]
 gi|168801824|ref|ZP_02826831.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC508]
 gi|195935961|ref|ZP_03081343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4024]
 gi|208806573|ref|ZP_03248910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208812724|ref|ZP_03254053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208819068|ref|ZP_03259388.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209400590|ref|YP_002273713.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4115]
 gi|217326156|ref|ZP_03442240.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14588]
 gi|254796190|ref|YP_003081027.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14359]
 gi|261225291|ref|ZP_05939572.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255457|ref|ZP_05947990.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|21263767|sp|Q8XDN3|MIAA_ECO57 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700797|sp|B5Z2H7|MIAA_ECO5E RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|12519156|gb|AAG59367.1|AE005650_6 delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364624|dbj|BAB38570.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|187770326|gb|EDU34170.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4196]
 gi|188014483|gb|EDU52605.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4113]
 gi|189001749|gb|EDU70735.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4076]
 gi|189357893|gb|EDU76312.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4401]
 gi|189364314|gb|EDU82733.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4486]
 gi|189368991|gb|EDU87407.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4501]
 gi|189374757|gb|EDU93173.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC869]
 gi|189376077|gb|EDU94493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC508]
 gi|208726374|gb|EDZ75975.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208734001|gb|EDZ82688.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208739191|gb|EDZ86873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209161990|gb|ACI39423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4115]
 gi|209750288|gb|ACI73451.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750290|gb|ACI73452.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750292|gb|ACI73453.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750296|gb|ACI73455.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|217322377|gb|EEC30801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14588]
 gi|254595590|gb|ACT74951.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|320638929|gb|EFX08575.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. G5101]
 gi|320644298|gb|EFX13363.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H- str. 493-89]
 gi|320649616|gb|EFX18140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H- str. H 2687]
 gi|320665788|gb|EFX32825.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. LSU-61]
          Length = 316

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLGGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|297717900|gb|ADI50093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Odyssella thessalonicensis L13]
          Length = 286

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 125/191 (65%), Gaps = 5/191 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGTGLY R+LT  +S +PEIP++IRE+ R +L Q  S   H+ + + D +V  ++
Sbjct: 92  VPILVGGTGLYLRSLTSGISPIPEIPSSIREEAR-RLAQAPS--FHEIVFAFDPMVRGKL 148

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             +D QR++RA E+K+ +G+SIIE W+Q  +  +P E   KI ++P RS L  RI  RF 
Sbjct: 149 KENDRQRLSRAWEVKMATGRSIIE-WQQEKSQALPYE-FQKIALVPARSWLHNRINARFD 206

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M+  GA++E+++L    L  D P+++A+GV+++   L G+   ++ ++   IAT +YAK
Sbjct: 207 LMMSQGALEEVQALKARPLRPDSPLLRAVGVKELSDYLNGQTTLEQAIELAKIATRQYAK 266

Query: 194 RQKTWLCHQFQ 204
           RQ TWL  Q Q
Sbjct: 267 RQLTWLRGQAQ 277


>gi|320190697|gb|EFW65347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC1212]
 gi|326345497|gb|EGD69240.1| tRNA delta-2-isopentenylpyrophosphate transferase [Escherichia coli
           O157:H7 str. 1125]
 gi|326346646|gb|EGD70380.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. 1044]
          Length = 301

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLGGEISYDEMVYRGVCATRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQITWL 271


>gi|238784775|ref|ZP_04628777.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           bercovieri ATCC 43970]
 gi|238714288|gb|EEQ06298.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           bercovieri ATCC 43970]
          Length = 298

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I E+  + G   LH +L+ +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPQIRQRIEEQAAELGWEALHQQLADIDPVSAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELTKIS-GESLPYR-VHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QMLE+G   E R+L  + +L  DLP ++ +G R + + L GEI+Y+E + RG+ AT + 
Sbjct: 204 HQMLEAGFEAEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNEMVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQITWLRGWSSVQWL 280


>gi|324005234|gb|EGB74453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 57-2]
          Length = 316

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAVEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|260858324|ref|YP_003232215.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260870921|ref|YP_003237323.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O111:H- str. 11128]
 gi|257756973|dbj|BAI28475.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257767277|dbj|BAI38772.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O111:H- str. 11128]
 gi|323156012|gb|EFZ42174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli EPECa14]
 gi|323176071|gb|EFZ61663.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 1180]
          Length = 316

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAVEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|110644528|ref|YP_672258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 536]
 gi|123048576|sp|Q0T9M2|MIAA_ECOL5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110346120|gb|ABG72357.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 536]
          Length = 316

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/188 (40%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLPEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|191165623|ref|ZP_03027463.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B7A]
 gi|190904318|gb|EDV64027.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B7A]
          Length = 316

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P +     I    R  L +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVYQFAIAPASRELLHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+ AT + A
Sbjct: 220 QMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQITWL 286


>gi|87200274|ref|YP_497531.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|123488962|sp|Q2G626|MIAA_NOVAD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|87135955|gb|ABD26697.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 281

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 125/210 (59%), Gaps = 9/210 (4%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +++  LPI+VGGTGLY R L   ++ +PEI   +RE++R    +      + EL   D  
Sbjct: 67  HQRGALPILVGGTGLYIRTLLDGIAPVPEIDPQVREEVRAMPLEAA----YAELEKSDPE 122

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKER 127
            AR++ P+D QRI RALE+   +G+ +  +W+Q  +  I  + A   +I+LPER  L  R
Sbjct: 123 RARKLAPADAQRITRALEVMRSTGRPLA-YWQQQLSGGIGNDVALAPLILLPERQWLYRR 181

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
              RF  M + GA++E+ +L+  +L   LP+M+AIGV +I A L+G+++ D  +  G  A
Sbjct: 182 CDLRFELMWDGGALEEVEALLARDLPDSLPVMRAIGVPEIAAFLRGDLSRDAAIASGQQA 241

Query: 188 TNKYAKRQKTWLCHQFQADWIRI---SSID 214
           T  YAKRQ TWL HQ   DW R+   +SID
Sbjct: 242 TRNYAKRQYTWLRHQNPGDWPRMEYDNSID 271


>gi|168822513|ref|ZP_02834513.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205341059|gb|EDZ27823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|320088787|emb|CBY98545.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 316

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 116/188 (61%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI YDE + RG+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEIPYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|213052282|ref|ZP_03345160.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213428673|ref|ZP_03361423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213648968|ref|ZP_03379021.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
          Length = 301

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ +T + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCSTRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQMTWL 271


>gi|29144658|ref|NP_808000.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|29140297|gb|AAO71860.1| tRNA delta-2-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 316

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ +T + 
Sbjct: 219 HQMLASGFEAEVRALFAREDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCSTRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|16763179|ref|NP_458796.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|213852838|ref|ZP_03382370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|21263773|sp|Q8Z186|MIAA_SALTI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|25324133|pir||AH1048 tRNA isopentenyltransferase (EC 2.5.1.8) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16505487|emb|CAD06837.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhi]
          Length = 316

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ +T + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCSTRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|317493568|ref|ZP_07951989.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918511|gb|EFV39849.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 316

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IRE+I ++ ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPAANPQIREQIEKQAQELGWDALHRQLQQVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+ L+SG+++ E  K +    +P  + H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFLISGKTLTELTKIS-GETLPY-NVHQFAIAPATREQLHQRIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QM+ SG   E R L  + +L  DLP ++ +G R + +  +GEI+YDE + RGI AT + 
Sbjct: 219 EQMMASGFEAEARKLFERGDLHTDLPSVRCVGYRQMWSYFEGEIDYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWESVQWL 295


>gi|332083168|gb|EGI88399.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           5216-82]
          Length = 301

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE + RG+  T + 
Sbjct: 204 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCTTRQL 263

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 264 AKRQITWL 271


>gi|238797609|ref|ZP_04641106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           mollaretii ATCC 43969]
 gi|238718606|gb|EEQ10425.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           mollaretii ATCC 43969]
          Length = 298

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I E+  + G   LH +L+ +D + A +I
Sbjct: 86  IPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEEQAAEQGWEALHQQLADIDPVSAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYR-VHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  DLP ++ +G R + + L GEI+Y+E + RG+ AT + 
Sbjct: 204 HQMLAAGFEAEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNEMVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQMTWLRGWSSVQWL 280


>gi|117618481|ref|YP_855466.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|239977181|sp|A0KGS0|MIAA_AERHH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117559888|gb|ABK36836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 305

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 114/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR  I E+  + G   LHDEL  +D +   +I
Sbjct: 93  IPLLVGGTMLYFKALLEGLSPLPSADPVIRAGIEEEAARLGWQALHDELVRIDPVAGARI 152

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L +RI  RF 
Sbjct: 153 HPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYRVLQFAIAPSDRAVLHQRIELRFD 211

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +ML+ G   E+R+L  + +L+ DLP ++ +G R +   L GE+ YDE   RGI+AT + A
Sbjct: 212 KMLQGGFEQEVRALYQRGDLTPDLPSIRCVGYRQMWDYLAGEVEYDEMRYRGIVATRQLA 271

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 272 KRQMTWLRGWSDVTWL 287


>gi|238897716|ref|YP_002923395.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465473|gb|ACQ67247.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 313

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 122/187 (65%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR+ I+ +  +YG+  L+++LS +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLQGLSPLPSSDPNIRQDIQNQALKYGNTFLYEQLSVIDPVAAERI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H +D QR+ RALE+  +SG+++ E  K +    +P +     +I   R+ L  RI RRF 
Sbjct: 161 HFNDIQRVIRALEVFFISGKTLTELTKIS-GSRLPYKVYPFGLIPSSRAQLHHRIERRFQ 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ +G ++E+ SL ++ +LS DLP ++A+G R + + L GEI+Y+E + RG+ AT + A
Sbjct: 220 KMISAGFLEEVSSLFIRDDLSADLPSIRAVGYRQMWSYLSGEIDYNEMIYRGVCATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQMTWL 286


>gi|167625541|ref|YP_001675835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           halifaxensis HAW-EB4]
 gi|189081960|sp|B0TU65|MIAA_SHEHH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167355563|gb|ABZ78176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           halifaxensis HAW-EB4]
          Length = 308

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 115/203 (56%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P     +R +I  + +++G   LHD+L  +D + A +IH
Sbjct: 99  PLLVGGTMMYFKALLEGLSPLPAADEVVRAQIACEAQEFGWQALHDQLREIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ARALE+  +SGQS+ E  K     F P E+    I   +R  L   I  RF  
Sbjct: 159 PNDPQRLARALEVYRISGQSLTELTKTKSEAF-PYEAVQFAIAPSDRKVLHRAIETRFKT 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G   E+  L  + +L LDLP M+ +G R     L GEI+Y+  +++ I+AT + AK
Sbjct: 218 MLTLGFTAEVERLKARGDLDLDLPSMRCVGYRQCWQYLDGEIDYETMVEKAIVATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL       W+   + D+L
Sbjct: 278 RQLTWLRGWPDLIWLESGAEDNL 300


>gi|157368677|ref|YP_001476666.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Serratia
           proteamaculans 568]
 gi|167011780|sp|A8G8U8|MIAA_SERP5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157320441|gb|ABV39538.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Serratia
           proteamaculans 568]
          Length = 313

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+RE+I ++  + G  +LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPPADPAVRERIEQQAAEQGWDVLHRQLQEIDPVAALRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  + +RI  R+
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GESLPYH-VHQFAIAPTSRELIHQRIELRY 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L  + +L  DLP ++ +G R + + L GEI+YDE + RGI AT + 
Sbjct: 219 HQMLAAGFETEARALFARGDLHTDLPSIRCVGYRQMWSYLSGEISYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWDSVHWL 295


>gi|311695391|gb|ADP98264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine
           bacterium HP15]
          Length = 397

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 122/224 (54%), Gaps = 29/224 (12%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   +S +P     +R  + ++ ++ G   LH+EL + D + A +I
Sbjct: 95  IPLLVGGTMMYFKALLHGMSGLPSASPDVRRALEQEAEERGWEALHEELRASDPVAAERI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK---------------------------QAP-NP 105
           HP++ QR+ RALE+  ++G+ I EFW+                           QA    
Sbjct: 155 HPNNRQRLMRALEVLRLTGKPISEFWRADQGACEQTTAVAQVGDIEDYTYFTRWQADETS 214

Query: 106 FIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGV 164
            +P       +  PER  L ERIR RF +MLESG +DE+R+LM + +L  DLP M+ +G 
Sbjct: 215 LLPYTVIQLAMTPPERRVLHERIRLRFLKMLESGFVDEVRALMIRDDLHPDLPSMRCVGY 274

Query: 165 RDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWI 208
           R   + L GE +Y+  + +G+ AT + AKRQ TWL      DW+
Sbjct: 275 RQAWSYLSGEDDYETFVSKGVAATRQLAKRQLTWLRKWSDVDWL 318


>gi|300721487|ref|YP_003710762.1| delta(2)-isopentenylpyrophosphate tRNA -adenosine transferase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297627979|emb|CBJ88528.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus nematophila ATCC 19061]
          Length = 313

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 120/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I ++ ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSANPEIRAQIEQQAEERGWDALHQQLQEIDPVAAVRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR+ RALE+  +SG+++ E  + A    +P    H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLTRALEVFRISGKTLTELTETA-GEILPYH-VHQFAIAPASREVLHQRIAARF 218

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QM++SG  DE+++L  + +L  DLP ++ +G R + + L GEI++DE + RGI AT + 
Sbjct: 219 EQMIKSGFEDEVKALYARRDLHTDLPSIRCVGYRQMWSYLAGEISHDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQITWLRSWDNVTWL 295


>gi|226887623|pdb|2ZM5|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe)
 gi|226887624|pdb|2ZM5|B Chain B, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe)
          Length = 316

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 116/188 (61%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTXLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            Q L SG   E+R+L  + +L  DLP ++ +G R   + L+GEI+YDE + RG+ AT + 
Sbjct: 219 HQXLASGFEAEVRALFARGDLHTDLPSIRCVGYRQXWSYLEGEISYDEXVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|118590851|ref|ZP_01548251.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Stappia
           aggregata IAM 12614]
 gi|118436373|gb|EAV43014.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Stappia
           aggregata IAM 12614]
          Length = 317

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/200 (40%), Positives = 118/200 (59%), Gaps = 7/200 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL-SSLDSIVARQ 72
           +PI+VGGTGLYF+ LT   + MP+IP  IR + R      G   L   L S  D   A  
Sbjct: 107 MPILVGGTGLYFKGLTEGFAEMPDIPQEIRNQARAIADTDGVEGLRQRLMSGGDPASAET 166

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAP--NPFIPLESAHKIIILPERSALKERIRR 130
           +  +D QR+ARALE+ L +G+ + + W+Q    +P +  ++ H+ ++ P R  L ERI +
Sbjct: 167 L--ADPQRLARALEVLLATGRPL-KVWQQEAHSSPLLAPQACHRFVLAPPRPWLHERIEQ 223

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           R   M+    + E+R L+   LS  LP M+AIGV ++ A L GE +Y ET+ R  +AT +
Sbjct: 224 RAGLMVSEEGLREVRDLLAKGLSDKLPAMRAIGVPELGAYLAGEADYAETIHRLTVATRQ 283

Query: 191 YAKRQKTWLCHQFQADWIRI 210
           YAKRQ+TW  +Q  ADW R+
Sbjct: 284 YAKRQETWFRNQM-ADWQRV 302


>gi|254420984|ref|ZP_05034708.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevundimonas
           sp. BAL3]
 gi|196187161|gb|EDX82137.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevundimonas
           sp. BAL3]
          Length = 290

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 109/195 (55%), Gaps = 2/195 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLYF ALT  L+ +P +P ++R+ +       G       L+ +D+  AR I  
Sbjct: 98  ILVGGTGLYFTALTRGLADIPPVPQSVRDAVEADYMAQGEAAFRARLAEIDAEAARSIEQ 157

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RA+ +   SG+++ + WK    P +   S    +I P+R+ L     RR   M
Sbjct: 158 GDRQRLVRAMSVHSASGRALSD-WKADTRPLLTPGSWRGRVIEPDRADLYANCDRRVDVM 216

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E+G +DE+R+L   NLS  LP MKA+GVR++ A L GE+  DE +     AT  YAKRQ
Sbjct: 217 MENGVLDEVRALTARNLSPTLPAMKAVGVRELAAYLAGEVGRDEAIDALKQATRNYAKRQ 276

Query: 196 KTWLCHQFQADWIRI 210
            TW  +Q    W R+
Sbjct: 277 LTWFRNQTPG-WARV 290


>gi|238764691|ref|ZP_04625635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           kristensenii ATCC 33638]
 gi|238697087|gb|EEP89860.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           kristensenii ATCC 33638]
          Length = 298

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++    G   LH +L+ +D I A +I
Sbjct: 86  IPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAALLGWEALHQQLAEIDPIAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYR-VHQFAIAPVSRELLHQRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  D+P ++ +G R + + L GEI+YD+ + RGI AT + 
Sbjct: 204 RQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDDMVYRGICATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQMTWLRGWSSVQWL 280


>gi|237809129|ref|YP_002893569.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tolumonas
           auensis DSM 9187]
 gi|259495773|sp|C4L9N0|MIAA_TOLAT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|237501390|gb|ACQ93983.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tolumonas
           auensis DSM 9187]
          Length = 310

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR+ I  +    G   LH +L S+D + A +I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAADPLIRQAIEAEASLSGWEALHAQLQSIDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SGQ++ E   Q     +P  +    I   +R  L++RI  RF 
Sbjct: 158 HPNDPQRLSRALEVYRISGQTLTEL-TQTKGEQLPYRTLQFAIAPTDRELLRQRIAERFH 216

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML  G   E+R+L  + +L+ DLP ++ +G R +   L G+I+YDE + RGI+AT + A
Sbjct: 217 LMLSQGFEQEVRALYDRGDLNADLPSIRCVGYRQMWEYLDGQISYDEMVYRGIVATCQLA 276

Query: 193 KRQKTWLCHQFQADWIRISSIDD 215
           KRQ TWL       W+   +I++
Sbjct: 277 KRQMTWLRSWQNVTWLETGAINN 299


>gi|310765332|gb|ADP10282.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia sp.
           Ejp617]
          Length = 316

 Score =  141 bits (356), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    A+R++I +  ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQLCDIDPVAAHRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K + +  +P   +   I    R  + +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELIKTSGDA-LPYNVSQFAIAPASRELIHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GEI+YD+ + RGI AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 280 KRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|326387417|ref|ZP_08209026.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208073|gb|EGD58881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 326

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 110/201 (54%), Gaps = 4/201 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P I  AIR+ +R          L  E    D   A ++
Sbjct: 117 LPILVGGTGLYIRTLLDGIAPIPAIDPAIRDAVRAMPVAQAWEALQGE----DPERAARL 172

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D  RIARALE+   +G+ +  +  +             ++++PER+ L  R  RRF 
Sbjct: 173 APADSTRIARALEVVRSTGRPLAAWQAEREGGIGDSVDLSSVVLMPERTWLYARCDRRFA 232

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M   GAI+E+R+L+   L  DLP+M+AIGVR+I A L GE + +  +  G  AT  YAK
Sbjct: 233 AMWSDGAIEEVRALLARRLEPDLPVMRAIGVREIAAFLAGETSAESAIASGQQATRNYAK 292

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TWL HQ    W R+S  D
Sbjct: 293 RQYTWLRHQMPESWPRLSHED 313


>gi|53804021|ref|YP_114134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylococcus
           capsulatus str. Bath]
 gi|61213992|sp|Q607R4|MIAA_METCA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53757782|gb|AAU92073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylococcus
           capsulatus str. Bath]
          Length = 312

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 120/200 (60%), Gaps = 1/200 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++ GGT LYF AL   L+ +P     +R +I  +  + G H LH EL+ +D   A +I
Sbjct: 98  LPVLAGGTMLYFNALLRGLAELPSADPDLRREIETRAARDGWHALHAELARIDPPAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ RALE+  ++G+++ +  + + +P +P      ++    R+ L ERI  RF 
Sbjct: 158 HPNDPQRLQRALEVFYLTGRTLSDLCEGSRSPELPFRPLRIVLAPSSRAVLAERIAERFR 217

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +MLE G ++E+ +L +  +L+  LP ++A+G R     L+G+  +D  ++R IIAT ++A
Sbjct: 218 RMLEEGFLEEVEALYRRGDLNETLPSIRAVGYRQAWGYLQGDYGFDTFVERAIIATRQFA 277

Query: 193 KRQKTWLCHQFQADWIRISS 212
           KRQ TWL  + +A W+   +
Sbjct: 278 KRQCTWLRKETEATWLETGT 297


>gi|23015778|ref|ZP_00055545.1| COG0324: tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 317

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 110/193 (56%), Gaps = 1/193 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLY +A+   LS +P+IP +IR + R  L + G+   H+ L+  D ++A ++
Sbjct: 99  LPILTGGTGLYLKAVMEGLSPIPDIPESIRAEARALLAEMGNAAFHNRLAKHDPLMAERL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
              + QR+ARA E+ + +G+S+ E W+  P           +++ P R  L  +   RF 
Sbjct: 159 DSGNSQRLARAWEVIMATGRSLAE-WQDEPRQGAVAARWFTMVLDPPRPRLYAQCESRFR 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M+ +GA+DE+R+   + L+ DLPI KA+G R++ A L GE   D  +     AT  YAK
Sbjct: 218 AMVAAGALDEVRAFEALGLAHDLPIQKALGRRELAAHLAGETGLDAAIADACQATRNYAK 277

Query: 194 RQKTWLCHQFQAD 206
           RQ TW  HQ  A 
Sbjct: 278 RQGTWFRHQMMAS 290


>gi|268592881|ref|ZP_06127102.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rettgeri DSM 1131]
 gi|291311671|gb|EFE52124.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rettgeri DSM 1131]
          Length = 313

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 118/196 (60%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    A+R +I    K+ G   +H  L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADQAVRTEIEHIAKEQGWGEIHRRLTEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+ L+SGQ++ E  + A    +P       I   +R  L ERI +RF 
Sbjct: 161 HPNDPQRLSRALEVYLISGQTLTEMIQTA-GEELPYNVFQFAIAPQDRKILHERIEQRFH 219

Query: 134 QMLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            M+++G  +E+R L + N L +DLP ++ +G R + + L GEI +DE + RGI AT + A
Sbjct: 220 LMIDAGFEEEVRKLHQRNDLHVDLPSIRCVGYRQMWSYLDGEIGHDEMIYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQITWLRSWENVHWL 295


>gi|309787675|ref|ZP_07682286.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1617]
 gi|308924425|gb|EFP69921.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1617]
          Length = 316

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE +  G+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYLGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|42520660|ref|NP_966575.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|99034955|ref|ZP_01314760.1| hypothetical protein Wendoof_01000416 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|81700072|sp|Q73GV7|MIAA_WOLPM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|42410400|gb|AAS14509.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 297

 Score =  141 bits (355), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 114/191 (59%), Gaps = 4/191 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PII GG+GLY  +    LS MP+I   +R+ + E  K       +  + S DS V  +I
Sbjct: 92  IPIITGGSGLYISSFIKGLSSMPQISQEVRKNVSELRKNLSKEEFYKLVLSKDSKVQDKI 151

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALKERIRRRF 132
             +D  R++RALE+   +G++I   W++   P  PL    KI  ILP+R  + ++I  RF
Sbjct: 152 CINDSHRLSRALEVITETGKTIF-VWQENRQP--PLFDNFKIYTILPKREDVYQKINSRF 208

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            +M+E+GAIDE++ L+ MNL+ +LP MKA GV +I+  LKGEI  DE +Q     T  YA
Sbjct: 209 IKMIENGAIDEVKKLLSMNLAPNLPAMKAHGVPEIVKYLKGEITLDEAIQIAQTNTRHYA 268

Query: 193 KRQKTWLCHQF 203
           KRQ TW  +QF
Sbjct: 269 KRQYTWFKNQF 279


>gi|91794554|ref|YP_564205.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           denitrificans OS217]
 gi|123356467|sp|Q12J94|MIAA_SHEDO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91716556|gb|ABE56482.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           denitrificans OS217]
          Length = 299

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 118/208 (56%), Gaps = 2/208 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+   P++VGGT +YF+AL   LS +P     IR++I+ +    G   LH  L  +D + 
Sbjct: 85  KRGKTPLLVGGTMMYFKALLEGLSPLPSADETIRQQIQTRADIEGWEALHQSLCEIDPVA 144

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
             +IHP+D QR++RALE+  +SG+++ E   Q  +  +P E     I   +R  L E I 
Sbjct: 145 GARIHPNDPQRLSRALEVYYISGKTMTEL-TQTKSAALPYEVVQFAIAPLDRKVLHELIA 203

Query: 130 RRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RFT MLE G ++E+ SLM + +L LDLP M+ +G R     L+GE +YD  +++   AT
Sbjct: 204 KRFTIMLEQGFVEEVNSLMARGDLHLDLPSMRCVGYRQCWQYLEGEFDYDTMVEKATAAT 263

Query: 189 NKYAKRQKTWLCHQFQADWIRISSIDDL 216
            + AKRQ TWL       W+   +  +L
Sbjct: 264 RQLAKRQLTWLRGWPDVHWLESGAESNL 291


>gi|217974861|ref|YP_002359612.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS223]
 gi|239977451|sp|B8ECA4|MIAA_SHEB2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|217499996|gb|ACK48189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS223]
          Length = 308

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 99  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLREIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P E     I   ER  L + I +RF  
Sbjct: 159 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYEVVQFAIAPRERKVLHDLIAQRFAI 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 218 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 278 RQLTWLRSWPELNWLESGAEGNL 300


>gi|82779447|ref|YP_405796.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae Sd197]
 gi|123560946|sp|Q328F0|MIAA_SHIDS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|81243595|gb|ABB64305.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella dysenteriae Sd197]
          Length = 316

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 117/188 (62%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI +RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIEQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E+R+L  + +L  DLP ++ +G R + + L+GEI+YDE +  G+ AT + 
Sbjct: 219 HQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYLGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQITWL 286


>gi|312173799|emb|CBX82053.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora ATCC BAA-2158]
          Length = 316

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 120/205 (58%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R++I +  ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAREAGWQALHRQLCDIDPVAAHRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P + +   I    R  + +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELIKTS-GQALPYDVSQFAIAPASRELIHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GEINYD+ + RG+ AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTEMPSVRCVGYRQMWSYLSGEINYDDMVYRGVCATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 280 KRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|292489621|ref|YP_003532511.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora CFBP1430]
 gi|292898159|ref|YP_003537528.1| tRNA delta-2-isopentenylpyrophosphate transferase [Erwinia
           amylovora ATCC 49946]
 gi|291198007|emb|CBJ45109.1| tRNA delta-2-isopentenylpyrophosphate transferase [Erwinia
           amylovora ATCC 49946]
 gi|291555058|emb|CBA23143.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora CFBP1430]
          Length = 316

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 120/205 (58%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R++I +  ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAREAGWQALHRQLCDIDPVAAHRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P + +   I    R  + +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELIKTS-GQALPYDVSQFAIAPASRELIHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GEINYD+ + RG+ AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTEMPSVRCVGYRQMWSYLSGEINYDDMVYRGVCATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 280 KRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|242237986|ref|YP_002986167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech703]
 gi|242130043|gb|ACS84345.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech703]
          Length = 313

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 116/204 (56%), Gaps = 4/204 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I E+ K  G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSANPDIRREIEERAKTEGWEALHRQLQEIDPVAATRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP+D QR++RALE+  VSG ++ E  K + +  +P    H+  I P  R  L ERI  RF
Sbjct: 161 HPNDPQRLSRALEVFFVSGNTLTELTKTSGDA-LPYH-VHQFAIAPATRELLHERIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R L  + +L   LP ++ +G R + + L GEI YDE + RGI AT + 
Sbjct: 219 RQMLAAGFETEARVLFARADLHPALPSIRCVGYRQMWSYLSGEIGYDEMVYRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWIRISSIDD 215
           AKRQ TWL       W+   S  D
Sbjct: 279 AKRQMTWLRGWEGVCWLDSDSPSD 302


>gi|197334540|ref|YP_002157120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           MJ11]
 gi|226700807|sp|B5FBR5|MIAA_VIBFM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|197316030|gb|ACH65477.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           MJ11]
          Length = 310

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I ++ +Q+G   +HD+L S+D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAEQFGWEAMHDQLKSIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P E  H+  I P ER+ +  RI  RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQIKGDALPYE-VHQFAIAPKERAEIHRRIELRF 214

Query: 133 TQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M+E G   E R+L +  +L  DLP ++ +G R +     GE   DE + RGI AT + 
Sbjct: 215 ANMMEEGFEAEARALYERDDLHADLPSIRCVGYRQMWDYFDGEGTLDEAVFRGICATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL    +  W+    ID
Sbjct: 275 AKRQITWLRSWKELTWLDSDDID 297


>gi|170728496|ref|YP_001762522.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           woodyi ATCC 51908]
 gi|239977458|sp|B1KHU9|MIAA_SHEWM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169813843|gb|ACA88427.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           woodyi ATCC 51908]
          Length = 296

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P     IR++I+ +   YG + LHDEL  +D + A +IH
Sbjct: 87  PLLVGGTMMYFKALLEGLSPLPAADDEIRKQIQIEADTYGWNHLHDELKQIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+S+ E  K    P +P +     I   +R  L   I  RF  
Sbjct: 147 PNDPQRLSRAIEVYRISGKSLTELTKIKSEP-LPYDVVQFAISPKDRKQLHLSIEERFKL 205

Query: 135 MLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G ++E+RSL  +  L +DLP M+ +G R     L G+ +YD  +++ ++AT + AK
Sbjct: 206 MLNQGFVEEVRSLRERSELHIDLPSMRCVGYRQCWQYLNGDYDYDTMVEKAVVATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   S  +L
Sbjct: 266 RQLTWLRGWPELNWLESGSDSNL 288


>gi|117919049|ref|YP_868241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           ANA-3]
 gi|239977456|sp|A0KSR6|MIAA_SHESA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117611381|gb|ABK46835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           ANA-3]
          Length = 296

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 118/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +    G   LH++L  +D + A +IH
Sbjct: 87  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADANGWEALHEQLREIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+S+ E  +    P +P +     I   ER  L E I +RF  
Sbjct: 147 PNDPQRLSRAIEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHELIGQRFRI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE G IDE+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 206 MLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 266 RQLTWLRSWPELNWLESGAEGNL 288


>gi|296532850|ref|ZP_06895519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseomonas
           cervicalis ATCC 49957]
 gi|296266806|gb|EFH12762.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseomonas
           cervicalis ATCC 49957]
          Length = 331

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 7/198 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTG+YFR L   ++ +P IP A RE+ R  L   G   LH  L+ +D   A ++
Sbjct: 96  LPILCGGTGMYFRVLIDGIAEIPPIPEAAREQARGLLAAEGPAALHARLAEIDPATAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----QAPNPFIPLESAHKIIILPERSALKERI 128
            PSD QR+ARA E+ L +G+ +   W+     +  N   P   A  +++ P R AL+  I
Sbjct: 156 RPSDSQRLARAYEVWLGTGRGL-SAWQSDGAGEGANGPAPWRFA-ALLLDPPREALRSAI 213

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RRR+  M+ +GA++E+R+L+   L   LP M+A GV ++ A+L+G +   +  +R  +  
Sbjct: 214 RRRWDGMIAAGAVEEVRALLARGLDPALPAMRAHGVPELAAMLEGRMTLAQAGERACLNI 273

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +Y KRQ TW  HQ  AD
Sbjct: 274 GQYTKRQATWFRHQRMAD 291


>gi|162145863|ref|YP_001600321.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|189081954|sp|A9GZI5|MIAA_GLUDA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|161784437|emb|CAP53964.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 332

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 107/189 (56%), Gaps = 3/189 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+ GGTG+Y RALT  L+ +P+     R + R  +   G   LHD L+++D   A  +H
Sbjct: 102 PILCGGTGMYLRALTDGLTDIPDPGPEARAEARRLVDAEGPAALHDRLAAVDPESAAALH 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRFT 133
           P+D QR+ARA E+   +G  +  + + A  P  PL      + L P R  L+  I  RF 
Sbjct: 162 PADSQRVARAWEVWSGTGHGMAHWRRTATLP--PLACRRVAVRLDPPRDTLRAAIAVRFA 219

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M++ GA+DE+R+L+   L   LP M+A GV ++ A L+G++  DE   R ++AT +Y +
Sbjct: 220 AMVQGGALDEVRALLAQGLPPALPAMRAHGVPELAAHLRGDLTLDEATHRAVLATGRYTR 279

Query: 194 RQKTWLCHQ 202
           RQ TW  H 
Sbjct: 280 RQSTWFAHH 288


>gi|294634452|ref|ZP_06712988.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda ATCC 23685]
 gi|291092162|gb|EFE24723.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda ATCC 23685]
          Length = 317

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 115/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I ++ ++ G   LH EL+ +D + A +I
Sbjct: 102 IPLLVGGTMLYYKALLEGLSPLPPADAGVRARIEQQAREQGWQALHHELARIDPVAAARI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  VSG ++ E  + +    +P   +   I    R  L +RI  RF 
Sbjct: 162 HPNDPQRLSRALEVFFVSGNTLTELTRIS-GEALPYSVSQFAIAPSSRELLHQRIALRFQ 220

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML +G   E R L  + +L  DLP ++ +G R + + L GEI+YDE + RGI AT + A
Sbjct: 221 QMLAAGFEQEARKLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEMVYRGICATRQLA 280

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 281 KRQMTWLRGWESVQWL 296


>gi|283476985|emb|CAY72877.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia pyrifoliae DSM 12163]
          Length = 301

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+++GGT LY++AL   LS +P    A+R++I +  ++ G   LH +L  +D + A +I
Sbjct: 86  IPLLIGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQLCDIDPVAAHRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P + +   I    R  + +RI +RF 
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELIKTS-GKALPYDVSQFAIAPASRELIHKRIEQRFH 204

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GEI+YD+ + RGI AT + A
Sbjct: 205 QMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDMVYRGICATRQLA 264

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 265 KRQMTWLRGWKDVQWLDSEQPDAAY 289


>gi|209543927|ref|YP_002276156.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531604|gb|ACI51541.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 332

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/189 (37%), Positives = 107/189 (56%), Gaps = 3/189 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+ GGTG+Y RALT  L+ +P+     R + R  +   G   LHD L+++D   A  +H
Sbjct: 102 PILCGGTGMYLRALTDGLTDIPDPGPEARAEARRLVDAEGPAALHDRLAAVDPESAAALH 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRFT 133
           P+D QR+ARA E+   +G  +  + + A  P  PL      + L P R  L+  I  RF 
Sbjct: 162 PADSQRVARAWEVWSGTGHGMAHWRRTATLP--PLACRRVAVRLDPPRDTLRAAIAVRFA 219

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M++ GA+DE+R+L+   L   LP M+A GV ++ A L+G++  DE   R ++AT +Y +
Sbjct: 220 AMVQGGALDEVRALLAQGLPPALPAMRAHGVPELAAHLRGDLTLDEATHRAVLATGRYTR 279

Query: 194 RQKTWLCHQ 202
           RQ TW  H 
Sbjct: 280 RQSTWFAHH 288


>gi|77456750|ref|YP_346255.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf0-1]
 gi|123606177|sp|Q3KIZ0|MIAA_PSEPF RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|77380753|gb|ABA72266.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf0-1]
          Length = 323

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 123/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LHD+L+++D   A +I
Sbjct: 96  IPLLVGGTMLYYKALIEGLADMPAADPEVRAQIEEEAARLGWQALHDQLAAIDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPF---------IPLESAHKIIILPERSA 123
           HP+D QR++RALE+  VSGQS+ E   KQ+             +P   A+  I    R  
Sbjct: 156 HPNDPQRLSRALEVYRVSGQSMTELRLKQSVQSTEAAASGLQQLPYTVANLAIAPTNRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI++RFT MLE G IDE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHERIKQRFTNMLEQGFIDEVVALRNRSDLHAGLPSIRAVGYRQVWDFLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWKDLHWLDSLDCDNL 309


>gi|259907177|ref|YP_002647533.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           pyrifoliae Ep1/96]
 gi|224962799|emb|CAX54256.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           pyrifoliae Ep1/96]
          Length = 316

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+++GGT LY++AL   LS +P    A+R++I +  ++ G   LH +L  +D + A +I
Sbjct: 101 IPLLIGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQLCDIDPVAAHRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P + +   I    R  + +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELIKTS-GKALPYDVSQFAIAPASRELIHKRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GEI+YD+ + RGI AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 280 KRQMTWLRGWKDVQWLDSEQPDAAY 304


>gi|238757518|ref|ZP_04618703.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           aldovae ATCC 35236]
 gi|238704280|gb|EEP96812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           aldovae ATCC 35236]
          Length = 310

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +L+ +D + A +I
Sbjct: 98  IPLLVGGTMLYFKALLEGLSPLPSADLPVRQRIEQQAAEQGWEALHQQLAEIDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L  RI  RF
Sbjct: 158 HPNDPQRLSRALEVFYISGKTLTELTKIS-GETLPYR-VHQFAIAPVSRELLHRRIELRF 215

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R+L  + +L  DLP ++ +G R + + L GEI+Y+E + RG+ AT + 
Sbjct: 216 HQMLDAGFEQEARALFDRGDLHTDLPAVRCVGYRQMWSYLSGEIDYNEMVYRGVCATRQL 275

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 276 AKRQMTWLRGWSSVQWL 292


>gi|288940954|ref|YP_003443194.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Allochromatium
           vinosum DSM 180]
 gi|288896326|gb|ADC62162.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Allochromatium
           vinosum DSM 180]
          Length = 332

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 118/196 (60%), Gaps = 1/196 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYFRAL   L+ +P     +R ++  + ++ G   +H  L+ LD   AR+I
Sbjct: 101 IPLLVGGTMLYFRALQQGLARLPSADAEVRAELEAEAERLGWAAMHARLAELDPDAARRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE++ +SG+++ +  + A +  +P      +    +R+ L  RI  RF 
Sbjct: 161 HPNDPQRIQRALEVQALSGRAMSDLIRDAEHTALPFRLLKLVRAPGDRAILHARIEHRFR 220

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            MLE G +DE+  L  + +L+ DLP M+ +G R ++  L GE  +++ +QRGIIAT + A
Sbjct: 221 VMLELGLVDEVSRLWARGDLTPDLPSMRCVGYRQVLNYLLGESTWEDMVQRGIIATRQLA 280

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL  +    W+
Sbjct: 281 KRQMTWLRAEPDCHWL 296


>gi|109900276|ref|YP_663531.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas atlantica T6c]
 gi|123064076|sp|Q15NR1|MIAA_PSEA6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|109702557|gb|ABG42477.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas atlantica T6c]
          Length = 315

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 120/204 (58%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +Y++ALT  LS +P+    +R +I ++ ++ G   LH EL  +D + A++I
Sbjct: 102 IPLLVGGTMMYYKALTDGLSTLPQADPLVRAEIEKQAEKNGWQALHQELQGIDPVSAQRI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALEI  +SG+S+ E       P  P + +   I   +R  L +RI +RF 
Sbjct: 162 HPNDPQRLSRALEIYRISGKSMTEL-SLNKQPSAPYQFSQFAIAPSDRHILHDRIAQRFD 220

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML SG  DE+  L  + +L LDLP M+ +G R +   L GE  Y E  ++G+ AT + A
Sbjct: 221 IMLNSGFEDEVIELKSRADLHLDLPSMRCVGYRQMWQYLDGENIYQEMREKGLAATRQLA 280

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TWL       W+   S D+L
Sbjct: 281 KRQLTWLRSWQNLHWLDTFSKDNL 304


>gi|261364638|ref|ZP_05977521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa ATCC 25996]
 gi|288567234|gb|EFC88794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa ATCC 25996]
          Length = 313

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 116/188 (61%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +YF ALT  L+ +PE   A+R +++E+  +YG   L+  L ++D   A ++
Sbjct: 95  LPLIVGGTMMYFHALTEGLNDLPEADAAVRAELQEEKNRYGLAHLYQNLQTIDPETAGRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +   + +  +   PL+     +I   R+ L E I RRFT
Sbjct: 155 KPNDSQRIERALEVYRLTGKPLSAHFAEKADYTPPLDLCTTALIPENRALLHENIARRFT 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           QMLE G I+E+R+L +    L+ D+P M+ +G R     L+G  +YD  +++GI AT + 
Sbjct: 215 QMLEQGFINEMRALRQKYPELTADMPSMRCVGYRQAWDYLEGLTDYDTFVEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|113968941|ref|YP_732734.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-4]
 gi|123325388|sp|Q0HMP0|MIAA_SHESM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|113883625|gb|ABI37677.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-4]
          Length = 296

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 117/203 (57%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LH++L  +D + A +IH
Sbjct: 87  PVLVGGTMMYFKALLEGLSPLPSADEAIRADIQAEADANGWEALHEQLREIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+S+ E  +    P +P +     I   ER  L E I +RF  
Sbjct: 147 PNDPQRLSRAIEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHELIGQRFRI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE G IDE+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 206 MLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 266 RQLTWLRSWPELNWLESGAEGNL 288


>gi|239993398|ref|ZP_04713922.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alteromonas
           macleodii ATCC 27126]
          Length = 311

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGT +YF AL   +S +P+    IR++I ++ ++ G   LHDEL  +D I   +I
Sbjct: 100 VPILAGGTMMYFNALINGISPLPKSDEKIRDEITQQAQRLGWSKLHDELRGVDPISGERI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+   +G+++   W+Q      P   A   I   +R+ L ERI  RF 
Sbjct: 160 HPNDPQRITRALEVYRSTGKTLTH-WQQQEGEKCPYNIAQFAIAPADRAVLHERIATRFD 218

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            MLE G  +E+  L  + +L  DLP ++++G R +   L G+++Y E  +RGIIAT + A
Sbjct: 219 LMLEQGFENEVVKLYERSDLHEDLPSIRSVGYRQMWQYLDGQLSYAEMRERGIIATRQLA 278

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TWL    Q  W+   + D+L
Sbjct: 279 KRQLTWLRGWEQVTWLDTFANDNL 302


>gi|291619091|ref|YP_003521833.1| MiaA [Pantoea ananatis LMG 20103]
 gi|291154121|gb|ADD78705.1| MiaA [Pantoea ananatis LMG 20103]
 gi|327395423|dbj|BAK12845.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA [Pantoea
           ananatis AJ13355]
          Length = 316

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R+KI +   + G   LH +L  +D +   +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRQKIEQMANERGWEALHRQLCEIDPVAGSRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P +  H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GEALPYD-VHQFAIAPANRELLHQRIALRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML SG   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RG+ AT + 
Sbjct: 219 DQMLASGFEAESRALFARGDLHTDMPSIRCVGYRQMWSYLAGEIDYDEMVYRGVCATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQMTWL 286


>gi|160876998|ref|YP_001556314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS195]
 gi|239977453|sp|A9L3W0|MIAA_SHEB9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160862520|gb|ABX51054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS195]
          Length = 296

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 87  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLREIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 147 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFAI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 206 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 266 RQLTWLRSWPELNWLESGAEGNL 288


>gi|75676529|ref|YP_318950.1| tRNA isopentenyltransferase [Nitrobacter winogradskyi Nb-255]
 gi|123612989|sp|Q3SQ43|MIAA_NITWN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|74421399|gb|ABA05598.1| tRNA isopentenyltransferase [Nitrobacter winogradskyi Nb-255]
          Length = 314

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 116/193 (60%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           K+ LPI VGG+GLYF+ALT  LS +P IP  +R  +R +L++ G+  LH  L+  DS  A
Sbjct: 101 KKRLPIFVGGSGLYFKALTRGLSAVPPIPPEVRNDVRARLERDGAEALHAVLARCDSETA 160

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
           +++ P D  R+ARALE+   +G+S+ ++ +    P +P E    + + PER AL  RI  
Sbjct: 161 QRLRPRDRSRVARALEVVEATGRSLTDWHRDGLPPLLPAERVRAVFLAPERDALYARIDA 220

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  ML + A++E+ +L +  L   LP MKA GV  +I  L+GEI+ +   + G   T  
Sbjct: 221 RFGAMLAAEALEEVAALAERRLDPLLPAMKAHGVPALIRHLRGEISLERAAEIGRADTRH 280

Query: 191 YAKRQKTWLCHQF 203
           YAKRQ TW  HQ 
Sbjct: 281 YAKRQFTWFRHQL 293


>gi|114773230|ref|ZP_01450465.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium HTCC2255]
 gi|114546349|gb|EAU49258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium HTCC2255]
          Length = 313

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT +YF AL   LS +P     IR  I E+  + G   +H +L+ +D + A++I
Sbjct: 102 LPVLVGGTMMYFNALIKGLSTLPASNACIRADIEEQATEKGWAAMHAQLALIDPLCAQRI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+  +SG+ +     ++  P IP   A   I   ERS L ERI  RF 
Sbjct: 162 HPNDPQRITRALEVYQISGRPMSALQAESSGP-IPYTIAQFAIAPQERSVLHERIELRFQ 220

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLE     E+ +LM + +L  DLP M+ +G R +   L G+++  +  +RG+IAT + A
Sbjct: 221 QMLEQNFEAEVSALMARQDLLEDLPSMRCVGYRQMWQYLSGQMSRSDMFERGVIATRQLA 280

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 281 KRQVTWL 287


>gi|315269201|gb|ADT96054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS678]
          Length = 308

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 99  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLREIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 159 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFAI 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 218 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 278 RQLTWLRSWPELNWLESGAEGNL 300


>gi|59712931|ref|YP_205707.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           ES114]
 gi|75506908|sp|Q5E2C7|MIAA_VIBF1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|59481032|gb|AAW86819.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Vibrio fischeri ES114]
          Length = 310

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 119/203 (58%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I ++ +Q+G   +HD+L ++D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAEQFGWEAMHDQLKTIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P E  H+  I P ER+ +  RI  RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQIKGDALPYE-VHQFAIAPKERAEIHRRIELRF 214

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M+E G   E R+L  + +L  DLP ++ +G R +     GE   DE + RGI AT + 
Sbjct: 215 ANMMEEGFEAEARALYERDDLHADLPSIRCVGYRQMWDYFDGEGTLDEAVFRGICATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL    +  W+    ID
Sbjct: 275 AKRQITWLRSWKELTWLDSDDID 297


>gi|12643932|sp|Q9X5G1|MIAA_ZYMMO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|5834303|gb|AAD53907.1|AF176314_17 IPP-transferase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 312

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 117/204 (57%), Gaps = 8/204 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I   +RE++R    +     L  E    D + A ++
Sbjct: 101 LPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSMSVEEAYSALQQE----DPMAADRL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKERIRRRF 132
            P+D  RI RALE+   +G  +  +W+Q     I  E      +I+P  + L+ R  +RF
Sbjct: 157 RPTDKTRIMRALEVMRSTGHPL-HYWQQKKTGGIANEIKLQSFVIIPPANILRSRCDKRF 215

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+    +++   AT +YA
Sbjct: 216 DQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLTMIEKAKAATRQYA 275

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ+TW  HQ    WI+I   DD+
Sbjct: 276 KRQRTWFRHQTDESWIKI--FDDI 297


>gi|126172806|ref|YP_001048955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS155]
 gi|239977452|sp|A3D023|MIAA_SHEB5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|125996011|gb|ABN60086.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS155]
          Length = 296

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 87  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLRDIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 147 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFAI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 206 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 266 RQLTWLRSWPELNWLESGAEGNL 288


>gi|290473400|ref|YP_003466266.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus bovienii SS-2004]
 gi|289172699|emb|CBJ79470.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus bovienii SS-2004]
          Length = 298

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I ++  ++G   LH +L  +DS+ A +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSSNLEIRAQIEQQAAKHGWEALHRQLQEIDSVAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR+ RALE+  +SG+++     +     +P    H+  I P  R  L +RI  RF
Sbjct: 146 HPNDPQRLTRALEVFRISGKTLTAL-TEMSGEILPYR-VHQFAIAPASREILHQRIAARF 203

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QM++SG  DE+++L  + +L  DLP ++ +G R + + L GEI++DE + RGI AT + 
Sbjct: 204 EQMIKSGFEDEVKALYARSDLHTDLPSIRCVGYRQMWSYLSGEISHDEMVYRGICATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQITWLRGWDNVTWL 280


>gi|239977163|sp|B4S1F8|MIAA_ALTMD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 301

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGT +YF AL   +S +P+    IR++I ++ ++ G   LHDEL S+D +   +I
Sbjct: 90  VPILAGGTMMYFNALINGISPLPKSDEKIRDEITQQAQRLGWSKLHDELRSVDPVSGERI 149

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+   +G+++  +W+Q      P   A   I   +R+ L  RI  RF 
Sbjct: 150 HPNDPQRITRALEVYRNTGKTLT-YWQQQKGEKCPYNIAQFAIAPEDRAVLHNRIATRFD 208

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            MLE G   E+  L  + +L  DLP ++++G R +   L G ++Y E  +RGIIAT + A
Sbjct: 209 MMLEQGFEKEVVKLYERSDLHEDLPSIRSVGYRQMWQYLDGHLSYAEMRERGIIATRQLA 268

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TWL    Q  W+   + D+L
Sbjct: 269 KRQLTWLRGWEQVTWLDTFANDNL 292


>gi|153002274|ref|YP_001367955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS185]
 gi|166216987|sp|A6WSV3|MIAA_SHEB8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151366892|gb|ABS09892.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS185]
          Length = 308

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 99  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLREIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 159 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFAI 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 218 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 278 RQLTWLRSWPELNWLESGAEGNL 300


>gi|241761987|ref|ZP_04760071.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241373453|gb|EER63040.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 283

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 120/207 (57%), Gaps = 14/207 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL---DSIVA 70
           LPI+VGGTGLY R L   ++ +P+I   +RE++R       S  + D  S+L   D + A
Sbjct: 72  LPILVGGTGLYIRTLLEGIAPIPDIAPELREEVR-------SMSVEDAYSALQQEDPMAA 124

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKERIR 129
            ++ P+D  RI RALE+   +G  +  +W+Q     I  E      +I+P  + L+ R  
Sbjct: 125 DRLRPTDKTRIMRALEVMRSTGHPL-HYWQQKKTGGIANEIKLQSFVIIPPANILRSRCD 183

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+    +++   AT 
Sbjct: 184 KRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLTMIEKAKAATR 243

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDL 216
           +YAKRQ+TW  HQ    WI+I   DD+
Sbjct: 244 QYAKRQRTWFRHQTDESWIKI--FDDI 268


>gi|283856409|ref|YP_162873.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|283775409|gb|AAV89762.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 283

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 117/204 (57%), Gaps = 8/204 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I   +RE++R    +     L  E    D + A ++
Sbjct: 72  LPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSMSVEEAYSALQQE----DPMAADRL 127

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKERIRRRF 132
            P+D  RI RALE+   +G  +  +W+Q     I  E      +I+P  + L+ R  +RF
Sbjct: 128 RPTDKTRIMRALEVMRSTGHPL-HYWQQKKTGGIANEIKLQSFVIIPPANILRSRCDKRF 186

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+    +++   AT +YA
Sbjct: 187 DQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLTMIEKAKAATRQYA 246

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ+TW  HQ    WI+I   DD+
Sbjct: 247 KRQRTWFRHQTDESWIKI--FDDI 268


>gi|192358868|ref|YP_001983534.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cellvibrio
           japonicus Ueda107]
 gi|239977196|sp|B3PDC2|MIAA_CELJU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190685033|gb|ACE82711.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cellvibrio
           japonicus Ueda107]
          Length = 338

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 122/198 (61%), Gaps = 7/198 (3%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +++  +P++VGGT LYFRAL   L+ MP   T++R +I     Q+G   +H +L+ +D  
Sbjct: 92  HRQGNIPLLVGGTMLYFRALLDGLAQMPAADTSVRAQIEADAAQFGWPYVHQQLAEVDPD 151

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAH---KIIILP-ERS 122
           VA  IHP+  QR++RALE+  VSG+++ +  +  QA       E  +   +I I P +R+
Sbjct: 152 VAADIHPNHSQRVSRALEVYRVSGKTMTQLRREQQASGDVRAFEDRYCVRQIAISPRDRA 211

Query: 123 ALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
            L +RI +RF  ML  G ++E+R L  + +L  DLP ++A+G R +   L  +++YDE +
Sbjct: 212 ILHQRIEQRFHAMLAQGLVEEVRRLYQRGDLHTDLPAIRAVGYRQVWDYLDDKLHYDEMV 271

Query: 182 QRGIIATNKYAKRQKTWL 199
            RGIIAT + AKRQ TWL
Sbjct: 272 ARGIIATRQLAKRQFTWL 289


>gi|114048921|ref|YP_739471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-7]
 gi|122944369|sp|Q0HR41|MIAA_SHESR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|113890363|gb|ABI44414.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-7]
          Length = 296

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 117/203 (57%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +    G   LH +L  +D + A +IH
Sbjct: 87  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADANGWEALHAQLREIDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+S+ E  +    P +P +     I   ER  L E I +RF  
Sbjct: 147 PNDPQRLSRAIEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHELIGQRFRI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE G IDE+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 206 MLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 265

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 266 RQLTWLRSWPELNWLESGAEGNL 288


>gi|296114129|ref|ZP_06832784.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295979205|gb|EFG85928.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 354

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 115/198 (58%), Gaps = 5/198 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + ++   +P+  GGTG+YFRALT  L+ +P+ P  IR + R  +   G   +H  L ++D
Sbjct: 94  EAWRAGRIPVFCGGTGMYFRALTDGLADIPDPPPEIRAEARAAVLAEGGPAIHARLMAVD 153

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH--KIIILPERSAL 124
              A  + P D QRIARA E+   +G+ +  +W+      +P  SA    + + P R  L
Sbjct: 154 PETASALRPGDTQRIARAWEVWRATGRGL-SWWRT--ESVLPPLSARFVSVRLSPPRDLL 210

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           ++ I  RF  M+E+GA++E+R+L+  +LS  LP M+A GV ++ A+L+GE++  + + R 
Sbjct: 211 RQAIAARFVAMMENGAVEEVRALLSCDLSPTLPAMRAHGVPELAAMLRGEMSRQDAITRA 270

Query: 185 IIATNKYAKRQKTWLCHQ 202
           +  T +Y KRQ TW  H 
Sbjct: 271 VQVTAQYTKRQSTWFAHH 288


>gi|118602748|ref|YP_903963.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gi|239977447|sp|A1AX35|MIAA_RUTMC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|118567687|gb|ABL02492.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
          Length = 305

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 111/187 (59%), Gaps = 3/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGT  YF AL   LS +PE     +EK  + LK  G+  LH +L  +D   A +I
Sbjct: 98  LPILVGGTSFYFHALEYGLSKLPESTPESKEKFNQLLKSKGTIKLHRDLKRIDLQAANRI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+  +SG+++ +   Q     I      KII++PERS L +RI  RF 
Sbjct: 158 HPNDAQRITRALEVFDLSGKTLSKL--QGNKKPIINHPIKKIILMPERSELHQRIEERFL 215

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            M+E G +DE++ L +  NL  +LP ++ +G R     L G+I+  E +++ IIAT K  
Sbjct: 216 SMMEHGFLDEVKHLKQNPNLHENLPAIRCVGYRQAWQYLNGKIDKAEMIEKAIIATRKLC 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQNTWL 282


>gi|260752432|ref|YP_003225325.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258551795|gb|ACV74741.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 312

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 117/204 (57%), Gaps = 8/204 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I   +RE++R    +     L  E    D + A ++
Sbjct: 101 LPILVGGTGLYIRTLLEGIAPIPDIDPELREEVRSMSVEEAYSALQQE----DPMAADRL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKERIRRRF 132
            P+D  RI RALE+   +G  +  +W+Q     I  E      +I+P  + L+ R  +RF
Sbjct: 157 RPADKTRIMRALEVMRSTGHPL-HYWQQKKTGGIANEIKLQSFVIIPPANILRSRCDKRF 215

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+    +++   AT +YA
Sbjct: 216 DQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLTMIEKAKAATRQYA 275

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ+TW  HQ    WI+I   DD+
Sbjct: 276 KRQRTWFRHQTDESWIKI--FDDI 297


>gi|170744236|ref|YP_001772891.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium sp. 4-46]
 gi|239977414|sp|B0UPN1|MIAA_METS4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|168198510|gb|ACA20457.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium sp. 4-46]
          Length = 306

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 111/195 (56%), Gaps = 2/195 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLYF+AL   LS +P +P A+R  +R + +   +  LH +L+  D   A ++
Sbjct: 99  LPIVVGGTGLYFKALLEGLSEIPPVPEAVRTALRAEAEGRETAALHADLARRDPEGAARL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
              D  R+ RALE+   +G+ +  F   + P P   +    K+ ++P+R+ L+ RI  RF
Sbjct: 159 GAHDRLRVLRALEVLAATGRPLSAFQGSRRPGPLAGMPC-DKLFLVPDRALLRARIDARF 217

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E GA+DE+  L    L   LP+M+A GV  +IA L G +  +E + RG   T  YA
Sbjct: 218 LAMMEEGALDEVARLRARRLDPMLPVMRAHGVPGLIAFLDGALTREEAVARGQADTRAYA 277

Query: 193 KRQKTWLCHQFQADW 207
           KRQ TW  HQ  A W
Sbjct: 278 KRQVTWFRHQAGAGW 292


>gi|146294368|ref|YP_001184792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens CN-32]
 gi|239977455|sp|A4YAL0|MIAA_SHEPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145566058|gb|ABP76993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens CN-32]
          Length = 304

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 114/195 (58%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+L  +D + A +IH
Sbjct: 95  PLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADVKGWETLHDQLRDIDPVSAERIH 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 155 PNDPQRLSRALEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFRI 213

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G IDE+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 214 MLQQGFIDEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTMVEKAVAATRQLAK 273

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    + +W+
Sbjct: 274 RQLTWLRSWPELNWL 288


>gi|304410914|ref|ZP_07392531.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS183]
 gi|307304915|ref|ZP_07584665.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica BA175]
 gi|304350811|gb|EFM15212.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS183]
 gi|306912317|gb|EFN42741.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica BA175]
          Length = 308

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D + A +IH
Sbjct: 99  PVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLRVIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 159 PNDPQRLSRALEVYRISGKSMTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFAI 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G ++E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 218 MLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVAATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSIDDL 216
           RQ TWL    + +W+   +  +L
Sbjct: 278 RQLTWLRSWPELNWLESGAEGNL 300


>gi|28198004|ref|NP_778318.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa Temecula1]
 gi|182680630|ref|YP_001828790.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M23]
 gi|32129726|sp|Q87F70|MIAA_XYLFT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238691050|sp|B2I692|MIAA_XYLF2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28056064|gb|AAO27967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa Temecula1]
 gi|182630740|gb|ACB91516.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M23]
          Length = 317

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+I 
Sbjct: 94  RRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWAALHTRLAEVDAIT 153

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +IH +D QRI RALE+ LVSGQS+ ++  Q P   +PL     ++    R  L  RI 
Sbjct: 154 AARIHATDPQRIQRALEVYLVSGQSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFRIA 213

Query: 130 RRFTQMLESGAIDEIR------SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           +RF  ML++G + E+       S+  M   LDLP M+A+G R     L G    +   QR
Sbjct: 214 QRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLYQR 273

Query: 184 GIIATNKYAKRQKTWLCHQFQADWI 208
            + AT + AKRQ TWL  +  A W 
Sbjct: 274 SVAATRQLAKRQLTWLRGELDALWF 298


>gi|307579089|gb|ADN63058.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 305

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+I 
Sbjct: 82  RRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWAALHTRLAEVDAIT 141

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +IH +D QRI RALE+ LVSGQS+ ++  Q P   +PL     ++    R  L  RI 
Sbjct: 142 AARIHATDPQRIQRALEVYLVSGQSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFRIA 201

Query: 130 RRFTQMLESGAIDEIR------SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           +RF  ML++G + E+       S+  M   LDLP M+A+G R     L G    +   QR
Sbjct: 202 QRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLYQR 261

Query: 184 GIIATNKYAKRQKTWLCHQFQADWI 208
            + AT + AKRQ TWL  +  A W 
Sbjct: 262 SVAATRQLAKRQLTWLRGELDALWF 286


>gi|153803478|ref|ZP_01958064.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-3]
 gi|124120979|gb|EAY39722.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-3]
          Length = 315

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIEREAEKLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 276 KRQITWLRSWDDLTWLDSENVD 297


>gi|121997464|ref|YP_001002251.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Halorhodospira
           halophila SL1]
 gi|239977380|sp|A1WUT7|MIAA_HALHL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|121588869|gb|ABM61449.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Halorhodospira
           halophila SL1]
          Length = 310

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 124/205 (60%), Gaps = 5/205 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTGLYF+AL   LS MP     +R ++  +   YG   LH  L ++D   A ++
Sbjct: 94  LPVLVGGTGLYFQALQHGLSPMPAADAQVRAELEAEEAAYGVQALHRRLQAVDPESAARL 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIII-LPERSALKERIRRRF 132
           HP+D QRI RALE+  ++G+ + +  ++   P +  E   KII+  PER+ L  RI  RF
Sbjct: 154 HPNDSQRIQRALEVHRLTGRPLSQVQREPGQPGL-TEMPLKIILEPPERAWLHRRIEARF 212

Query: 133 TQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             ML +G + E+ +L +  +LS +LP ++A+G R I   L+G  +Y   ++RG+ AT +Y
Sbjct: 213 RAMLAAGLVGEVVALHRRGDLSEELPAVRAVGYRQIWHYLEGACDYRTMIRRGLRATRQY 272

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TWL  + Q D +R ++ D L
Sbjct: 273 AKRQITWL--RGQTDGVRFTADDRL 295


>gi|22124543|ref|NP_667966.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           KIM 10]
 gi|45440382|ref|NP_991921.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594776|ref|YP_068967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809902|ref|YP_653818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Antiqua]
 gi|108813459|ref|YP_649226.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Nepal516]
 gi|145600849|ref|YP_001164925.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Pestoides F]
 gi|150260584|ref|ZP_01917312.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CA88-4125]
 gi|153950565|ref|YP_001402608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419131|ref|YP_001605280.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Angola]
 gi|165926687|ref|ZP_02222519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165936572|ref|ZP_02225140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166011861|ref|ZP_02232759.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166214048|ref|ZP_02240083.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167400714|ref|ZP_02306223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419000|ref|ZP_02310753.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423725|ref|ZP_02315478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|170026015|ref|YP_001722520.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186893783|ref|YP_001870895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927575|ref|YP_002345450.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CO92]
 gi|229836632|ref|ZP_04456798.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Pestoides A]
 gi|229840244|ref|ZP_04460403.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842322|ref|ZP_04462477.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229903939|ref|ZP_04519052.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Nepal516]
 gi|294502481|ref|YP_003566543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Z176003]
 gi|21263774|sp|Q8ZIW3|MIAA_YERPE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|61214046|sp|Q66FB6|MIAA_YERPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123072502|sp|Q1C0Z9|MIAA_YERPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123372928|sp|Q1CEF4|MIAA_YERPN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166217002|sp|A4TRP0|MIAA_YERPP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011781|sp|A7FMY0|MIAA_YERP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238687243|sp|A9QYN2|MIAA_YERPG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238688464|sp|B1JMP0|MIAA_YERPY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238691359|sp|B2K203|MIAA_YERPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21957341|gb|AAM84217.1|AE013665_6 delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis KIM 10]
 gi|45435238|gb|AAS60798.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51588058|emb|CAH19664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777107|gb|ABG19626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Nepal516]
 gi|108781815|gb|ABG15873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Antiqua]
 gi|115346186|emb|CAL19054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CO92]
 gi|145212545|gb|ABP41952.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Pestoides F]
 gi|149289992|gb|EDM40069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CA88-4125]
 gi|152962060|gb|ABS49521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351946|gb|ABX85894.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Angola]
 gi|165915688|gb|EDR34297.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165921310|gb|EDR38534.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165989220|gb|EDR41521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166204843|gb|EDR49323.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962994|gb|EDR59015.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050082|gb|EDR61490.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057895|gb|EDR67641.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169752549|gb|ACA70067.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186696809|gb|ACC87438.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679709|gb|EEO75812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Nepal516]
 gi|229690632|gb|EEO82686.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229696610|gb|EEO86657.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706316|gb|EEO92324.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Pestoides A]
 gi|262360511|gb|ACY57232.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           D106004]
 gi|294352940|gb|ADE63281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Z176003]
 gi|320013762|gb|ADV97333.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 313

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 119/197 (60%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +L+ +D + A +I
Sbjct: 101 IPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQLAVIDPVAAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K +    +P    H+  I P  R  L +RI  RF
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GETLPYR-VHQFAIAPASRELLHQRIELRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML++G   E R L  + +L  DLP ++ +G R + + L GEI+Y++ + RG+ AT + 
Sbjct: 219 HQMLDAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDMVYRGVCATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWSSVQWL 295


>gi|308048237|ref|YP_003911803.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ferrimonas
           balearica DSM 9799]
 gi|307630427|gb|ADN74729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ferrimonas
           balearica DSM 9799]
          Length = 315

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR +I ++  + G   LHDEL+ +D   A +I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPSADPKIRAEIEQQAAERGWQALHDELAQIDPESAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++    +Q   P +P  +A   I+  +R  L +RI +RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGETLTTLTQQK-RPPLPFRTAQFAIVPDQRDRLHQRIEKRFL 215

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML+ G   E+R+L  + +L   LP ++ +G R + A L GEI++ E + +G+ AT + A
Sbjct: 216 SMLDQGFEAEVRALYERGDLHPGLPSIRCVGYRQMWAYLDGEISHQEMVAKGVAATRQLA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQITWL 282


>gi|24372193|ref|NP_716235.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           oneidensis MR-1]
 gi|46577042|sp|Q8CX50|MIAA_SHEON RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24346102|gb|AAN53680.1|AE015507_6 tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           oneidensis MR-1]
          Length = 308

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 82/206 (39%), Positives = 120/206 (58%), Gaps = 8/206 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P     IR  I+ +    G   LHD+L  +D + A +IH
Sbjct: 99  PLLVGGTMMYFKALLEGLSPLPSADEVIRADIQAEADANGWEALHDQLREIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEF--WKQAPNPFIPLESAHKIIILP-ERSALKERIRRR 131
           P+D QR++RALE+  +SG+S+ E    K AP P+  ++ A    I P ER  L E I +R
Sbjct: 159 PNDPQRLSRALEVYRISGKSLTELTMTKSAPLPYNVVQFA----IAPRERKVLHELIGQR 214

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  MLE G IDE+  L  + +L LDLP M+ +G R     L GE ++D  +++ I AT +
Sbjct: 215 FRIMLEQGFIDEVAQLKARDDLHLDLPSMRCVGYRQCWQYLDGEFDHDTMVEKAIAATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDL 216
            AKRQ TWL    + +W+   +  +L
Sbjct: 275 LAKRQLTWLRSWPELNWLESGAEGNL 300


>gi|94500523|ref|ZP_01307054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanobacter
           sp. RED65]
 gi|94427313|gb|EAT12292.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanobacter
           sp. RED65]
          Length = 318

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 117/187 (62%), Gaps = 1/187 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+ L    + +P     +R  I E + ++G   +HD L  +D   A+++
Sbjct: 100 IPVLVGGTMLYFKFLMEGSADLPNADEKVRAHIEELVVKHGKQYIHDLLKEVDPESAQRL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QR+ RA E+ L++G+++ + W +  NP    +     I   +R  L ERI  RF 
Sbjct: 160 NPNDPQRVQRAYEVYLITGKTLTQHWAEQENPESEYDWLQFAIAPTDRKDLHERIALRFQ 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QM+E G  +E+R+L  + +L+ DLP ++A+G R +   ++G+I++DE ++RGIIAT + A
Sbjct: 220 QMVEQGFEEEVRALYARGDLNPDLPSIRAVGYRQMWDFIEGKISHDEMIERGIIATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQLTWL 286


>gi|83858874|ref|ZP_00952396.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853697|gb|EAP91549.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 314

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 116/199 (58%), Gaps = 2/199 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLYF+AL   L+  P++P A+  ++     + G   L +   +LD + A +I  
Sbjct: 98  ILVGGTGLYFKALVDGLAPTPDVPEAVISEVNALYARGGLDALREAAHALDPVGAARIEA 157

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ R + +   SG+ + E   +   P I  + A  ++I P+R  L  RI  RF QM
Sbjct: 158 GDRQRLMRLIAVARTSGRPLSEIQAET-RPLIEPDRAVGVVIAPDRDGLYGRIEARFDQM 216

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +  GA++E R++ +  L+ DLP MKA+G+  +IA ++G ++ DE +      T +YAKRQ
Sbjct: 217 VSHGALEEARAIAERRLAADLPAMKAVGLPPLIAHVQGRLDLDEAIALAKRDTRRYAKRQ 276

Query: 196 KTWLCHQFQADWIRISSID 214
            TW  +Q   DW+R++S+D
Sbjct: 277 FTWFSNQ-HPDWVRVNSLD 294


>gi|90581378|ref|ZP_01237174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio angustum
           S14]
 gi|90437488|gb|EAS62683.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio angustum
           S14]
          Length = 312

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 120/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R  I     ++G   LHDEL S+D +   +I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDAAEHGWQALHDELVSIDPVAGARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K      +P +  H+  I P +R+ L +RI  RF
Sbjct: 158 HPNDPQRLSRALEVFRISGKTLTELTKTQ-GESLPYK-VHQFAITPMDRAVLHQRIELRF 215

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +M+E+G   E+R+L  + +L L+LP ++ +G R +   L G  + DE + RGI AT + 
Sbjct: 216 NKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEAVFRGICATRQL 275

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+  S +D
Sbjct: 276 AKRQITWLRGWKDLTWLDSSDVD 298


>gi|300715039|ref|YP_003739842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           billingiae Eb661]
 gi|299060875|emb|CAX57982.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           billingiae Eb661]
          Length = 316

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 115/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R++I ++  + G   LH +L  +D +   +I
Sbjct: 101 IPLLVGGTMLYYKALLEGLSPLPPADPEVRQRIEQQASEQGWDALHRQLCEIDPVAGNRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P +     I    R  + +RI  RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKTS-GEALPYDVTQFAIAPQHREVIHQRIELRFQ 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  DLP ++ +G R + + L GEI+YD+ + RGI AT + A
Sbjct: 220 QMLASGFEAEARALYAREDLHTDLPSIRCVGYRQMWSYLAGEIDYDDMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQITWLRGWKDVHWL 295


>gi|163749346|ref|ZP_02156595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           benthica KT99]
 gi|161331065|gb|EDQ01991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           benthica KT99]
          Length = 296

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 114/195 (58%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS +P     IR +I  + + +G   LHDEL  +D + A +IH
Sbjct: 87  PLLVGGTMLYFKALLEGLSPLPAADEVIRAEIAAEAQTHGWQHLHDELMRVDPVSAERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E   Q  +P +P E     I   +R  L   I  RF  
Sbjct: 147 PNDPQRLSRALEVFRISGKSLTEL-TQIKSPPLPYEVIQFAISPKDRKVLHLSIEERFKL 205

Query: 135 MLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G + E+R+L + N L L LP M+ +G R     L G+ +Y+  + +GIIAT + AK
Sbjct: 206 MLNQGFVAEVRTLRQRNDLHLALPSMRCVGYRQCWQHLDGDYDYNTMVDKGIIATRQLAK 265

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    + +W+
Sbjct: 266 RQLTWLRGWAELNWL 280


>gi|308188270|ref|YP_003932401.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pantoea vagans C9-1]
 gi|308058780|gb|ADO10952.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pantoea vagans C9-1]
          Length = 316

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 114/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I +  ++ G   LH +L  +D +   +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQTAREKGWEALHRQLCEIDPVAGSRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P +     I    R  L +RI  RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKTS-GEALPYDVQQFAIAPASRELLHQRIALRFE 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  D+P ++ +G R + + L GEI+Y E + RGI AT + A
Sbjct: 220 QMLASGFEAESRALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDYSEMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQMTWLRGWENVHWL 295


>gi|157373935|ref|YP_001472535.1| tRNA isopentenyltransferase [Shewanella sediminis HAW-EB3]
 gi|239977122|sp|A8FRD4|MIAA1_SHESH RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|157316309|gb|ABV35407.1| tRNA isopentenyltransferase [Shewanella sediminis HAW-EB3]
          Length = 303

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 118/201 (58%), Gaps = 3/201 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    A+R +I  + +Q G   +HDEL  LD + + +IH
Sbjct: 94  PLLVGGTMMYFKALLEGLSPLPAADEALRAQIILEAEQRGWQDMHDELKRLDPVSSERIH 153

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ RALE+  +SG+S+ E  +    P +P +     I   +R  L   I  RF  
Sbjct: 154 PNDPQRLIRALEVCRISGKSMTELSQIKSEP-LPYDVVQFAISPKDRKVLHISIEERFKL 212

Query: 135 MLESGAIDEIRSLMK-MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G +DE+R+L K  +L+L LP M+ +G R     L GE +YD  +++ I+AT + AK
Sbjct: 213 MLNQGFVDEVRALKKRSDLNLALPSMRCVGYRQCWQYLDGEFDYDTMVEKAIVATRQLAK 272

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TWL    + +W+  S +D
Sbjct: 273 RQLTWLRGWPELNWLE-SGVD 292


>gi|15640373|ref|NP_230000.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121729705|ref|ZP_01682147.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           V52]
 gi|147673758|ref|YP_001218615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|153217191|ref|ZP_01950955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           1587]
 gi|153820448|ref|ZP_01973115.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           NCTC 8457]
 gi|153823680|ref|ZP_01976347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|153830896|ref|ZP_01983563.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           623-39]
 gi|227080558|ref|YP_002809109.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           M66-2]
 gi|254851657|ref|ZP_05241007.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MO10]
 gi|297582274|ref|ZP_06944188.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC385]
 gi|298501246|ref|ZP_07011044.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MAK 757]
 gi|11386938|sp|Q9KV12|MIAA_VIBCH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|172047713|sp|A5F3L6|MIAA_VIBC3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811023|sp|C3LR78|MIAA_VIBCM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|9654762|gb|AAF93519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121628556|gb|EAX61038.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           V52]
 gi|124113774|gb|EAY32594.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           1587]
 gi|126509007|gb|EAZ71601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           NCTC 8457]
 gi|126518797|gb|EAZ76020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|146315641|gb|ABQ20180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|148873630|gb|EDL71765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           623-39]
 gi|227008446|gb|ACP04658.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           M66-2]
 gi|227012202|gb|ACP08412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|254847362|gb|EET25776.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MO10]
 gi|297533493|gb|EFH72340.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC385]
 gi|297540000|gb|EFH76063.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MAK 757]
 gi|327483208|gb|AEA77615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           LMA3894-4]
          Length = 315

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 276 KRQITWLRSWDDLTWLDSENVD 297


>gi|323138999|ref|ZP_08074059.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylocystis
           sp. ATCC 49242]
 gi|322395753|gb|EFX98294.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylocystis
           sp. ATCC 49242]
          Length = 306

 Score =  137 bits (346), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 107/195 (54%), Gaps = 1/195 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+I GGTG+YF+A    LS +P +P  +R ++R          LH EL++ D   A ++ 
Sbjct: 95  PVITGGTGMYFKAALYGLSDIPAVPEEVRARVRTVAAGKTPQELHAELAARDPETAARLR 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QRI RALE+   +G+ +  F      P +   +     + PER +L  RI  RF +
Sbjct: 155 PTDPQRILRALEVLTATGKPLASFQGPRSAPLLDASACPSFFLAPERESLYARIDARFDR 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E GA+DE+ +L    L   LP M+A GV  ++A L G +  +E + RG + T +YAKR
Sbjct: 215 MMEKGALDEVAALRDRRLDPALPAMRAHGVPHLVAFLDGRMKLEEAVMRGKLDTRRYAKR 274

Query: 195 QKTWLCHQFQA-DWI 208
           Q T+  HQ     W+
Sbjct: 275 QFTFARHQLPGFQWL 289


>gi|161501829|ref|NP_760221.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus CMCP6]
 gi|320155086|ref|YP_004187465.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus MO6-24/O]
 gi|31340222|sp|Q8CWK9|MIAA_VIBVU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|319930398|gb|ADV85262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus MO6-24/O]
 gi|319999186|gb|AAO09748.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus CMCP6]
          Length = 315

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAANAEIRQQIEQEALTKGWSVLHDELQEIDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   +     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TETKGESLPFRVKQFAIAPKERAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G   E+R+L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMMEAGFEQEMRALYTRKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDNLTWLDSENIE 297


>gi|229506858|ref|ZP_04396366.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           BX 330286]
 gi|229508662|ref|ZP_04398156.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|229512376|ref|ZP_04401851.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           TMA 21]
 gi|229516044|ref|ZP_04405495.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC9]
 gi|229606372|ref|YP_002877020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MJ-1236]
 gi|229346947|gb|EEO11914.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC9]
 gi|229350591|gb|EEO15536.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           TMA 21]
 gi|229354297|gb|EEO19226.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|229355963|gb|EEO20882.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           BX 330286]
 gi|229369027|gb|ACQ59450.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MJ-1236]
          Length = 384

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+L  +D + A++I
Sbjct: 166 IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQLQQIDPVSAQRI 225

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 226 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 284

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 285 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 344

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 345 KRQITWLRSWDDLTWLDSENVD 366


>gi|121591758|ref|ZP_01678967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           2740-80]
 gi|121546382|gb|EAX56635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           2740-80]
          Length = 284

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+L  +D + A++I
Sbjct: 66  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQLQQIDPVSAQRI 125

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 126 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 184

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 185 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 244

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 245 KRQITWLRSWDDLTWLDSENVD 266


>gi|255747146|ref|ZP_05421089.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholera
           CIRS 101]
 gi|262147190|ref|ZP_06027995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           INDRE 91/1]
 gi|262166928|ref|ZP_06034648.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC27]
 gi|255735195|gb|EET90597.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholera
           CIRS 101]
 gi|262024633|gb|EEY43314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC27]
 gi|262031371|gb|EEY49980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           INDRE 91/1]
          Length = 304

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+L  +D + A++I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQLQQIDPVSAQRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 146 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 205 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 264

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 265 KRQITWLRSWDDLTWLDSENVD 286


>gi|323143739|ref|ZP_08078407.1| tRNA dimethylallyltransferase [Succinatimonas hippei YIT 12066]
 gi|322416452|gb|EFY07118.1| tRNA dimethylallyltransferase [Succinatimonas hippei YIT 12066]
          Length = 313

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 121/191 (63%), Gaps = 9/191 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPII GGT +Y++AL   LS +PE    +R+K+ ++ + YG   +H +L ++D  +  ++
Sbjct: 95  LPIICGGTMMYYKALVEGLSSLPETDPLVRDKVAKQAEIYGWPYMHAKLETIDPPLFAKL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW--KQAPNPFIPLESAHKIIILP--ERSALKERIR 129
            P+D QRI+RALE+  ++G+++  F+  K+   PF    S  + +ILP  +R AL+  IR
Sbjct: 155 APNDKQRISRALEVYEMTGKALSSFYAAKKDACPF----SLCEFVILPDNDRKALRNGIR 210

Query: 130 RRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            RF +ML  G IDE++ L  + +LSLD+P M+++G R +   L G  +YD  +++ +IAT
Sbjct: 211 ARFEKMLNLGLIDEVKKLKDRGDLSLDMPSMRSVGYRQVWEYLDGVYDYDTMIEKAVIAT 270

Query: 189 NKYAKRQKTWL 199
            + AK Q TWL
Sbjct: 271 ARLAKHQMTWL 281


>gi|37681256|ref|NP_935865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus YJ016]
 gi|46576896|sp|Q7M7I8|MIAA_VIBVY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|37200007|dbj|BAC95836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus YJ016]
          Length = 315

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAANAEIRQQIEQEALTKGWSVLHDELQEIDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   +     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TETKGESLPFRVKQFAIAPKERAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G   E+R+L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMMEAGFEQEMRALYTRKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDNLTWLDSENIE 297


>gi|71275935|ref|ZP_00652218.1| tRNA isopentenyltransferase [Xylella fastidiosa Dixon]
 gi|71900021|ref|ZP_00682166.1| tRNA isopentenyltransferase [Xylella fastidiosa Ann-1]
 gi|170729310|ref|YP_001774743.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M12]
 gi|238687896|sp|B0U1E8|MIAA_XYLFM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71163312|gb|EAO13031.1| tRNA isopentenyltransferase [Xylella fastidiosa Dixon]
 gi|71730231|gb|EAO32317.1| tRNA isopentenyltransferase [Xylella fastidiosa Ann-1]
 gi|167964103|gb|ACA11113.1| tRNA isopentenyltransferase [Xylella fastidiosa M12]
          Length = 317

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+I 
Sbjct: 94  RRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWATLHTRLAEVDAIT 153

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +IH +D QRI RALE+ LVSG+S+ ++  Q P   +PL     ++    R  L  RI 
Sbjct: 154 AARIHATDPQRIQRALEVYLVSGRSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFRIA 213

Query: 130 RRFTQMLESGAIDEIR------SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           +RF  ML++G + E+       S+  M   LDLP M+A+G R     L G    +   QR
Sbjct: 214 QRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLYQR 273

Query: 184 GIIATNKYAKRQKTWLCHQFQADWI 208
            + AT + AKRQ TWL  +  A W 
Sbjct: 274 SVAATRQLAKRQLTWLRGELDALWF 298


>gi|127511499|ref|YP_001092696.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           loihica PV-4]
 gi|166216988|sp|A3QAD9|MIAA_SHELP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|126636794|gb|ABO22437.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           loihica PV-4]
          Length = 308

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 115/195 (58%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS +P    AIR +I ++++  G   LHDEL  +D + A +IH
Sbjct: 99  PLLVGGTMLYFKALLEGLSPLPSADEAIRAEIAKEVEAKGWQALHDELRQIDPVSADRIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+S+ E   Q     +P +     I   +R  L   I  RF  
Sbjct: 159 PNDPQRLSRAIEVYRISGKSLTEL-TQVKAEALPYKVVQFGIAPKDRKVLHLAIAERFKL 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G ++E++ L  + +L LDLP M+ +G R +   L GE +YD  +++ I+AT + AK
Sbjct: 218 MLNQGFVEEVQRLKARADLHLDLPSMRCVGYRQVWQYLDGEYDYDTMVEKSIVATRQLAK 277

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL      +W+
Sbjct: 278 RQLTWLRGWADLNWL 292


>gi|270158032|ref|ZP_06186689.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           longbeachae D-4968]
 gi|289163700|ref|YP_003453838.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           longbeachae NSW150]
 gi|269990057|gb|EEZ96311.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           longbeachae D-4968]
 gi|288856873|emb|CBJ10684.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Legionella longbeachae NSW150]
          Length = 314

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 118/193 (61%), Gaps = 10/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF AL   L+I+PE    +RE++  +   +G   LH +L  +D   A+++
Sbjct: 94  IPLLVGGTMMYFNALQKGLAILPEACPVVREQLENEAASHGWGKLHQQLMQIDPDTAKRV 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH---KIIILPE-RSALKERIR 129
           H +D QRI RALE+  +SG+++  F++Q        ++ H     I+ PE R+ L ERI 
Sbjct: 154 HANDAQRIQRALEVYYLSGKTLSAFFEQQKE-----KNVHHFINFILFPERRTWLHERIA 208

Query: 130 RRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RF QML++G ++E+  L  K  LS++LP M+++G R ++  L+   +Y     +GI AT
Sbjct: 209 QRFNQMLQAGLLEEVIQLQQKWPLSINLPSMRSVGYRQVLEYLQNAYDYSTLCDKGIAAT 268

Query: 189 NKYAKRQKTWLCH 201
            + AKRQ TWL H
Sbjct: 269 RQLAKRQLTWLRH 281


>gi|328472282|gb|EGF43152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 10329]
          Length = 310

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEIDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDRAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  DE+++L  + +L  DLP ++ +G R +   L GE   DE + RG+ AT + A
Sbjct: 216 KMMEAGFEDEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSDNIE 297


>gi|197104340|ref|YP_002129717.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Phenylobacterium zucineum HLK1]
 gi|239977431|sp|B4RGS2|MIAA_PHEZH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|196477760|gb|ACG77288.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Phenylobacterium zucineum HLK1]
          Length = 307

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 114/199 (57%), Gaps = 4/199 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGTGLYFRALT  L+ +PE+P  +R K     ++ G       L+ +D   A +I P
Sbjct: 96  VVVGGTGLYFRALTQGLAEIPEVPADVRAKAAADFERMGEAAFRTRLAEVDPAAAARIAP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RA E+   +GQ++ +  ++   P I   SA  + + P R AL  R   R   M
Sbjct: 156 GDRQRLCRAWEVFAATGQALSDL-QRTGAPAIADWSA--VALEPPRPALYARCDARLHAM 212

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +  GA++E+R+L+  NL   LP MKA+GVR+  A L+GE + +  ++     T +YAKRQ
Sbjct: 213 VREGALEEVRALIARNLDPALPAMKAVGVREFAAHLRGETSLEAAVEAAQQETRRYAKRQ 272

Query: 196 KTWLCHQFQADWIRISSID 214
            TW+  Q  A W R+++ D
Sbjct: 273 ITWMRGQM-AGWPRLTADD 290


>gi|89075986|ref|ZP_01162358.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           sp. SKA34]
 gi|89048335|gb|EAR53914.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           sp. SKA34]
          Length = 312

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 120/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R  I     ++G  +LHDEL  +D +   +I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDATEHGLQVLHDELVRIDPVAGARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K      +P +  H+  I P +R+ L +RI  RF
Sbjct: 158 HPNDPQRLSRALEVFRISGKTLTELTKTQ-GESLPYK-VHQFAITPMDRAVLHQRIELRF 215

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +M+E+G   E+R+L  + +L L+LP ++ +G R +   L G  + DE + RGI AT + 
Sbjct: 216 NKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEAVFRGICATRQL 275

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+  S +D
Sbjct: 276 AKRQITWLRGWKDLTWLDSSDVD 298


>gi|170717828|ref|YP_001784889.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 2336]
 gi|189081955|sp|B0UUU6|MIAA_HAES2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|168825957|gb|ACA31328.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 2336]
          Length = 311

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 115/187 (61%), Gaps = 3/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I +K +++G   LH+EL+ +D I A++I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADEKVRLEIEQKAEKFGWATLHNELAKIDPISAQRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++GQS+ E   Q     IP    H   I PER+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYLTGQSLTELTAQKGEE-IPYHIIH-FAIAPERAVLHQRIEQRFH 213

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  +LP ++ +G R +   L+G    DE + RGI AT + A
Sbjct: 214 KMIEQGFQQEVEKLYQRSDLHPNLPSIRCVGYRQMWEYLQGNYGKDEMIFRGICATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 274 KRQLTWL 280


>gi|323496871|ref|ZP_08101903.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           sinaloensis DSM 21326]
 gi|323318057|gb|EGA71036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           sinaloensis DSM 21326]
          Length = 315

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G ++LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWNVLHDQLKEIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGDALPFRVKQFAIAPKERAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +MLE+G  +E+R+L  + +L  DLP ++ +G R +   L G    D+ + +G+ AT + A
Sbjct: 216 KMLEAGFEEEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDAIFKGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSIDD 215
           KRQ TWL       W+   +ID+
Sbjct: 276 KRQITWLRSWDNLTWLDSENIDE 298


>gi|229526910|ref|ZP_04416313.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           bv. albensis VL426]
 gi|229336079|gb|EEO01098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           bv. albensis VL426]
          Length = 384

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+L  +D + A++I
Sbjct: 166 IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQLQQIDPVSAQRI 225

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 226 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 284

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 285 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 344

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 345 KRQITWLRSWDDLTWLDSENVD 366


>gi|254292138|ref|ZP_04962910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           AM-19226]
 gi|150421937|gb|EDN13912.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           AM-19226]
          Length = 315

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 276 KRQITWLRSWDDLTWLDSENVD 297


>gi|153827306|ref|ZP_01979973.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-2]
 gi|149738772|gb|EDM53114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-2]
          Length = 315

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 276 KRQITWLRSWDDLTWLDSENVD 297


>gi|149184820|ref|ZP_01863138.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. SD-21]
 gi|148832140|gb|EDL50573.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. SD-21]
          Length = 317

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 111/196 (56%), Gaps = 4/196 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGTGLY R L   ++ +PEI   IRE++R   +      L  E    D   A ++
Sbjct: 106 VPILCGGTGLYMRTLLEGIAPVPEIDPVIREQVRALSQGEARAALETE----DPEAASRL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D  R  RALE+   +G+++ E+  Q           + +++LPER  L ER  RRF 
Sbjct: 162 APADASRTTRALEVVRSTGRTLKEWQAQKTGGIGSQIDLYPLLLLPEREWLYERCDRRFV 221

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML+ GAI E+ +L+   L   LP+M+AIGV +I +LL+G+++ DE +  G  AT +YAK
Sbjct: 222 LMLDGGAIGEVEALLARQLDPSLPVMRAIGVPEIASLLQGDLSRDECIFAGQRATRQYAK 281

Query: 194 RQKTWLCHQFQADWIR 209
           RQ TW  HQ    W R
Sbjct: 282 RQYTWFRHQPPGSWPR 297


>gi|229526990|ref|ZP_04416386.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           12129(1)]
 gi|229335513|gb|EEO00994.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           12129(1)]
          Length = 315

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 276 KRQITWLRSWDDLTWLDSENVD 297


>gi|149192036|ref|ZP_01870263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio shilonii
           AK1]
 gi|148834137|gb|EDL51147.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio shilonii
           AK1]
          Length = 315

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 121/203 (59%), Gaps = 2/203 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I ++  + G   LH+EL ++D + A +I
Sbjct: 97  IPLLVGGTMLYFKALLQGLSPLPAANPEIRKQIEQEATEKGWQALHNELRAIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+S+ E  +    P +P       +   +R+ L +RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKSLTELTETKGEP-LPFRVKQFAVAPKDRALLHKRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+++G  DE+++L  + +L  DLP ++ +G R +   L GE   D+ + RGI AT + A
Sbjct: 216 KMIQAGFEDEVKALYAREDLHPDLPSIRCVGYRQMWEYLDGESTLDDAIFRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSIDD 215
           KRQ TWL       W+    ++D
Sbjct: 276 KRQITWLRSWDDLVWLDSEHVED 298


>gi|312958651|ref|ZP_07773171.1| tRNA dimethylallyltransferase [Pseudomonas fluorescens WH6]
 gi|311287194|gb|EFQ65755.1| tRNA dimethylallyltransferase [Pseudomonas fluorescens WH6]
          Length = 323

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 122/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+L+++D + A +I
Sbjct: 96  IPLLVGGTMLYYKALQEGLADMPAADAQVRAELEEEAARLGWQALHDQLAAVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPF---------IPLESAHKIIILPERSA 123
           HP+D QR++RALE+  VSGQ++ E   KQ              +P   A+  I    R  
Sbjct: 156 HPNDPQRLSRALEVWRVSGQTMTELRLKQTAQSADAGASGQSQLPYTVANLAIAPANRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI +RFT MLE G IDE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHERIAQRFTIMLEQGFIDEVVALRSRGDLHTGLPSIRAVGYRQVWDHLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSDLHWLDSLDSDNL 309


>gi|261209767|ref|ZP_05924073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC341]
 gi|262401562|ref|ZP_06078129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC586]
 gi|260841183|gb|EEX67693.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC341]
 gi|262352277|gb|EEZ01406.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC586]
          Length = 304

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+L  +D + A++I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQLQQIDPVSAQRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 146 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 205 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEAIYRGICATRQLA 264

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   ++D
Sbjct: 265 KRQITWLRSWDDLTWLDSENVD 286


>gi|319427723|gb|ADV55797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens 200]
          Length = 308

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 113/195 (57%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+L  +D + A +IH
Sbjct: 99  PLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADAKGWETLHDQLRDIDPVSAERIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 159 PNDPQRLSRALEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFRI 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G I E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 218 MLQQGFIGEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTMVEKAVAATRQLAK 277

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    + +W+
Sbjct: 278 RQLTWLRSWPELNWL 292


>gi|190570597|ref|YP_001974955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019151|ref|ZP_03334958.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|239977475|sp|B3CNB0|MIAA_WOLPP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190356869|emb|CAQ54243.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995260|gb|EEB55901.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 297

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 114/195 (58%), Gaps = 4/195 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K   +PII GG+GLY  +L   LS +P+I   +RE + E  K       +  + S D  +
Sbjct: 88  KNSRIPIITGGSGLYISSLIKGLSSIPQISQEVRENVNELRKNLSKEEFYKLVLSKDPRI 147

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALKERI 128
             +I  +D  R++RALE+   +G++I   W++   P  PL +  K+  ILP+R  +  +I
Sbjct: 148 QGKIFINDSHRLSRALEVITETGKTIF-VWQENRQP--PLFNNFKVYTILPKREDIYRKI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF +M+E+GAIDE+++L+ MN S  LP MKA GV +II  LKGEI  DE +Q     T
Sbjct: 205 NSRFIEMVENGAIDEVKNLLSMNPSPHLPAMKAHGVPEIIRYLKGEITLDEAIQIAQTNT 264

Query: 189 NKYAKRQKTWLCHQF 203
             YAKRQ TW  +QF
Sbjct: 265 RHYAKRQYTWFKNQF 279


>gi|52425572|ref|YP_088709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mannheimia
           succiniciproducens MBEL55E]
 gi|61214027|sp|Q65SD6|MIAA_MANSM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|52307624|gb|AAU38124.1| MiaA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 314

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 119/190 (62%), Gaps = 8/190 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P+    +R KI EK +++G   LH ELS +D + A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPQADEKVRSKIEEKAQKFGWATLHKELSLIDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN--PFIPLESAHKIIILPE-RSALKERIRR 130
           +P+D QRI RALE+  +SG+S+ E  +Q     P+  L+ A    I PE R+ L  RI  
Sbjct: 156 NPNDSQRINRALEVFYISGKSMTELTEQKGEQLPYHILQFA----IAPEDRAILHRRIEM 211

Query: 131 RFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +M+ESG   E+  L  + +L +DLP ++ +G R +   L+G+ + DE + RGI AT 
Sbjct: 212 RFHKMIESGFKQEVERLYHRGDLHIDLPSIRCVGYRQMWEHLRGDYDLDEAVFRGICATR 271

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 272 QLAKRQITWL 281


>gi|222825169|dbj|BAH22326.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Cadra cautella]
          Length = 297

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/195 (40%), Positives = 114/195 (58%), Gaps = 4/195 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K   +PII GG+GLY  +L   LS +P+I   +RE + E  K       +  + S D  +
Sbjct: 88  KNSRIPIITGGSGLYISSLIKGLSSIPQISQEVRENVNELRKNLSKEEFYKLVLSKDPRI 147

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALKERI 128
             +I  +D  R++RALE+   +G++I   W++   P  PL +  K+  ILP+R  +  +I
Sbjct: 148 QGKIFINDSHRLSRALEVITETGKTIF-VWQENRQP--PLFNNFKVYTILPKREDIYRKI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF +M+E+GAIDE+++L+ MN S  LP MKA GV +II  LKGEI  DE +Q     T
Sbjct: 205 NSRFIEMVENGAIDEVKNLLSMNPSPHLPAMKAHGVPEIIRYLKGEITLDEAIQIAQTNT 264

Query: 189 NKYAKRQKTWLCHQF 203
             YAKRQ TW  +QF
Sbjct: 265 RHYAKRQYTWFKNQF 279


>gi|120597491|ref|YP_962065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           W3-18-1]
 gi|239977457|sp|A1RFR6|MIAA_SHESW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120557584|gb|ABM23511.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           W3-18-1]
          Length = 304

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 113/195 (57%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+L  +D + A +IH
Sbjct: 95  PLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADAKGWETLHDQLRDIDPVSAERIH 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  +    P +P +     I   ER  L + I +RF  
Sbjct: 155 PNDPQRLSRALEVYRISGKSLTELTQTKSAP-LPYDVVQFAIAPRERKVLHDLIAQRFRI 213

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML+ G I E+  L  + +L LDLP M+ +G R     L GE +YD  +++ + AT + AK
Sbjct: 214 MLQQGFIGEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTMVEKAVAATRQLAK 273

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    + +W+
Sbjct: 274 RQLTWLRSWPELNWL 288


>gi|262275156|ref|ZP_06052967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Grimontia
           hollisae CIP 101886]
 gi|262221719|gb|EEY73033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Grimontia
           hollisae CIP 101886]
          Length = 297

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 117/197 (59%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR KI ++ K+ G   LH+ L  +D +   +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPPADPVIRAKIEQEAKERGWQALHEALCKVDPVAGARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  +    P +P E  H+  I P ER  L  RI  RF
Sbjct: 146 HPNDPQRLSRALEVFRISGKTLTELTETKGEP-LPYE-VHQFAIAPKERGDLHRRIELRF 203

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +M+E+G   E+R+L  + +L+ D+P ++ +G R +   L G  + D+ + RG+ AT + 
Sbjct: 204 HKMMEAGFEKEVRALFDRGDLNPDMPSIRCVGYRQMWDYLAGSCSLDDAVYRGVCATRQL 263

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 264 AKRQITWLRSWDNLTWL 280


>gi|317049757|ref|YP_004117405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp.
           At-9b]
 gi|316951374|gb|ADU70849.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp.
           At-9b]
          Length = 316

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 114/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I +   + G   LH +L  +D +   +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQMAAEKGWDALHRQLCEIDPVAGGRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P +     I    R  L +RI  R+ 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKTS-GEALPYDVYQFAIAPANREVLHQRIALRYN 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  D+P ++ +G R + + L GEI+Y+E + RGI AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLTGEIDYNEMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 280 KRQMTWLRGWPDVHWL 295


>gi|88606708|ref|YP_505034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaplasma
           phagocytophilum HZ]
 gi|123495412|sp|Q2GKR7|MIAA_ANAPZ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|88597771|gb|ABD43241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaplasma
           phagocytophilum HZ]
          Length = 312

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 120/210 (57%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q +    LP+I GG+G+Y  +L   +S +P I   +R+  R  L+  G+   ++ L + D
Sbjct: 84  QAWDDNVLPVITGGSGMYINSLVNGISDIPAIDPEVRKTARNLLESLGNAAFYEALVARD 143

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
           S  AR +H ++  +I RA E+   +G SI  +W+++P    P E+   +++LP R+ L +
Sbjct: 144 SNAAR-LHHNNTHQILRAFEVLEQTGTSIFTWWERSPR-IKPFENCEVLVLLPPRNKLYD 201

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           +I RRF  M+++ AI E++ LM +NL +  P+MKA G  +I+  L+G+I + E ++    
Sbjct: 202 KINRRFLTMMQTDAISEVKYLMSLNLPMHAPVMKAHGAPEIVQYLQGKIEFMEAVEIAQK 261

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T  YAKRQ TW   Q   D    SS +++
Sbjct: 262 NTRHYAKRQCTWFRTQLPCDTRFFSSQNEI 291


>gi|146283981|ref|YP_001174134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri A1501]
 gi|145572186|gb|ABP81292.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri A1501]
          Length = 332

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP    ++R ++       G  +LHD L+ +D   A +I
Sbjct: 105 IPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQVLHDRLAQVDPESAARI 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF------WKQAPNP----FIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG ++ E        K  P+      +P   A   I   +R  
Sbjct: 165 HPNDPQRLVRALEVYCVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTVAQLCIAPAQRHI 224

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI RRF  M+E G ++E+ +L  + +L L +P ++A+G R +   L G    +E ++
Sbjct: 225 LHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEYLDGSSTREEMVE 284

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 285 RGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 318


>gi|294139255|ref|YP_003555233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           violacea DSS12]
 gi|293325724|dbj|BAJ00455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           violacea DSS12]
          Length = 308

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 114/195 (58%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS +P     IR +I  +   +G   LHD L  +D + A +IH
Sbjct: 99  PLLVGGTMLYFKALLEGLSPLPAADEVIRAEIAAEALTHGWQHLHDALKRVDPVSAARIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+S+ E  K   +P +P E     I   +R  L   I  RF  
Sbjct: 159 PNDPQRLSRALEVFRISGKSMTELTK-IKSPPLPYEVIQFAISPKDRKVLHLSIEERFKL 217

Query: 135 MLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G ++E++SL + N L LDLP M+ +G R     L G+ +Y+  + +GIIAT + AK
Sbjct: 218 MLNQGFVEEVQSLRQRNDLHLDLPSMRCVGYRQCWEHLDGDYDYNTMVDKGIIATRQLAK 277

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    + +W+
Sbjct: 278 RQLTWLRGWSELNWL 292


>gi|330445001|ref|ZP_08308655.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328493119|dbj|GAA03152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 311

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 119/203 (58%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R  I     ++G   LHDEL  +D +   +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDAAEFGWQALHDELVRIDPVAGARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K      +P +  H+  I P +R+ L +RI  RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTELTKTQ-GESLPYK-VHQFAIAPMDRAVLHQRIELRF 214

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +M+E+G   E+R+L  + +L L+LP ++ +G R +   L G  + DE + RGI AT + 
Sbjct: 215 NKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEAVFRGICATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+  S +D
Sbjct: 275 AKRQITWLRGWKDLTWLDSSDVD 297


>gi|254292842|ref|YP_003058865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hirschia
           baltica ATCC 49814]
 gi|254041373|gb|ACT58168.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hirschia
           baltica ATCC 49814]
          Length = 314

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 114/199 (57%), Gaps = 3/199 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGTGLY  AL   LS +P++P +++ K  +++++      H  L+ +D   A +I
Sbjct: 95  VPILAGGTGLYLSALVHGLSKVPDVPESVKRKALDQVEE-DREAAHKALALVDPEAAMRI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D QR+ RALE+   +G+SI  F    P PF+         + P R+ L  RI  R+ 
Sbjct: 154 RPLDIQRLTRALEVFYHTGRSITSFQTPEP-PFLKQNEWVGFALTPIRAELYARINARYD 212

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +MLE+GA DE R L +  LS DLPIM+A G+        G I  +++++RG   T +YAK
Sbjct: 213 KMLETGAPDEARILYERGLSKDLPIMRAHGMPGFCEYFDGAIRLEDSIERGKRDTRRYAK 272

Query: 194 RQKTWLCHQFQADWIRISS 212
           RQ TW+ HQF   W RI S
Sbjct: 273 RQFTWIAHQFPF-WARIPS 290


>gi|239977576|sp|A4VQP1|MIAA_PSEU5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 323

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP    ++R ++       G  +LHD L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQVLHDRLAQVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF------WKQAPNP----FIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG ++ E        K  P+      +P   A   I   +R  
Sbjct: 156 HPNDPQRLVRALEVYCVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTVAQLCIAPAQRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI RRF  M+E G ++E+ +L  + +L L +P ++A+G R +   L G    +E ++
Sbjct: 216 LHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEYLDGSSTREEMVE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 309


>gi|77359237|ref|YP_338812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123587197|sp|Q3IDT9|MIAA_PSEHT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|76874148|emb|CAI85369.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 306

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 123/205 (60%), Gaps = 4/205 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +PE    IR ++  +  QYG   L+ EL  +D   A+++
Sbjct: 96  VPVLVGGTMLYFKALIDGLSPLPEANVEIRAELEAQAAQYGWPHLYQELVKIDPQAAQKM 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
             +D QRI RALE+  ++G+++ E  KQ   P +P  + H+  I P +RS L +RI +RF
Sbjct: 156 SENDSQRINRALEVYKLTGKTMTELQKQK-QPVLPY-TFHQFAIAPTQRSELHQRIEKRF 213

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE G  +E+ +L ++ +L  ++P ++ +G R +   L GEI++DE + RGI AT + 
Sbjct: 214 KIMLEQGFENEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGEIDHDEMVFRGIAATRQL 273

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TWL       W+     ++L
Sbjct: 274 AKRQLTWLRSWPDVTWLTTGDEENL 298


>gi|167855441|ref|ZP_02478206.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis 29755]
 gi|167853435|gb|EDS24684.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis 29755]
          Length = 314

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY+++L   LS +P    AIR +I  K +Q G   LH EL  +D I A +I
Sbjct: 95  IPLLVGGTMLYYKSLLDGLSPLPSADPAIRAEIEAKAEQIGWAGLHQELVKIDPISAERI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  +SG+++ E   Q     IP E     I   ER+ L +RI +RF 
Sbjct: 155 NPNDSQRINRALEVFYISGKTMTELTAQQ-GEGIPYEITQFAIAPQERAVLHQRIEQRFH 213

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M++ G   E+R L  + +L++DLP ++ +G R +   L+G+ + DE + RGI AT + A
Sbjct: 214 KMIDLGFEQEVRQLYQRGDLNVDLPSIRCVGYRQMWEYLEGQTSLDEAIFRGICATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 274 KRQITWL 280


>gi|188535086|ref|YP_001908883.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           tasmaniensis Et1/99]
 gi|238689722|sp|B2VCX4|MIAA_ERWT9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|188030128|emb|CAO98014.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           tasmaniensis Et1/99]
          Length = 316

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 118/205 (57%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R++I +   + G   LH +L  +D + A +I
Sbjct: 101 IPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAGEAGWEALHRQLCDIDPVAANRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P + +   I    R  + +RI +RF 
Sbjct: 161 HPNDPQRLSRALEVFFISGKTLTELTKIS-GEILPYDVSQFAIAPASRELIHQRIEQRFH 219

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  ++P ++ +G R + + L GE +YD+ + RGI AT + A
Sbjct: 220 QMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLAGETDYDDMVYRGICATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+     D  +
Sbjct: 280 KRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|15602770|ref|NP_245842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|12721221|gb|AAK02989.1| TrpX [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 357

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I EK +  G   LH EL+ +D + A++I
Sbjct: 138 IPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEEKAQLQGWAALHQELAKIDPLAAQRI 197

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+S+ E  +Q  +  +P +     I   +RS L +RI  RF 
Sbjct: 198 NPNDSQRINRALEVFYLTGKSLSELSQQKGDS-LPYQILQFAIAPKDRSILHDRIALRFQ 256

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L LDLP M+ +G R +   L+G+ ++DE + RGI AT + A
Sbjct: 257 KMIEQGFQQEVEKLYQREDLHLDLPAMRCVGYRQMWEYLRGDYDHDEMIFRGICATRQLA 316

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 317 KRQITWL 323


>gi|58696929|ref|ZP_00372428.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225630535|ref|YP_002727326.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia sp.
           wRi]
 gi|254811024|sp|C0R3P3|MIAA_WOLWR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|58536843|gb|EAL60055.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592516|gb|ACN95535.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia sp.
           wRi]
          Length = 294

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 110/191 (57%), Gaps = 4/191 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PII GG+GLY  +L   LS MP+I   +R+ + E  K       +    S D  +  ++
Sbjct: 92  IPIITGGSGLYISSLIKGLSSMPQISQKVRKNVSELRKNLSKEEFYKLALSKDPRIQGKV 151

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALKERIRRRF 132
             +D  R++RALE+   +G+SI   W++   P  PL +  KI  ILP+R  +  +I  RF
Sbjct: 152 FMNDSHRLSRALEVITETGKSIF-VWQENRQP--PLFNNFKIYTILPKREDVYRKINSRF 208

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E+GAIDE++ L+ MNL+  LP MKA GV +II  LKGEI  DE +Q     T  YA
Sbjct: 209 ITMIENGAIDEVKKLLSMNLAPHLPAMKAHGVPEIIKYLKGEITLDEAIQIAQTNTRHYA 268

Query: 193 KRQKTWLCHQF 203
           KRQ TW   QF
Sbjct: 269 KRQYTWFKKQF 279


>gi|262172556|ref|ZP_06040234.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           MB-451]
 gi|261893632|gb|EEY39618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           MB-451]
          Length = 315

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEQEALTLGWQVLHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|114798380|ref|YP_759182.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hyphomonas
           neptunium ATCC 15444]
 gi|123028387|sp|Q0C511|MIAA_HYPNA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114738554|gb|ABI76679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hyphomonas
           neptunium ATCC 15444]
          Length = 316

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 119/209 (56%), Gaps = 3/209 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K+LQR  K    +IVGGTGLY  ALT  LS +P +P  IR +++   +  G+  L   L+
Sbjct: 85  KRLQRQNKHA--VIVGGTGLYLLALTQGLSDIPPVPEDIRAEVKAISESEGADGLRLRLA 142

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
             D  +A ++   D QR+ARA E+ L +G+ + EF  +   P +         + P R+A
Sbjct: 143 PHDPELAERLGTGDRQRLARAYEVWLATGRQLSEFQNERQPPVLKEGEWVGFALTPPRAA 202

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           L ++I RRF  ML  GA+ E R+L+  NL  +LP MKA+G+  I A ++GEI+ +E  + 
Sbjct: 203 LYKKIDRRFEGMLMQGAVAEARALVSRNLDPELPAMKALGMPSIAAFVRGEISAEEAAES 262

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISS 212
               + +YAKRQ TW+  QF   W RI S
Sbjct: 263 AKRESRRYAKRQFTWIGRQFPF-WPRIPS 290


>gi|21263785|sp|Q9CMC7|MIAA_PASMU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 316

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I EK +  G   LH EL+ +D + A++I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEEKAQLQGWAALHQELAKIDPLAAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+S+ E  +Q  +  +P +     I   +RS L +RI  RF 
Sbjct: 157 NPNDSQRINRALEVFYLTGKSLSELSQQKGDS-LPYQILQFAIAPKDRSILHDRIALRFQ 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L LDLP M+ +G R +   L+G+ ++DE + RGI AT + A
Sbjct: 216 KMIEQGFQQEVEKLYQREDLHLDLPAMRCVGYRQMWEYLRGDYDHDEMIFRGICATRQLA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQITWL 282


>gi|329889828|ref|ZP_08268171.1| tRNA delta2-isopentenylpyrophosphate transferase [Brevundimonas
           diminuta ATCC 11568]
 gi|328845129|gb|EGF94693.1| tRNA delta2-isopentenylpyrophosphate transferase [Brevundimonas
           diminuta ATCC 11568]
          Length = 274

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 109/194 (56%), Gaps = 2/194 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGTGLYF ALT  L+ +P IP   R+ ++ +    G       L+ +D +    + P
Sbjct: 78  LLVGGTGLYFNALTKGLADIPPIPVETRDAVQAEFDAEGETAFRRRLAEVDPVAEAAVFP 137

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RAL +  VSG+++   WK    P +P +S   +++ P R  L      R   M
Sbjct: 138 GDRQRLVRALSVHRVSGRAL-SAWKADTRPLLPPDSYDTLVVEPSRDRLYASCDARVDLM 196

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +   A++E+R+L+  +L  DLP MKA+GVR++ A L+GE++  + +     +T  YAKRQ
Sbjct: 197 MAHCALNEVRALVARDLDPDLPAMKAVGVRELAAHLRGELSLGDAVDAVKQSTRNYAKRQ 256

Query: 196 KTWLCHQFQADWIR 209
            TW  +Q Q DW R
Sbjct: 257 LTWFRNQ-QRDWPR 269


>gi|56459443|ref|YP_154724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           loihiensis L2TR]
 gi|61213954|sp|Q5QWA0|MIAA_IDILO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56178453|gb|AAV81175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           loihiensis L2TR]
          Length = 316

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 120/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +PE  T++REK+  +L + G   LH  L  +D   A++I
Sbjct: 96  VPLLVGGTMLYFKALLEGLSHLPESDTSVREKLTAELHEKGLAELHSRLQKVDPTSAKRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QRI RALE+  ++G+ + E  ++        +  ++  + P ER  L +RI +RF
Sbjct: 156 HPNDPQRILRALEVYEIAGKPLTELTRERHGQLT--KPIYQFAVAPVERKVLHQRIEQRF 213

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             ML     +E+ +L  + +L  DLP ++++G R +   L GE++YDE  +RGIIAT + 
Sbjct: 214 DHMLAQPFKEEVATLFARPDLHPDLPSIRSVGYRQMWQHLAGELSYDEMRERGIIATRQL 273

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+    ++
Sbjct: 274 AKRQMTWLRGWPGVHWLETGDLN 296


>gi|220934075|ref|YP_002512974.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|239977470|sp|B8GNC6|MIAA_THISH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219995385|gb|ACL71987.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 320

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 113/187 (60%), Gaps = 1/187 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYFRAL   L  +PE    +R +I  +    G   +H  L+++D   A +I
Sbjct: 98  VPLLVGGTMLYFRALEFGLDRLPEADPEVRAQIEAEAAASGWEAIHARLAAVDPPSAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ RALE+ L++G+ +  F   A    +P       +I  +R+AL+ERI RRF 
Sbjct: 158 HPNDPQRLQRALEVYLLTGRPLSAFHGGADASTLPYRLLRLALIPADRAALRERIARRFD 217

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QMLE G I E+ +L +  +L+  LP ++A+G R   A L GE++++    + IIAT + A
Sbjct: 218 QMLELGLIHEVETLYRREDLNPSLPAIRAVGYRQAWAYLAGEMDFETMRSKAIIATGQLA 277

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 278 KRQLTWL 284


>gi|219871387|ref|YP_002475762.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis SH0165]
 gi|239977381|sp|B8F662|MIAA_HAEPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219691591|gb|ACL32814.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis SH0165]
          Length = 314

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/187 (40%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I A++I
Sbjct: 95  IPLLVGGTMLYYKALLDGLSPLPSADPDIRAEIEAKAEQIGWAGLHQELVNIDPISAKRI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  +SG+++ E   Q     IP E     I+  ER+ L +RI +RF 
Sbjct: 155 NPNDSQRINRALEVFYISGKTMTELTAQQ-GEAIPYEIMQFAIVPQERAVLHQRIEQRFH 213

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+  G   E+R L  + +L++DLP ++ +G R +   L+G+ + DE + +GI AT + A
Sbjct: 214 KMINLGFEQEVRRLYQRGDLNVDLPSIRCVGYRQMWEYLEGQTSLDEAIFKGICATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 274 KRQITWL 280


>gi|229588074|ref|YP_002870193.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens SBW25]
 gi|259495771|sp|C3KDW2|MIAA_PSEFS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229359940|emb|CAY46794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens SBW25]
          Length = 323

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 123/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+L+++D + A +I
Sbjct: 96  IPLLVGGTMLYYKALQEGLADMPAADAQVRAELEEEAARLGWQALHDQLAAIDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPF---------IPLESAHKIIILPERSA 123
           HP+D QR++RALE+  VSGQ++ E   KQ+             +P   A+  I    R  
Sbjct: 156 HPNDPQRLSRALEVWRVSGQTMTEHRLKQSAQSADAGASGQSQLPYTVANLAIAPANRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI +RFT MLE G +DE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHERIAQRFTIMLEQGFVDEVVALRSRGDLHPGLPSIRAVGYRQVWDHLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSDLHWLDSLDSDNL 309


>gi|320539678|ref|ZP_08039342.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Serratia symbiotica str. Tucson]
 gi|320030290|gb|EFW12305.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Serratia symbiotica str. Tucson]
          Length = 311

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 118/197 (59%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    ++RE I ++  + G   LH +L  +D + A +I
Sbjct: 99  IPLLVGGTMLYYKALLAGLSPLPPADPSVRECIEQQAVEQGWKALHRQLQEIDPVAALRI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSAL-KERIRRRF 132
           HP+D QR+ RALE+  +SG+++ E  K +    +P    H+  I P   AL  +RI  R+
Sbjct: 159 HPNDPQRLFRALEVFFISGKTLTEMIKIS-GESLPYH-VHQFAIAPSSRALIHQRIELRY 216

Query: 133 TQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E R+L    +L +DLP ++++G R + + L GE++YDE + RGI AT + 
Sbjct: 217 QQMLAAGFEAEARALFAWDDLHIDLPSIRSVGYRQMWSYLSGEMSYDEMVYRGICATRQL 276

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 277 AKRQMTWLRGWNSVHWL 293


>gi|300023590|ref|YP_003756201.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525411|gb|ADJ23880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 310

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 116/185 (62%), Gaps = 2/185 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF+AL   LS +P I  AIRE  R + ++ G+  LH EL++ D+ +A ++ 
Sbjct: 100 PVIVGGTGLYFKALLEGLSPIPSIDPAIREHWRAEAERRGAAELHRELAARDTRMADRLA 159

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPN-PFIPLESAHKIIILPERSALKERIRRRFT 133
           P+D QRI RALE+   +G+S+ + W+Q P  P     ++ + ++  +R  L  R   RF 
Sbjct: 160 PNDTQRIVRALEVIEQTGKSLAD-WQQIPGVPLFDAANSVRFLVTLDREDLHARADARFD 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +M+ SGA++E R L  + L+ DLP M+AIGVR ++ +++G+ + +         T +Y K
Sbjct: 219 RMIASGALNEARDLEALQLNPDLPAMRAIGVRPLLEVVRGQSSIEAAADAAKAETRQYIK 278

Query: 194 RQKTW 198
           RQ+TW
Sbjct: 279 RQETW 283


>gi|308125317|ref|ZP_05774457.2| tRNA dimethylallyltransferase [Vibrio parahaemolyticus K5030]
 gi|308112917|gb|EFO50457.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus K5030]
          Length = 304

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 91  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEIDPVSAARI 150

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 151 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDRAELHRRIELRFD 209

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L GE   DE + RG+ AT + A
Sbjct: 210 KMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEAVFRGVCATRQLA 269

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 270 KRQITWLRSWDDLTWLDSDNIE 291


>gi|28899592|ref|NP_799197.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260876667|ref|ZP_05889022.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260896640|ref|ZP_05905136.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260900900|ref|ZP_05909295.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|31340218|sp|Q87L06|MIAA_VIBPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28807828|dbj|BAC61081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308086321|gb|EFO36016.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308093998|gb|EFO43693.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308106502|gb|EFO44042.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AQ4037]
          Length = 310

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEIDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDRAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L GE   DE + RG+ AT + A
Sbjct: 216 KMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSDNIE 297


>gi|304396956|ref|ZP_07378836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp. aB]
 gi|304355752|gb|EFM20119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp. aB]
          Length = 301

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 114/196 (58%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R++I +  ++ G   LH +L  +D +   +I
Sbjct: 86  IPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQTAREKGWDALHRQLCEIDPVAGSRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K +    +P +     I    R  L +RI  RF 
Sbjct: 146 HPNDPQRLSRALEVFFISGKTLTELTKTS-GEALPYDVQQFAIAPASRELLHQRIALRFE 204

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E R+L  + +L  D+P ++ +G R + + L GEI++ E + RGI AT + A
Sbjct: 205 QMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDHSEMVYRGICATRQLA 264

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       W+
Sbjct: 265 KRQITWLRGWENVHWL 280


>gi|254509319|ref|ZP_05121409.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 16]
 gi|219547748|gb|EED24783.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 16]
          Length = 304

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 119/203 (58%), Gaps = 2/203 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+L  +D + A +I
Sbjct: 86  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWDVLHDQLKEVDPVSAERI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E  K   +  +P       I   ER+ L  RI  RF 
Sbjct: 146 HPNDPQRLSRALEVYRISGKTLTELTKTKGDS-LPFRVKQFAIAPKERAELHRRIELRFE 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+R+L  + +L  DLP ++ +G R +   L G    D+ + +G+ AT + A
Sbjct: 205 KMMEAGFENEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDAIFKGVCATRQLA 264

Query: 193 KRQKTWLCHQFQADWIRISSIDD 215
           KRQ TWL       W+   +ID+
Sbjct: 265 KRQITWLRSWDNLTWLDSENIDE 287


>gi|262163595|ref|ZP_06031338.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM223]
 gi|262027962|gb|EEY46624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM223]
          Length = 315

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     IR++I ++    G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYFKALIEGLSPLPAADPEIRQQIEQEALTLGWQTLHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  R+ 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRYE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|304319731|ref|YP_003853374.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parvularcula
           bermudensis HTCC2503]
 gi|303298634|gb|ADM08233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parvularcula
           bermudensis HTCC2503]
          Length = 302

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 117/202 (57%), Gaps = 3/202 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGTGL+ +ALT  LS +P I  +       +  Q G      E+ +LD  +   + 
Sbjct: 93  PIVVGGTGLWLKALTDGLSPIPPIDDSYGRAAAARWAQLGPEDFRREVLNLDPAM-EALA 151

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR  RA  +   +G  + E+ +  P P + +E A + +++P+R  L+ R   RF  
Sbjct: 152 PADRQRHLRAWTVATATGTPLSEWQRVPPTPVLTIEWA-RGVLMPDRETLRTRSAHRFAA 210

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E GA+ E+ +L+  +LSL LPIMKA+GVR++  +L GE + +E +   + AT++  KR
Sbjct: 211 MVERGAMGEVAALLARDLSLSLPIMKAVGVRELSKVLAGEWSLEEGVSAAVTATHRLVKR 270

Query: 195 QKTWLCHQFQADWIRISSIDDL 216
           Q TW  +QF A W + +S + L
Sbjct: 271 QTTWFNNQFSA-WPQSASANAL 291


>gi|209696184|ref|YP_002264114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aliivibrio
           salmonicida LFI1238]
 gi|226700793|sp|B6EMQ8|MIAA_ALISL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|208010137|emb|CAQ80462.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Aliivibrio
           salmonicida LFI1238]
          Length = 313

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 118/203 (58%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I ++ +  G   +HD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAETLGWEAMHDQLKEIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E   Q     +P +  H+  I P ER+ +  RI  RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQVKGDALPYQ-VHQFAIAPKERAEIHRRIELRF 214

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M++ G  +E+RSL  + +L  DLP ++ +G R +     GE   D+ + RGI AT + 
Sbjct: 215 DNMMKGGFEEEVRSLYERDDLHADLPSIRCVGYRQMWEYFDGEGTLDDAIFRGICATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+   +ID
Sbjct: 275 AKRQITWLRSWKDLTWLDSDNID 297


>gi|325266809|ref|ZP_08133481.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kingella
           denitrificans ATCC 33394]
 gi|324981741|gb|EGC17381.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kingella
           denitrificans ATCC 33394]
          Length = 322

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +Y+ ALT  L+ +PE    +R +++ + +Q+G H L+++L   D   A ++
Sbjct: 100 LPLIVGGTMMYYHALTQGLNELPEADATVRAELQRQKQQHGLHSLYEQLRRADPETAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN-PFIPLESAHKIIILPE-RSALKERIRRR 131
            P D QRI RALE+ L++G+ + +  + A + P +PL   H I ++PE RS L  +I RR
Sbjct: 160 PPGDSQRIERALEVFLLTGKPLSQHIRAAQSAPALPL---HTIALIPEDRSRLHAQINRR 216

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F QML++G +DE+R L +   +L  D   M+ +G R +   L G+IN  E + +G  AT 
Sbjct: 217 FEQMLDNGFVDEVRRLQQKYPDLPPDGTAMRCVGYRQVWQYLDGQINKSELVAQGQAATR 276

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 277 QLAKRQLTWL 286


>gi|256821742|ref|YP_003145705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kangiella
           koreensis DSM 16069]
 gi|256795281|gb|ACV25937.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kangiella
           koreensis DSM 16069]
          Length = 317

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 116/187 (62%), Gaps = 1/187 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++ L   +  +P+    +R  ++E+L   G   LH EL+ +D + A++I
Sbjct: 102 MPLLVGGTMLYYKTLLEGMHNLPDSDPTVRAGLQERLNNEGLAKLHQELAEVDPVSAKRI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H +D QR  RALE+  ++G+ + +   +  N   P  +    +   +R+ L +RI +RF 
Sbjct: 162 HENDPQRTLRALEVFAITGKPLSQLHAEQDNNDFPYRTLQIALAPQDRAYLHQRIEKRFH 221

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QM+E G + E++SL  + +L+ DLP +K++G R +   L GE++ +E ++RGIIAT + A
Sbjct: 222 QMMEQGFLQEVQSLYERGDLNPDLPSIKSVGYRQMWQYLAGELSLEEAIERGIIATRQLA 281

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 282 KRQFTWL 288


>gi|258623498|ref|ZP_05718500.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM573]
 gi|258625636|ref|ZP_05720517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM603]
 gi|258582091|gb|EEW06959.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM603]
 gi|258584210|gb|EEW08957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM573]
          Length = 315

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 117/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G   LHD+L  +D + A++I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEQEALTLGWQALHDQLQQIDPVSAQRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+ESG  +E+++L  + +L  DLP ++ +G R +   L G    DE + RGI AT + A
Sbjct: 216 KMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|114570571|ref|YP_757251.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Maricaulis
           maris MCS10]
 gi|122315626|sp|Q0AN24|MIAA_MARMM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114341033|gb|ABI66313.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Maricaulis
           maris MCS10]
          Length = 308

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 115/201 (57%), Gaps = 2/201 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+VGGTGLYF ALT  L+ +PEI  A R +    L   G   L  E   LD +   ++
Sbjct: 93  VPILVGGTGLYFNALTRGLAPVPEIGDAARARAAALLDADGLAGLRAEALRLDPVATNRV 152

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             +D QR+ R +E+   +G ++  F      P  P  +   I+I P+R AL  RI +RF 
Sbjct: 153 DAADRQRLLRIVEVGFETGTALSVFQADTVPPLEP-AAWRGIVIEPDREALYRRIDQRFE 211

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLE+GA+DE+ + M+ +L  DLP  KA+GV  +IA L+GE++ DE        + +YAK
Sbjct: 212 HMLEAGALDEVAAFMQRDLDPDLPASKALGVPPLIAHLRGEMSLDEARDNAKRDSRRYAK 271

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TW  +Q  A W RI ++D
Sbjct: 272 RQGTWFRNQ-AASWSRIGTLD 291


>gi|327482308|gb|AEA85618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri DSM 4166]
          Length = 332

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 118/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP    ++R ++       G   LHD L+ +D   A +I
Sbjct: 105 IPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQALHDRLAQVDPESAARI 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF------WKQAPNP----FIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG ++ E        K  P+      +P   A   I   +R  
Sbjct: 165 HPNDPQRLVRALEVHRVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTVAQLCIAPAQRHI 224

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI RRF  M+E G ++E+ +L  + +L L +P ++A+G R +   L G    +E ++
Sbjct: 225 LHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEYLDGSSTREEMVE 284

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 285 RGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 318


>gi|254230083|ref|ZP_04923481.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|262393032|ref|YP_003284886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|151937417|gb|EDN56277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|262336626|gb|ACY50421.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
          Length = 310

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEVDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDRAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L GE   DE + RG+ AT + A
Sbjct: 216 KMMEAGFEEEMKALHSRKDLHPDLPSIRCVGYRQMWEYLDGECTRDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|190573717|ref|YP_001971562.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia K279a]
 gi|229621760|sp|B2FL25|MIAA_STRMK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190011639|emb|CAQ45258.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia K279a]
          Length = 317

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 109/200 (54%), Gaps = 6/200 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+ GGTGLYFRAL   LS MPE    +RE +  +  + G   LH EL+ +D   A +IH
Sbjct: 99  PILAGGTGLYFRALLQGLSPMPEADPVMREALSTEAAERGWAALHAELAKVDPAAAARIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            +D QRI RALE+  ++G  I E+ ++     +P+ +   I+   +R+ L +RI  RF  
Sbjct: 159 ATDPQRIQRALEVYRLTGTPISEWQRRPGVAPLPVRTLKLILAPRDRAVLHQRIEARFDA 218

Query: 135 MLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           ML  G +DE+R+L  M         LDLP ++A+G R     L GE +      + I AT
Sbjct: 219 MLAQGFLDEVRALRAMPEMAAVTAPLDLPAVRAVGYRQAWEYLDGEGDAARFRDKAIFAT 278

Query: 189 NKYAKRQKTWLCHQFQADWI 208
            + AKRQ TWL  +  A W 
Sbjct: 279 RQLAKRQLTWLRGELDARWF 298


>gi|54310431|ref|YP_131451.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum SS9]
 gi|61214123|sp|Q6LM29|MIAA_PHOPR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|46914872|emb|CAG21649.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Photobacterium profundum SS9]
          Length = 311

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 116/190 (61%), Gaps = 8/190 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R  I  + ++ G H LH+EL  +D +   +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPASDPDVRAGIEREAQEKGWHFLHEELVRIDPVSGARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIILP-ERSALKERIRR 130
           HP+D QR++RALE+  +SG+++ E  K    P P+      H+  I P +R+ L +RI +
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTELTKIQGEPLPY----RVHQFAIAPKDRAVLHQRIEQ 212

Query: 131 RFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +M+E+G   E+R+L  + +L  DLP ++ +G R +   L G  + DE + RG+ AT 
Sbjct: 213 RFEKMIEAGFEQEVRALYQRGDLHPDLPSIRCVGYRQMWDYLGGNCDLDEAVFRGVCATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQITWL 282


>gi|91227454|ref|ZP_01261818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           alginolyticus 12G01]
 gi|91188604|gb|EAS74895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           alginolyticus 12G01]
          Length = 310

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEVDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDRAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L GE   DE + RG+ AT + A
Sbjct: 216 KMMEAGFEEEMKALHSRKDLHPDLPSIRCVGYRQMWEYLDGECTRDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|94497353|ref|ZP_01303924.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Sphingomonas
           sp. SKA58]
 gi|94423216|gb|EAT08246.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Sphingomonas
           sp. SKA58]
          Length = 316

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 115/209 (55%), Gaps = 30/209 (14%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIRE-KLKQYGSHILHDELSSLDSIVARQ 72
           LPI+VGGTGLY R L   ++ +P+I   IR  +R   + Q      H+ L   D   A +
Sbjct: 106 LPILVGGTGLYLRTLLDGIAPVPDIDPDIRATVRALPVAQA-----HEALRQEDPQAAAR 160

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI------------IILPE 120
           + P+D  R+ARALE+   +G+++ + W+           AHKI            I+LP 
Sbjct: 161 LAPADTTRVARALEVIRSTGRTL-KAWQ-----------AHKIGGIGDRIALAPLILLPP 208

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R  L +R  RRF QML+ GA+ E+ +L+  NL   LP+M+AIGV DI A L G+++    
Sbjct: 209 RPWLIDRCDRRFVQMLDQGAVAEVEALLARNLDPALPVMRAIGVPDIAAWLNGDMDRGTM 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           ++RG  AT +YAKRQ TW  HQ    W R
Sbjct: 269 IERGQRATRQYAKRQYTWFAHQPPGGWQR 297


>gi|156972475|ref|YP_001443382.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           ATCC BAA-1116]
 gi|269961401|ref|ZP_06175765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           1DA3]
 gi|166217000|sp|A7MX77|MIAA_VIBHB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|156524069|gb|ABU69155.1| hypothetical protein VIBHAR_00095 [Vibrio harveyi ATCC BAA-1116]
 gi|269833778|gb|EEZ87873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           1DA3]
          Length = 310

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDELKEIDPVSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQTKGDSLPYRVKQFAIAPKDRAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L G+   DE + RGI AT + A
Sbjct: 216 KMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGDCTRDEAVFRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWNDLTWLDSDNIE 297


>gi|114319733|ref|YP_741416.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122312369|sp|Q0AB61|MIAA_ALHEH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114226127|gb|ABI55926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 317

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 114/188 (60%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYFRAL   LS +PE   A+R ++  +   +G   LHD L+++D   A +I
Sbjct: 102 VPLLAGGTMLYFRALEHGLSELPEADPALRRRLEGEAAAHGWGALHDRLAAVDPEAAARI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           HP D QRI RALE+  ++GQS+ E  ++A    +P     K +++PE R  L  RI RRF
Sbjct: 162 HPHDAQRIQRALEVWELTGQSLSEL-QRAGRQRLPWPIG-KWVLMPESRGELHRRIARRF 219

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML  G IDE+ +L  + +L   LP M+++G R +   L G  + +   +RGI AT ++
Sbjct: 220 DQMLAQGFIDEVAALRQRPDLHRALPAMRSVGYRQVWDYLDGCYDRETLRERGIAATRQF 279

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 280 AKRQITWL 287


>gi|113461227|ref|YP_719296.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 129PT]
 gi|123327355|sp|Q0I462|MIAA_HAES1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|112823270|gb|ABI25359.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 129PT]
          Length = 311

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 118/189 (62%), Gaps = 7/189 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I +K +++G   LH+EL+ +D I A++I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADEKVRLEIEQKAEKFGWATLHNELAKIDPISAQRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN--PFIPLESAHKIIILPERSALKERIRRR 131
           +P+D QRI RALE+  ++GQS+ E   Q     P+  ++ A    I P+R+ L +RI +R
Sbjct: 156 NPNDSQRINRALEVFYLTGQSLTELTAQKGKEIPYHIIQFA----IAPDRAVLHQRIEQR 211

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F +M+E G   E+  L  + +L  +LP ++ +G R +   L+G  + DE + RGI AT +
Sbjct: 212 FHKMIEQGFQQEVEKLYQRSDLHPNLPSIRCVGYRQMWEYLQGNYDKDEMIFRGICATRQ 271

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 272 LAKRQLTWL 280


>gi|254470383|ref|ZP_05083787.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudovibrio
           sp. JE062]
 gi|211960694|gb|EEA95890.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudovibrio
           sp. JE062]
          Length = 307

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 113/199 (56%), Gaps = 1/199 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGTGLYF++    LS++P+IP  IR+  R   ++  S  LH  L   D+ +A ++HP
Sbjct: 91  VVVGGTGLYFKSALEGLSLLPDIPEGIRQHWRTFAQEATSEELHGALGERDTAMAERLHP 150

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           SD QRI RALE+   +G+S+  +  +   P +  + A  +++ P+R  L +RI RRF  M
Sbjct: 151 SDTQRIVRALEVIEGTGKSLSIWQNERSTPLLAADEAMTVVLSPDRKVLHDRIHRRFDMM 210

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E  +L    L  +L +MKAIGV+ +     G    +  +++    T +YAKRQ
Sbjct: 211 VEQGGVEEACALWAKGLDPNLQVMKAIGVKQLAEAASGLTTMEWAIEKAKTETRRYAKRQ 270

Query: 196 KTWLCHQFQADWIRISSID 214
            T+   Q  + W  +  ++
Sbjct: 271 STFFRGQLSS-WSNLDPLN 288


>gi|213967923|ref|ZP_03396069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato T1]
 gi|301384443|ref|ZP_07232861.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato Max13]
 gi|302064110|ref|ZP_07255651.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato K40]
 gi|302132269|ref|ZP_07258259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213927266|gb|EEB60815.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato T1]
          Length = 323

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 122/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP   TA+R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAANTAVRAQLEADAQAFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDHLDGKLTREEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|166712460|ref|ZP_02243667.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzicola BLS256]
          Length = 327

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 115/203 (56%), Gaps = 10/203 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A+R  I  +  Q G   LH EL+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSHLPEADRAVRASIAAEAAQIGWAGLHSELARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ-APNPFIPLESAHKIIILP-ERSALKERIRRR 131
           H +D QRI RALE+  +SG+  I +W+   P P +P+    K+++ P ER+ L  RI RR
Sbjct: 158 HATDPQRIQRALEVYRISGRP-ISYWQALPPGPRLPVR-VLKVVLAPRERAVLHGRIERR 215

Query: 132 FTQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
              ML  G    ++++R+L +M      LDLP ++A+G R     L G  +  E   + I
Sbjct: 216 LDAMLAQGFLAEVEQVRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAI 275

Query: 186 IATNKYAKRQKTWLCHQFQADWI 208
            AT + AKRQ TWL  +  A W 
Sbjct: 276 QATRQLAKRQLTWLRGELDARWF 298


>gi|149910177|ref|ZP_01898823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moritella sp.
           PE36]
 gi|149806763|gb|EDM66727.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moritella sp.
           PE36]
          Length = 311

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 121/204 (59%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+ L   LS +P    AIR+ I  + K  G   LH ELS  D   A ++
Sbjct: 101 IPLLVGGTMLYFKVLLEGLSPVPTSVPAIRQAIEAEAKLRGWESLHHELSLYDPESAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H +D QR+ RA+E+  ++G+S+ E  +Q     +P + +   I   +++ L ERI +RF 
Sbjct: 161 HKNDAQRVCRAVEVYRLTGKSLTELTQQK-GESLPYDVSQFAIAPTDKAVLHERIEQRFK 219

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            M+E+G   E+++L  + +L LDLP M+ +G R +   L G++++DE + RG++AT + A
Sbjct: 220 LMIEAGFETEVQALHQRDDLHLDLPSMRCVGYRQMWEYLDGKMDHDEMVFRGVVATRQLA 279

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TWL       W+   + D+L
Sbjct: 280 KRQMTWLKSWNDLTWLDSKADDNL 303


>gi|152978662|ref|YP_001344291.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           succinogenes 130Z]
 gi|239977180|sp|A6VN09|MIAA_ACTSZ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150840385|gb|ABR74356.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           succinogenes 130Z]
          Length = 318

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 116/190 (61%), Gaps = 8/190 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  + +Q G  +LH EL+ +D   A +I
Sbjct: 100 IPLLVGGTMLYYKALIEGLSPLPNADEKIRSEIEARAQQTGWAVLHQELAKIDPASAARI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN--PFIPLESAHKIIILPE-RSALKERIRR 130
           +P+D QRI RALE+  ++G+S+ E   Q  +  P+  L+ A    I PE RS L ERI  
Sbjct: 160 NPNDSQRINRALEVFYLTGKSLTELTAQKGDALPYNVLQFA----IAPEDRSILHERIEL 215

Query: 131 RFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +M+E G   E+  L  + +LS DLP ++ +G R +   L+G+  +DE + RGI AT 
Sbjct: 216 RFKKMVELGFKAEVEKLYARSDLSPDLPSIRCVGYRQMWEHLRGDYGFDEAIYRGICATR 275

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 276 QLAKRQITWL 285


>gi|104783873|ref|YP_610371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           entomophila L48]
 gi|122401627|sp|Q1I448|MIAA_PSEE4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|95112860|emb|CAK17588.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudomonas entomophila L48]
          Length = 323

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R ++  +    G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALVEGLADMPPADAAVRAELEAQASALGLGELHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++            N  +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGANGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G +  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGHLTENEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWDGVHWLDSLACDNL 309


>gi|331014609|gb|EGH94665.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 323

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 122/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP   TA+R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAANTAVRAQLEADAQAFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFEQMLDQGLLDEVLALRSRGDLHAGLPSIRAVGYRQVWDHLDGKLTREEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLYWLDSLASDNL 309


>gi|167035936|ref|YP_001671167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida GB-1]
 gi|189081957|sp|B0KKZ6|MIAA_PSEPG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166862424|gb|ABZ00832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida GB-1]
          Length = 323

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 122/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYYKALIDGLADMPAADAAVRAELEAQAEALGLAELHRQLAEVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G ++E+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVEEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|58584893|ref|YP_198466.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|75507955|sp|Q5GS00|MIAA_WOLTR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|58419209|gb|AAW71224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 297

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 112/191 (58%), Gaps = 4/191 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PII GG+GLY  +L   LS +P++   IR+ + E  K       +  + S DS +  +I
Sbjct: 92  MPIITGGSGLYISSLINSLSPIPKVSEEIRKNVSELRKNLSKEEFYKLVLSKDSKIQGKI 151

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALKERIRRRF 132
             +D  R++RALE+   +G+SI   W+++    +PL    KI  ILP+R  +  +I  RF
Sbjct: 152 STNDLHRLSRALEVITATGKSIF-VWQESRQ--LPLFDNFKIYTILPKREDVYRKINSRF 208

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+ESGA+DE++ L+ MNL+  LP M+A GV +II  LKG+I   E +Q     T  YA
Sbjct: 209 VTMIESGAVDEVKKLLNMNLAPHLPAMRAHGVPEIIKYLKGKITLSEAIQIAQTNTRHYA 268

Query: 193 KRQKTWLCHQF 203
           KRQ TW  +QF
Sbjct: 269 KRQYTWFKNQF 279


>gi|330872249|gb|EGH06398.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 16  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARI 75

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 76  HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 135

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 136 LHQRIALRFKQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 195

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 196 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 229


>gi|144899624|emb|CAM76488.1| tRNA isopentenyltransferase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 312

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 113/203 (55%), Gaps = 11/203 (5%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +++  LP++VGGTGLY R L   +S  P IP  IR   R  L + G+   H EL+  D
Sbjct: 87  EAWEQGRLPVVVGGTGLYIRTLMHGISPAPPIPDEIRAHTRALLAEMGNAAFHAELAKRD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-----HKIIILPER 121
            ++A ++ P++ QR+ARA E+   SGQS+   W+      +P+E A       + + P R
Sbjct: 147 PVMAARLDPANSQRLARAWEVLEASGQSLAH-WQS-----LPMEGAVPARWLTLALDPPR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L      RF  M+  GA+DE+R+L+ ++L   LP MKA+GV ++  L  G +   + +
Sbjct: 201 NILYAHCDHRFRAMMAQGALDEVRALLDLHLDPALPAMKALGVPELARLAGGTMTEIQAV 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQ 204
           +    AT  YAKRQ TW  HQ +
Sbjct: 261 EAAQRATRNYAKRQLTWFRHQLE 283


>gi|4768874|gb|AAD29668.1|AF124757_28 tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 312

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 115/210 (54%), Gaps = 12/210 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I   +RE++R    +     L  E    D + A ++
Sbjct: 101 LPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSMSVEEAYSALQQE----DPMAADRL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE-SAHKIIILPERSALKERIRRRF 132
            P+D  RI RALE+   +G  +  +W+Q     I  E      +I+P  + L+ R  +RF
Sbjct: 157 RPTDKTRIMRALEVMRSTGHPL-HYWQQKKTGGIANEIKLQSFVIIPPANILRSRCDKRF 215

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++ EI+    +++   AT +YA
Sbjct: 216 DQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRREIDRLTMIEKAKAATRQYA 275

Query: 193 KRQKTWLCHQFQADW------IRISSIDDL 216
           KRQ+TW  HQ    W      I  + IDD 
Sbjct: 276 KRQRTWFRHQTDESWIIFFDDINFNPIDDF 305


>gi|315498752|ref|YP_004087556.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Asticcacaulis
           excentricus CB 48]
 gi|315416764|gb|ADU13405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Asticcacaulis
           excentricus CB 48]
          Length = 284

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 105/188 (55%), Gaps = 1/188 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
            IVGGTGLYF  L   L+ +PEI   +RE+ R     +G   + D L  LD +   ++ P
Sbjct: 97  CIVGGTGLYFLTLVRGLAEIPEIEPEVRERARATYDTHGEVFVRDTLRQLDPVTEARLAP 156

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RALE+   +G+++ + W+   +P +P  S    I+ P R  L  R  +RF QM
Sbjct: 157 HDRQRLCRALEVVWQTGRALSD-WQTDTHPILPPNSYRFDILRPARDGLYARCDQRFDQM 215

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +  GA+DE+R+LM   L    PI++ +G+ ++ A LKGE+  D+        T  YAKRQ
Sbjct: 216 IAHGALDEVRTLMDAGLQAGWPILRVLGLPELWAHLKGEMTLDDARNLAKQKTRNYAKRQ 275

Query: 196 KTWLCHQF 203
            T+  +QF
Sbjct: 276 TTFFGNQF 283


>gi|90414476|ref|ZP_01222452.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum 3TCK]
 gi|90324481|gb|EAS41040.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum 3TCK]
          Length = 311

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 120/203 (59%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R  I  + ++ G   LH+EL  +D +   +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPASDPDVRAGIEREAQEKGWQFLHEELVRIDPVSGARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K    P +P    H+  I P +R+ L +RI +RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTELTKTQGEP-LPYR-VHQFAIAPKDRAVLHQRIEQRF 214

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M+E+G  +E+R+L  + +L  DLP ++ +G R +   L G  + DE + RG+ AT + 
Sbjct: 215 ENMIEAGFEEEVRALYQRGDLHPDLPSIRCVGYRQMWDYLGGNCDLDEAVFRGVCATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+  ++ D
Sbjct: 275 AKRQITWLRGWKDLTWLDSNNGD 297


>gi|114330407|ref|YP_746629.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           eutropha C91]
 gi|122314569|sp|Q0AJ07|MIAA_NITEC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114307421|gb|ABI58664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           eutropha C91]
          Length = 317

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 114/188 (60%), Gaps = 3/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+ L   L+ +P    A+R+++ +  ++ G   +H  LS LD ++A +I
Sbjct: 100 IPLLVGGTMLYFKVLQQGLATLPAADEAVRKELEQSAREQGWPAMHTVLSRLDPVIAERI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P+D QRI RALE+  ++G+ +    KQ  +   P      I +LP +RS L  RI +RF
Sbjct: 160 KPNDSQRIQRALEVCYLTGRPMSAVLKQQQSRDFPYR-VFNIALLPGDRSVLHARISQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +MLE G +DE+R +  +  ++ D+P M+ +G R +   L+ EI+  E  +RG+ AT + 
Sbjct: 219 DKMLEIGLVDEVRMIRDQFQVTADMPAMRCVGYRQVYMYLENEISLAEMRERGVFATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQLTWL 286


>gi|260774635|ref|ZP_05883542.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260609425|gb|EEX35570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 315

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWEVLHDQLKEIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPFRVKQFAIAPKERAELHRRIELRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G   E+R L  + +L+ DLP ++ +G R +   L G    D+ + +GI AT + A
Sbjct: 216 KMMEAGFEQEMRELYARDDLNPDLPSIRCVGYRQMWDYLDGNCTLDDAIFKGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|320321885|gb|EFW77981.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320331010|gb|EFW86984.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 323

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFKQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330886599|gb|EGH20260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 323

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330899892|gb|EGH31311.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 323

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQLAGVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|254522787|ref|ZP_05134842.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas sp. SKA14]
 gi|219720378|gb|EED38903.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas sp. SKA14]
          Length = 317

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 108/200 (54%), Gaps = 6/200 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+ GGTGLYFRAL   LS MPE   A+R  +  +  + G   LH EL+ +D   A +IH
Sbjct: 99  PILAGGTGLYFRALLQGLSPMPEADPALRAALTAEAAERGWAALHAELAEVDPSAAARIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            +D QRI RALE+  +SG  I E+ ++     +P+ +   I+   +R+ L  RI  RF  
Sbjct: 159 ATDPQRIQRALEVYRLSGTPISEWQRRPGVAPLPVRTLKLILAPRDRAVLHRRIEARFDL 218

Query: 135 MLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           ML  G +DE+R+L  M         LDLP ++A+G R     L GE +      + I AT
Sbjct: 219 MLAQGFLDEVRALRAMPEMAAVKAPLDLPAVRAVGYRQAWEYLDGEGDAARFRDKAIFAT 278

Query: 189 NKYAKRQKTWLCHQFQADWI 208
            + AKRQ TWL  +  A W 
Sbjct: 279 RQLAKRQLTWLRGELDARWF 298


>gi|71737536|ref|YP_272866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|123638417|sp|Q48P03|MIAA_PSE14 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71558089|gb|AAZ37300.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 323

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|289623755|ref|ZP_06456709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648628|ref|ZP_06479971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|330865893|gb|EGH00602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 323

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLANDNL 309


>gi|319941731|ref|ZP_08016053.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804664|gb|EFW01531.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Sutterella
           wadsworthensis 3_1_45B]
          Length = 320

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 109/188 (57%), Gaps = 5/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY +A+   +  MP     +R  +  +    G   +H EL+ +D   A ++
Sbjct: 105 LPLIVGGTMLYAKAIREGIDEMPSTSPEVRSAVAAEGAAKGWPAMHAELAKIDPAAAERL 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
            P+D QRI RALE+  ++G+ +  F ++AP+P  P+ +A    ++PE R+AL ERI  RF
Sbjct: 165 APNDKQRIGRALEVFRMTGKPLSHFHRKAPHPAFPMLTA---ALVPEDRAALHERIEERF 221

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             ML +G +DE+R LM +     + P M+A+G R  +  L+G  NY      GI AT + 
Sbjct: 222 DAMLAAGLLDEVRQLMAEPGFDANSPAMRAVGYRQAVQFLEGRTNYAAFRLAGIAATRQL 281

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 282 AKRQLTWL 289


>gi|260774598|ref|ZP_05883510.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           metschnikovii CIP 69.14]
 gi|260610392|gb|EEX35599.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           metschnikovii CIP 69.14]
          Length = 310

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    A+R++I  + ++ G   LH +L  +D I A +I
Sbjct: 97  IPLLVGGTMLYYKALLDGLSPLPAANPAVRQQIESQAQEQGWAALHAQLQQIDPISAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     IP       I   +R+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYKISGKTLTEL-TQTKGESIPFRVKQFAIAPMDRAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M++SG  +E+++L   N L  DLP ++ +G R +     G    DE + RGI AT + A
Sbjct: 216 KMVKSGFEEEVKALYDRNDLHPDLPSIRCVGYRQMWDYFDGNSTLDEAIYRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL    +  W+   +I+
Sbjct: 276 KRQLTWLRSWDELTWLDSENIE 297


>gi|330984561|gb|EGH82664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 323

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWRSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330873786|gb|EGH07935.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330965980|gb|EGH66240.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 323

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 121/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP    A+R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAAVRAQLEADAQAFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDHLDGKLTREEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|331009763|gb|EGH89819.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 323

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWRSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|119474823|ref|ZP_01615176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451026|gb|EAW32259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2143]
          Length = 343

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 114/202 (56%), Gaps = 7/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   ++  P +   IR +I  +  ++G   LH +L+ +D   A +I
Sbjct: 104 IPLLVGGTMLYFKALLEGIAKTPAVEPEIRRQIEREALEFGWPFLHSQLALVDCESAARI 163

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF------WKQAPNPFIPLESAHKIIILPERSALKER 127
           HP+  QRI RAL +   SG ++ EF       KQ+ +   P +     I   +R  L  R
Sbjct: 164 HPNHSQRIERALAVYRSSGTTLTEFHRRQQEGKQSSSDDCPYDVVQLAIAPADRKVLHRR 223

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  M+E   IDE+ SL  + +L  DLP M+A+G R +   L GE+ ++E ++RGII
Sbjct: 224 IEKRFHSMIEHEFIDEVISLRAEYSLHEDLPSMRAVGYRQVWQYLAGELGHEEMIERGII 283

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL       W+
Sbjct: 284 ATRQLAKRQFTWLNGWKDVHWL 305


>gi|313500874|gb|ADR62240.1| MiaA [Pseudomonas putida BIRD-1]
          Length = 323

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 122/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALIDGLADMPAADAAVRAELEAQAEALGLAELHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSII-----EFWKQ-----APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+      +F +           +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTVHRRRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|145633370|ref|ZP_01789100.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 3655]
 gi|145635253|ref|ZP_01790957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittAA]
 gi|144985933|gb|EDJ92535.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 3655]
 gi|145267532|gb|EDK07532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittAA]
          Length = 311

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D + A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPMSAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E+  L  + +L+++LP ++ +G R +   L+G+  Y+E + RGI AT + A
Sbjct: 213 KMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|315178345|gb|ADT85259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii NCTC 11218]
          Length = 310

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  + +Q+G   LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEHEAEQHGWMALHDQLRQIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEALPFRVKQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L G    ++ + RGI AT + A
Sbjct: 216 KMVEAGFEEEVKALYARKDLHPDLPSIRCVGYRQMWDYLDGNGRLEDAIFRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +++
Sbjct: 276 KRQITWLRSWDDLTWLDSENVE 297


>gi|330971553|gb|EGH71619.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 323

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|255607876|ref|XP_002538803.1| tRNA delta(2)-isopentenylpyrophosphate transferase, putative
           [Ricinus communis]
 gi|223510350|gb|EEF23580.1| tRNA delta(2)-isopentenylpyrophosphate transferase, putative
           [Ricinus communis]
          Length = 229

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 108/188 (57%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF AL   LS +PE   AIR +I  +    G   +H +L+S+D  VA +I
Sbjct: 10  IPVLVGGTMLYFNALQHGLSDLPEADVAIRAQIEAEANALGWPAMHAQLASIDPSVAAKI 69

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H +D QRI RALE+  +SGQS+     Q+    +P       ++  +RS L +RI  RF 
Sbjct: 70  HTTDSQRIERALEVYRISGQSMSALRAQSQKVSLPFNILKLALMPSDRSVLHQRIAERFQ 129

Query: 134 QMLESGAIDEIRSLM--KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML+ G +DE++ L+     L+ D P M+ +G R  +  L GEI+     + G+ AT + 
Sbjct: 130 LMLKHGFVDEVKRLLVEYPQLNADSPSMRCVGYRQALQHLSGEIDLPTLGEHGVYATRQL 189

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 190 AKRQLTWL 197


>gi|66043838|ref|YP_233679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|81308574|sp|Q4ZYY1|MIAA_PSEU2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|63254545|gb|AAY35641.1| tRNA isopentenyltransferase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 323

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|240948253|ref|ZP_04752639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor NM305]
 gi|240297292|gb|EER47833.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor NM305]
          Length = 312

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    +IR +I ++ +Q G   LH EL  +D +   +I
Sbjct: 96  IPLLVGGTMLYYKALIEGLSPLPSADPSIRAEIEQRAEQQGWATLHQELLKIDPVAGTRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   +     +P +     I   ER+ L ERI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAEQ-GESLPYDVLQFAIAPQERAVLHERIEQRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+  G  +E++ L  + +L +DLP ++ +G R +   L+GEI+ DE + +GI AT + A
Sbjct: 215 KMIALGFEEEVKKLYARSDLHIDLPSIRCVGYRQMWEYLQGEISLDEAIFKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|229845406|ref|ZP_04465537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 6P18H1]
 gi|229811714|gb|EEP47412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 6P18H1]
          Length = 311

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D + A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPMSAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E+  L  + +L+++LP ++ +G R +   L+G+  Y+E + RGI AT + A
Sbjct: 213 KMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|212633662|ref|YP_002310187.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           piezotolerans WP3]
 gi|226704737|sp|B8CIX4|MIAA_SHEPW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|212555146|gb|ACJ27600.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           piezotolerans WP3]
          Length = 308

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 110/186 (59%), Gaps = 2/186 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P     IR +I  + +  G   LHD+L  +D + A +IH
Sbjct: 99  PLLVGGTMMYFKALIEGLSPLPGANDEIRAQIAVEAQANGWQALHDQLKEVDPVAAARIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ARALE+  +SG+S+ E  K     F P E+    I   +R  L + I  RF  
Sbjct: 159 PNDPQRLARALEVFRISGKSLTELTKVKSEAF-PYEAIQFAIAPNDRKVLHKAIETRFKA 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G ++E++ L  + +L L+LP M+ +G R     L GE +Y+  +++ I+AT + AK
Sbjct: 218 MLGLGFVEEVKKLKSRDDLHLELPSMRCVGYRQCWQHLDGEYDYETMVEKAIVATRQLAK 277

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 278 RQLTWL 283


>gi|28872057|ref|NP_794676.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|38257953|sp|Q87VJ3|MIAA_PSESM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28855310|gb|AAO58371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
          Length = 323

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 121/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP    A+R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAANAAVRAQLEADAQAFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDHLDGKLTREEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|301168661|emb|CBW28252.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Haemophilus influenzae 10810]
          Length = 311

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+  Y+E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|85710757|ref|ZP_01041818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           baltica OS145]
 gi|85695161|gb|EAQ33098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           baltica OS145]
          Length = 318

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGT LYF+AL   +S +PE  T +R++++ +L  +G   LH  L+ +D   A +IH
Sbjct: 99  PILVGGTMLYFKALLEGMSALPESDTNVRQQLQFELDTHGLATLHQRLAEVDPEAAARIH 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPF-IPLESAHKIIILP-ERSALKERIRRRF 132
           P+D QR  RALE+  +S + + +  +Q       P+   ++  + P +R+ L ERI +RF
Sbjct: 159 PNDPQRTLRALEVYQLSAKPMTQLVQQRRGALNYPI---YQFAVAPQQRALLHERIAQRF 215

Query: 133 TQMLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML  G   E+ +L K N L  DLP ++++G R +   L GE+ Y    +RGIIAT + 
Sbjct: 216 DQMLAEGFQQEVEALFKRNDLHPDLPAIRSVGYRQMWHYLTGELTYQAMKERGIIATRQL 275

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TWL       W+   + D L
Sbjct: 276 AKRQLTWLRGWPDVHWLDTFAHDKL 300


>gi|226939875|ref|YP_002794948.1| MiaA [Laribacter hongkongensis HLHK9]
 gi|226714801|gb|ACO73939.1| MiaA [Laribacter hongkongensis HLHK9]
          Length = 311

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 107/188 (56%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    AIR  +  +    G   LH EL+ +D   A ++
Sbjct: 95  IPLLVGGTMLYFKALAEGLSDLPPANPAIRAGLDARAAMLGWPALHQELARIDPQTAARL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D QR+ RALE+  ++GQ +  F        +P       +   ER+ + ERI RRF 
Sbjct: 155 APHDSQRLQRALEVWQLTGQPLSSFHTDEKTTALPFNVLRLALDTGERAWIHERIARRFR 214

Query: 134 QMLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML++G +DE+R+L+     L  DLP M+ +G R     L+GE + DE ++RGI AT + 
Sbjct: 215 LMLDAGFVDEMRTLLHDYPELHPDLPSMRCVGYRQAWEWLRGECSEDEFIERGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TW+
Sbjct: 275 AKRQITWM 282


>gi|16272042|ref|NP_438241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae Rd KW20]
 gi|260580628|ref|ZP_05848455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae RdAW]
 gi|319775011|ref|YP_004137499.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3047]
 gi|319896481|ref|YP_004134674.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3031]
 gi|329123086|ref|ZP_08251656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           aegyptius ATCC 11116]
 gi|1170952|sp|P44495|MIAA_HAEIN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|1573017|gb|AAC21746.1| tRNA delta(2)-isopentenylpyrophosphate transferase (trpX)
           [Haemophilus influenzae Rd KW20]
 gi|260092690|gb|EEW76626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae RdAW]
 gi|317431983|emb|CBY80331.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3031]
 gi|317449602|emb|CBY85807.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3047]
 gi|327471641|gb|EGF17083.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           aegyptius ATCC 11116]
          Length = 311

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+  Y+E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|119468155|ref|ZP_01611281.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Alteromonadales bacterium TW-7]
 gi|119448148|gb|EAW29412.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Alteromonadales bacterium TW-7]
          Length = 296

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 129/216 (59%), Gaps = 5/216 (2%)

Query: 4   KKLQRYKKRF-LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           KK+  + ++  +P++VGGT LYF+AL   LS +PE   AIR ++  +  ++G   L+ EL
Sbjct: 75  KKIDEFHQQGKVPVLVGGTMLYFKALIDGLSPLPEADPAIRAQLEAEASEFGWPHLYQEL 134

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ER 121
             +D   A+++  +D QRI RALE+  ++G+++ E  KQ   P +P  + H+  I P ER
Sbjct: 135 VKIDPQAAQKMSENDSQRINRALEVYRLTGKTMTELQKQK-QPPLPY-TFHQFAIAPQER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L +RI  RF  M++ G  +E+ +L ++ +L  ++P ++ +G R +   L GE+++DE 
Sbjct: 193 SELHQRIEERFKIMIDQGFENEVSALYLRKDLHHNMPSIRCVGYRQMWDYLAGEVSHDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+     ++L
Sbjct: 253 VFRGIAATRQLAKRQLTWLRSWPDVTWLTTGDEENL 288


>gi|330978951|gb|EGH78010.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 323

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|332038824|gb|EGI75266.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 305

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 120/205 (58%), Gaps = 4/205 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF++L   LS +PE  T IR ++  + K++G   L+ EL  +D   A +I
Sbjct: 95  VPVLVGGTMLYFKSLIDGLSPLPEADTEIRAELEAQAKEFGWPHLYKELVKVDPKAAEKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
             +D QRI RALE+  ++G+++ E   Q   P +P  + H+  I P ERS L  RI  RF
Sbjct: 155 SENDSQRINRALEVYRLTGKTMTELQMQK-QPALPY-TFHQFAIAPQERSELHRRIEERF 212

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M++ G  +E+ +L ++ +L  ++P ++ +G R +   L GE N+DE + RGI AT + 
Sbjct: 213 KIMIDQGFENEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGETNHDEMVFRGIAATRQL 272

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TWL       W+     ++L
Sbjct: 273 AKRQLTWLRSWPDVTWLTTGDEENL 297


>gi|85058314|ref|YP_454016.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sodalis
           glossinidius str. 'morsitans']
 gi|123520158|sp|Q2NW64|MIAA_SODGM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84778834|dbj|BAE73611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sodalis
           glossinidius str. 'morsitans']
          Length = 312

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 114/197 (57%), Gaps = 4/197 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I  + +  G   LH +L  +D I A +I
Sbjct: 101 IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEREAETVGWQALHRQLQQIDPIAANRI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR+ RALE+  VSG ++ E  K +          H+  I+P +R+ L +RI +RF
Sbjct: 161 HPNDPQRLLRALEVFFVSGNTLTELTKISGEALA--YRVHQFAIVPLDRALLHQRIAQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E+ +L  + +L  ++P ++ +G R + + L  E +YD+ + RGI AT + 
Sbjct: 219 HQMLAAGFEHEVSTLFARGDLHREMPSIRCVGYRQMWSYLADETDYDDMVFRGICATRQL 278

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 279 AKRQMTWLRGWHDVHWL 295


>gi|58039547|ref|YP_191511.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gluconobacter
           oxydans 621H]
 gi|81672670|sp|Q5FRZ1|MIAA_GLUOX RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|58001961|gb|AAW60855.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gluconobacter
           oxydans 621H]
          Length = 332

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 111/196 (56%), Gaps = 5/196 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + +  +PI+ GGTG+Y RALT  L  +P+   A R + R   ++ G   LH  L  +D  
Sbjct: 96  WAEERMPILCGGTGMYLRALTDGLVEVPDPGDAARSEARGLAEEIGPEALHARLMQVDPE 155

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSALKE 126
            A  + P+D QRI+RA E+   +G  +  +W+  P   +P  S   + +   PER  L+ 
Sbjct: 156 TASGLRPNDTQRISRAWEVWTGTGHGLA-WWRSQPG--LPPASCRFVSVQLDPEREGLRR 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
            I  RF QMLE+GA++E+ +L++  L   LP M+A GV ++ A+L+GE+  +E  +  ++
Sbjct: 213 AIDSRFGQMLEAGALEEVSALLERGLDPVLPAMRAHGVPELAAVLRGEVPLEEARKSAVL 272

Query: 187 ATNKYAKRQKTWLCHQ 202
           A  +Y +RQ TW  H 
Sbjct: 273 AIGRYTRRQATWFRHH 288


>gi|149915213|ref|ZP_01903741.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseobacter sp. AzwK-3b]
 gi|149810934|gb|EDM70773.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseobacter sp. AzwK-3b]
          Length = 293

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 114/200 (57%), Gaps = 5/200 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PII+GGTGLYF ALT  L+ +P  P AIR    + + + G   L   L+ LD+    +I 
Sbjct: 98  PIIIGGTGLYFTALTEGLAQIPPTPPAIRALANDLMAREGCAAL---LADLDTATRDRID 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E++  +G+ + ++    P P +PL+    +++  ++  L  RI RRF  
Sbjct: 155 TRNPMRVQRAWEVQRATGRGLADWQDDTPPPLLPLDHCAALLVEADKDWLTPRIERRFDA 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML +GA+DE R+ +      DLP  +AIG  ++IA L+G+I+ D   +   IAT ++AKR
Sbjct: 215 MLRAGALDEARANLA-GWQPDLPSSRAIGAPELIAHLRGDISLDTAREAATIATRQFAKR 273

Query: 195 QKTWLCHQFQADWIRISSID 214
           Q+TW   +    W RI++ D
Sbjct: 274 QRTWFRARMSG-WHRIAAQD 292


>gi|261856600|ref|YP_003263883.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Halothiobacillus neapolitanus c2]
 gi|261837069|gb|ACX96836.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Halothiobacillus neapolitanus c2]
          Length = 325

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 118/195 (60%), Gaps = 5/195 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   +S +P    A+R +++ +  + G   LH +L S D  VA ++
Sbjct: 106 VPLLVGGTMMYFQALLDGISQLPSTDPAVRAEVQAEAARLGWPALHAQLQSFDPQVAARV 165

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPL--ESAHKIIILP-ERSALKERIRR 130
           HP+D QRI RA+E+   +G+S+  + ++ P P  PL   + H+  + P  R+  +E +  
Sbjct: 166 HPNDPQRIGRAVEVFRSTGRSLSRWQREHP-PVSPLLGRAVHRFGLWPASRAHAREAMAH 224

Query: 131 RFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +ML +G +DE+ +L  + +L   +P ++A+G R +   L G ++YDE  QR I AT 
Sbjct: 225 RFDEMLAAGFVDEVAALRARGDLHPGMPSIRAVGYRQVWDYLDGTVDYDEMRQRAITATR 284

Query: 190 KYAKRQKTWLCHQFQ 204
           + AKRQ TW+  Q Q
Sbjct: 285 QLAKRQVTWMRGQTQ 299


>gi|330951473|gb|EGH51733.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae Cit 7]
          Length = 323

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|312882817|ref|ZP_07742550.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369509|gb|EFP97028.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 318

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 116/205 (56%), Gaps = 2/205 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G   +HD L  +D + A++I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQQALTLGWDTMHDRLKEVDPVAAQRI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  ++G+++ E   Q     +P       I   ER+ L  RI +RF 
Sbjct: 158 HPNDPQRLSRALEVYQITGKTLTEL-TQTKGDSLPFNVRQFAIAPTERAELHRRIEQRFN 216

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            M+E+G   E+R L  + +L  DLP ++ +G R +   L G   +++ + +G+ AT + A
Sbjct: 217 NMIEAGFEQEVRRLYAREDLHSDLPSIRCVGYRQMWEYLDGSSTFEDAVFKGVCATRQLA 276

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TWL       W+   +I+  F
Sbjct: 277 KRQITWLRSWDNLTWLDSENIEQAF 301


>gi|226942901|ref|YP_002797974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azotobacter
           vinelandii DJ]
 gi|259495761|sp|C1DLQ1|MIAA_AZOVD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226717828|gb|ACO76999.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azotobacter
           vinelandii DJ]
          Length = 323

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 118/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R ++  +    G   LH EL+++D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPSADPALRAELEARGAAEGWAALHRELATVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSII--EFWKQAPNPF--------IPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+      + A NP         +P    H  I   +R  
Sbjct: 156 HPNDPQRLVRALEVYRVSGLSMTAHRLRQVAQNPLSDRSAGEHLPYTVVHLAIAPTQRQI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI RRF  MLE G +DE+  L +  +L   LP M+A+G R +   L G +  ++ ++
Sbjct: 216 LHERIARRFRLMLEQGFVDEVELLWRRGDLHASLPSMRAVGYRQVWEYLDGLLTREQMVE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL +     W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRNWTDLHWLDSLGDDNL 309


>gi|145629067|ref|ZP_01784866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.1-21]
 gi|145639643|ref|ZP_01795246.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittII]
 gi|144978570|gb|EDJ88293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.1-21]
 gi|145271200|gb|EDK11114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittII]
 gi|309750613|gb|ADO80597.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPTase)
           [Haemophilus influenzae R2866]
          Length = 311

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 113/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR  + +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRADLEQKAAQQGWAALHTELAKIDPISATRI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+  Y+E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|152996646|ref|YP_001341481.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MWYL1]
 gi|239977410|sp|A6VYL7|MIAA_MARMS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150837570|gb|ABR71546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MWYL1]
          Length = 310

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 110/186 (59%), Gaps = 1/186 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF AL   L+ MP+    +R  I  +  + G   LH+EL   D   A +IH
Sbjct: 96  PLLVGGTMMYFNALQKGLAEMPQADAELRVIIEAEAAEKGWAALHEELQRFDPEAASRIH 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR+ RA+E+  ++G+++  FW+Q     +P E  +  ++  ERS L ERI +RF  
Sbjct: 156 PNDPQRLQRAIEVYRLTGKTMTHFWRQQEAVSLPFEMINMAVMPKERSVLHERIEQRFYD 215

Query: 135 MLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           M++ G + E+    +  +L++D+P M+ +G R +   L G    ++ + +G++A+ + AK
Sbjct: 216 MMDQGFLAEVEGFYRRGDLTIDMPSMRCVGYRQLWQYLDGVDLLEDAIFKGVVASRQLAK 275

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 276 RQLTWL 281


>gi|148981050|ref|ZP_01816270.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrionales
           bacterium SWAT-3]
 gi|145961026|gb|EDK26349.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrionales
           bacterium SWAT-3]
          Length = 310

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRKQIEAESIEQGWQALHDQLREIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER  L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKERKELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  +LP ++ +G R +   L G  + DE + RG+ AT + A
Sbjct: 216 KMIEAGFEEEMKALYAREDLHPELPSIRCVGYRQMWDYLDGNCDLDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +ID
Sbjct: 276 KRQITWLRSWDDLTWLDSENID 297


>gi|261493049|ref|ZP_05989589.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261311269|gb|EEY12432.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 317

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH EL  +D I   +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQELVKIDPIAGARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q     +P       I   +R+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQ-GEALPYNILQFAIAPQDRAVLHQRIEQRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E++ L ++ +L ++LP ++ +G R +   L+G+I+ DE + +GI AT + A
Sbjct: 215 KMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEAIFKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|261496337|ref|ZP_05992732.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307981|gb|EEY09289.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 317

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH EL  +D I   +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQELVKIDPIAGARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q     +P       I   +R+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQ-GEALPYNILQFAIAPQDRAVLHQRIEQRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E++ L ++ +L ++LP ++ +G R +   L+G+I+ DE + +GI AT + A
Sbjct: 215 KMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEAIFKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|254363114|ref|ZP_04979168.1| tRNA isopentenyltransferase [Mannheimia haemolytica PHL213]
 gi|153095001|gb|EDN75564.1| tRNA isopentenyltransferase [Mannheimia haemolytica PHL213]
          Length = 317

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH EL  +D I   +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQELVKIDPIAGARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q     +P       I   +R+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQ-GEALPYNILQFAIAPQDRAVLHQRIEQRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E++ L ++ +L ++LP ++ +G R +   L+G+I+ DE + +GI AT + A
Sbjct: 215 KMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEAIFKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|289672583|ref|ZP_06493473.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae FF5]
          Length = 323

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEGLHWLDSLASDNL 309


>gi|303256708|ref|ZP_07342722.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderiales
           bacterium 1_1_47]
 gi|330999348|ref|ZP_08323065.1| tRNA dimethylallyltransferase [Parasutterella excrementihominis YIT
           11859]
 gi|302860199|gb|EFL83276.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderiales
           bacterium 1_1_47]
 gi|329575206|gb|EGG56757.1| tRNA dimethylallyltransferase [Parasutterella excrementihominis YIT
           11859]
          Length = 314

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 111/187 (59%), Gaps = 3/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+IVGGT LY +A+   LS +P    A+REKI  +L + G   L++ L S+D   A ++
Sbjct: 96  VPLIVGGTMLYAKAVREGLSPLPATDPAVREKIGAELNEKGLPALYERLRSVDPKTADRL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ I E   Q   P + L S    ++ P+R+AL  RI  RF 
Sbjct: 156 APADTQRITRALEVFEMTGKPISELTAQKGEPLLKLSS--YALLPPDRAALHARIAERFE 213

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            M+++G +DE++ LM M  +  DLP M+++G R     L G   +D   + GI AT + A
Sbjct: 214 LMIKNGFLDEVKKLMAMPGMHADLPSMRSVGYRQAWNYLSGLTTFDAFKEAGIAATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TW+
Sbjct: 274 KRQMTWM 280


>gi|296447995|ref|ZP_06889901.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylosinus
           trichosporium OB3b]
 gi|296254505|gb|EFH01626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylosinus
           trichosporium OB3b]
          Length = 307

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 106/195 (54%), Gaps = 1/195 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+ GGTG+YF+A    LS +P +P +IREKIR + +      LH  L+  D   A ++ 
Sbjct: 94  PIVAGGTGMYFKAALYGLSDIPPVPDSIREKIRAEAQGRAPEFLHARLAERDPETAARLR 153

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QRI RALE+   +G+ +  F      P +   +     + P R AL  RI  RF  
Sbjct: 154 PTDPQRILRALEVLEATGRPLASFHNARSAPLLDAAACLAFFLAPPRDALHARIDARFDA 213

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML  GA+DE+R+L    L   LP M+A G   ++  ++GE++ +    +G + T  Y+KR
Sbjct: 214 MLRQGALDEVRALGARALDPALPAMRAHGAPHLMRFMRGEMSLEAAAAQGKLDTRHYSKR 273

Query: 195 QKTWLCHQFQA-DWI 208
           Q T+  HQ  +  WI
Sbjct: 274 QFTFARHQLPSFRWI 288


>gi|26991573|ref|NP_746998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida KT2440]
 gi|38257991|sp|Q88DD2|MIAA_PSEPK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24986661|gb|AAN70462.1|AE016688_1 tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida KT2440]
          Length = 323

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALIDGLADMPAADATVRAELEAQAEALGLAELHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTAHRRRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|148825651|ref|YP_001290404.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittEE]
 gi|229846988|ref|ZP_04467094.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 7P49H1]
 gi|166198912|sp|A5UB70|MIAA_HAEIE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148715811|gb|ABQ98021.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittEE]
 gi|229810072|gb|EEP45792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 7P49H1]
 gi|309972798|gb|ADO95999.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPTase)
           [Haemophilus influenzae R2846]
          Length = 311

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D + A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPMSAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E+  L  + +L+++LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|330960090|gb|EGH60350.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 323

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAEVRAQLEADAQAFGWQSLHDQLALVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGQQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|148358567|ref|YP_001249774.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Corby]
 gi|166215132|sp|A5IAM8|MIAA_LEGPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148280340|gb|ABQ54428.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Corby]
          Length = 313

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 115/197 (58%), Gaps = 10/197 (5%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 90  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALK 125
           A +IH  D QRI RALE+  ++G ++  +     + P+ +        + + PE RS L 
Sbjct: 150 AARIHAHDTQRIQRALEVYYLTGSTLSTYLTGPHEQPDYYFV-----NLALFPEQRSWLH 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           ERI +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++G
Sbjct: 205 ERIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPAMRCVGYRQILEYLAGHYDYETMREKG 264

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL H
Sbjct: 265 IAATRQLAKRQLTWLRH 281


>gi|86148235|ref|ZP_01066532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           MED222]
 gi|218708322|ref|YP_002415943.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus LGP32]
 gi|239977474|sp|B7VI54|MIAA_VIBSL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|85834005|gb|EAQ52166.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           MED222]
 gi|218321341|emb|CAV17291.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus LGP32]
          Length = 310

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADQEIRKQIEAESIEQGWQALHDQLREIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER  L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKERKELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  DE+++L  + +L  +LP ++ +G R +   L G  + DE + RG+ AT + A
Sbjct: 216 KMIEAGFEDEMKALYAREDLHPELPSIRCVGYRQMWDYLDGNCDLDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|325577873|ref|ZP_08148106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160303|gb|EGC72430.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 317

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I EK +++G  +LH EL  +D I A +I
Sbjct: 100 IPLLVGGTMLYYKALIEGLSPLPSADENLRLEIEEKAQKFGWPVLHQELQKIDPISAERI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+S+ E  +Q     +P +     I   +R+ L +RI +RF 
Sbjct: 160 NPNDSQRINRALEVFYLTGKSLTELTEQKGEE-LPYQFLQFAIAPEDRAVLHQRIEQRFH 218

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E   L  + +L  DLP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 219 KMIELGFQEEAEKLYQREDLHPDLPSIRCVGYRQMWEYLRGDYDHEEMVFRGICATRQLA 278

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 279 KRQITWL 285


>gi|260770598|ref|ZP_05879530.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii CIP 102972]
 gi|260614428|gb|EEX39615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii CIP 102972]
          Length = 310

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  + +Q+G   LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEHEAEQHGWLALHDQLRHIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGEALPFRVKQFAIAPKERAELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+++L  + +L  DLP ++ +G R +   L G    ++ + RGI AT + A
Sbjct: 216 KMVEAGFEEEVKALYARKDLHPDLPSIRCVGYRQMWDYLDGNGRLEDAIFRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +++
Sbjct: 276 KRQITWLRSWDDLTWLDSENVE 297


>gi|163802744|ref|ZP_02196634.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           AND4]
 gi|159173451|gb|EDP58273.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           AND4]
          Length = 310

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 115/201 (57%), Gaps = 2/201 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  +    G  +LHDEL  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEREALTKGWSVLHDELKEIDPVSAVRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  RI +RF 
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTEL-TQKKGDSLPYRVKQFAIAPKDRAELHRRIEQRFD 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+  L  + +L  DLP ++ +G R +   L G+   DE + RGI AT + A
Sbjct: 216 KMMEAGFEEEMNVLYARKDLHPDLPSIRCVGYRQMWEYLDGDCTRDEAIFRGICATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSI 213
           KRQ TWL       W+   +I
Sbjct: 276 KRQITWLRSWNDLTWLDSENI 296


>gi|296108343|ref|YP_003620044.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|295650245|gb|ADG26092.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 305

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 115/197 (58%), Gaps = 10/197 (5%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 82  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 141

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALK 125
           A +IH  D QRI RALE+  ++G ++  +     + P+ +        + + PE RS L 
Sbjct: 142 AARIHAHDTQRIQRALEVYYLTGSTLSTYLTGPHEQPDYYFV-----NLALFPEQRSWLH 196

Query: 126 ERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           ERI +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++G
Sbjct: 197 ERIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPAMRCVGYRQILEYLAGHYDYETMREKG 256

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL H
Sbjct: 257 IAATRQLAKRQLTWLRH 273


>gi|145636726|ref|ZP_01792392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittHH]
 gi|145270024|gb|EDK09961.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittHH]
          Length = 311

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 116/187 (62%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D + A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPMSAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E+  L  + +L+++LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQEEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|84393187|ref|ZP_00991951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus 12B01]
 gi|84376239|gb|EAP93123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus 12B01]
          Length = 310

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+L  +D + A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADQEIRKQIEAESIEQGWQALHDQLREIDPVSAERI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER  L  RI  RF 
Sbjct: 157 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKERKELHRRIELRFE 215

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  DE+++L  + +L  +LP ++ +G R +   L G  + DE + RG+ AT + A
Sbjct: 216 KMIEAGFEDEMKALYARDDLHPELPSIRCVGYRQMWDYLDGNCDLDEAVFRGVCATRQLA 275

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 276 KRQITWLRSWDDLTWLDSENIE 297


>gi|145630633|ref|ZP_01786412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
 gi|144983759|gb|EDJ91209.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
          Length = 311

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|254501939|ref|ZP_05114090.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Labrenzia
           alexandrii DFL-11]
 gi|222438010|gb|EEE44689.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Labrenzia
           alexandrii DFL-11]
          Length = 320

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 122/206 (59%), Gaps = 7/206 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS-SLDSIVARQ 72
           +P++VGGTGLYF+ALT   + +PEIP  +R K R      G   L   L+ + D   A  
Sbjct: 106 IPVLVGGTGLYFKALTEGFAELPEIPEDVRVKARSLADDGGVSELKAALAKAGDRDGAEG 165

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFW--KQAPNPFIPLESAHKIIILPERSALKERIRR 130
           ++  D QR+ARALE+ L +G+ + E    +Q+P P + ++    +++ P R  L ERI +
Sbjct: 166 LN--DPQRLARALEVLLTTGRPLAELQTEQQSP-PLLDIKHCLCLVLAPPRPWLHERIEK 222

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           R   ML    I+E+++L+   LS  LP M+AIGV++I  LL G  +  ET  R ++AT +
Sbjct: 223 RARLMLSLEGIEEVKTLLARELSYKLPAMRAIGVKEIAGLLTGGSDIGETEYRLVVATRQ 282

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDL 216
           YAKRQ+TW  +Q   DW R+   +++
Sbjct: 283 YAKRQETWFRNQM-PDWQRLDPSNEI 307


>gi|302189790|ref|ZP_07266463.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae 642]
          Length = 323

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQTFGWQSLHDQLAVVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+    +Q          +    +P   A+  I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGVSMTAHREQQTAQSTEAAASGRQQLPYTVANLAIAPADRKV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QML+ G +DE+ +L  + +L   LP ++A+G R +   L G++  DE  +
Sbjct: 216 LHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDHLDGKLTRDEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|70734069|ref|YP_257709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf-5]
 gi|123658372|sp|Q4KJ74|MIAA_PSEF5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|68348368|gb|AAY95974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf-5]
          Length = 323

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+L+++D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPAADPQVRAELEEEAARLGWQALHDQLAAVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG ++    ++          +    +P   A+  I    R  
Sbjct: 156 HPNDPQRLTRALEVYRVSGLTMTAHRQRQLAQSTEAGASGRSQLPYTVANLAIAPANRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RFTQMLE G IDE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHQRIAQRFTQMLEQGFIDEVVALRSRSDLHAGLPSIRAVGYRQVWDHLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWADLQWLDSLDCDNL 309


>gi|269103608|ref|ZP_06156305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163506|gb|EEZ42002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 311

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 119/203 (58%), Gaps = 4/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR  I ++ K+ G   LH+EL  +D +   +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLSPLPAADPEIRAGIEQEAKEKGWQALHEELVRIDPVSGARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QR++RALE+  +SG+++ E  K   +  +P +  H+  I P +R+ L +RI  RF
Sbjct: 157 HPNDPQRLSRALEVFRISGKTLTELTKTQGD-ALPYK-VHQFAIAPKDRTVLHQRIELRF 214

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +M+ +G   E+++L  + +L  DLP ++ +G R +   L G  + DE + RGI AT + 
Sbjct: 215 EKMMAAGFEQEVKALYERGDLHPDLPSIRCVGYRQMWDYLDGHCDQDEAVFRGICATRQL 274

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TWL       W+    +D
Sbjct: 275 AKRQITWLRSWKDLTWLDSGDVD 297


>gi|68248619|ref|YP_247731.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 86-028NP]
 gi|81336954|sp|Q4QPH6|MIAA_HAEI8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|68056818|gb|AAX87071.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 86-028NP]
          Length = 311

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHVLHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|315127882|ref|YP_004069885.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas sp. SM9913]
 gi|315016396|gb|ADT69734.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas sp. SM9913]
          Length = 306

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 121/205 (59%), Gaps = 4/205 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   LS +PE    +R ++  + K++G   L+ EL  +D   A+++
Sbjct: 96  VPVLVGGTMMYFKALIDGLSPLPEADADVRAELETQAKEHGWPYLYKELVKVDPQAAQKM 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
             +D QRI RALE+  ++G+++ E  KQ   P +P  + H+  I P +RS L  RI  RF
Sbjct: 156 SENDSQRINRALEVYRITGKTMTELQKQK-QPALPY-TFHQFAIAPDDRSELHHRIEERF 213

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M+E G   E+ +L ++ +L  ++P ++ +G R +   L GEI++DE + RGI AT + 
Sbjct: 214 KIMIEQGFEKEVSTLYLREDLHPNMPSIRCVGYRQMWDYLAGEIDHDEMIFRGIAATRQL 273

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TWL       W+     ++L
Sbjct: 274 AKRQLTWLRSWPDVTWLTTGDEENL 298


>gi|54298687|ref|YP_125056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Paris]
 gi|61213970|sp|Q5X1J2|MIAA_LEGPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53752472|emb|CAH13904.1| hypothetical protein lpp2751 [Legionella pneumophila str. Paris]
          Length = 313

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 114/195 (58%), Gaps = 6/195 (3%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 90  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-PLESAHKIIILPE-RSALKER 127
           A +IH  D QRI RALE+  ++G ++  +      P + P      + + PE RS L ER
Sbjct: 150 AARIHAHDTQRIQRALEVYYLTGSTLSTYLT---GPHVQPDYYFVNLALFPEQRSWLHER 206

Query: 128 IRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++GI 
Sbjct: 207 IAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILEYLAGHYDYETMREKGIA 266

Query: 187 ATNKYAKRQKTWLCH 201
           AT + AKRQ TWL H
Sbjct: 267 ATRQLAKRQLTWLRH 281


>gi|30249923|ref|NP_841993.1| tRNA isopentenyltransferase [Nitrosomonas europaea ATCC 19718]
 gi|46576985|sp|Q820J6|MIAA_NITEU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|30139030|emb|CAD85887.1| tRNA isopentenyltransferase [Nitrosomonas europaea ATCC 19718]
          Length = 317

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 111/188 (59%), Gaps = 3/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+ L   L+ +P    ++R  + ++    G   +H  LS LD + A +I
Sbjct: 100 VPLLVGGTMLYFKVLRQGLAALPPADDSVRRALEQQALDKGWPAMHAVLSQLDPVTAGRI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P+D QRI RALE+  ++G+ + E  +Q  N   P      I +LP +RS L +RI +RF
Sbjct: 160 QPNDSQRIQRALEVCYLTGKPMSEMLEQQQNADFPFR-VFNIALLPGDRSVLHDRISQRF 218

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE+G IDE+R +  + +++ D+P M+ +G R +   L  EI++    + G+ AT + 
Sbjct: 219 ATMLEAGLIDEVRLIREQFHVNGDMPSMRCVGYRQVCMYLDNEISFARMQETGVFATRQL 278

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 279 AKRQLTWL 286


>gi|146305669|ref|YP_001186134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina ymp]
 gi|239977437|sp|A4XPY6|MIAA_PSEMY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145573870|gb|ABP83402.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina ymp]
          Length = 324

 Score =  130 bits (328), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 120/214 (56%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++  +    G   LH EL+ +D   A +I
Sbjct: 97  IPLLVGGTMLYYKALLEGLADMPSADPVVRAELEARAAVEGWEALHRELAEVDPQSAARI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIE--FWKQAPNPF--------IPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG S+ E    + A NP         +P   A   I   +R  
Sbjct: 157 HPNDPQRLTRALEVYRVSGMSMSEHRLRQAAGNPEGGTSASGQLPYTVAQLAIAPAQRQI 216

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI +RF  MLE G ++E+ +L  + +L   LP ++A+G R +   L G+++ +E ++
Sbjct: 217 LHERIAQRFQAMLEQGFVEEVEALRSRSDLHAGLPSIRAVGYRQVWEYLDGKLSREEMVE 276

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 277 RGIIATRQLAKRQFTWLRGWGDLQWLDSLACDNL 310


>gi|54295537|ref|YP_127952.1| hypothetical protein lpl2624 [Legionella pneumophila str. Lens]
 gi|61213968|sp|Q5WTA1|MIAA_LEGPL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53755369|emb|CAH16865.1| hypothetical protein lpl2624 [Legionella pneumophila str. Lens]
          Length = 313

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 90  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           A +IH  D QRI RALE+  ++G S +  +   P+   P      + + PE RS L ERI
Sbjct: 150 AARIHAHDTQRIQRALEVYYLTG-STLSTYLTGPHE-QPDYCFVNLALFPEQRSWLHERI 207

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++GI A
Sbjct: 208 AQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILEYLAGHYDYETMREKGIAA 267

Query: 188 TNKYAKRQKTWLCH 201
           T + AKRQ TWL H
Sbjct: 268 TRQLAKRQLTWLRH 281


>gi|15836695|ref|NP_297383.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa 9a5c]
 gi|11386944|sp|Q9PH56|MIAA_XYLFA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|9104868|gb|AAF82903.1|AE003863_5 tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa 9a5c]
          Length = 317

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 110/205 (53%), Gaps = 6/205 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+I 
Sbjct: 94  RRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMITAEAKRDSWATLHTRLAEVDAIT 153

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +IH +D QRI RALE+  VSG+S+ ++ KQ     +PL     ++    R  L  RI 
Sbjct: 154 AARIHATDPQRIQRALEVYRVSGRSMSDWQKQPLKQRLPLRVLKLVLAPTHRKVLHFRIA 213

Query: 130 RRFTQMLESGAIDEIR------SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           +RF  ML++G + E+       S+  M   L+LP M+A+G R     L      +   QR
Sbjct: 214 QRFKAMLDNGLLAEVNALRTHPSIHAMARPLNLPAMRAVGYRQCWEHLDNMYTAETLYQR 273

Query: 184 GIIATNKYAKRQKTWLCHQFQADWI 208
           G+ AT + AKRQ TWL  +  A W 
Sbjct: 274 GVAATRQLAKRQLTWLRGELDALWF 298


>gi|223041564|ref|ZP_03611765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor 202]
 gi|223017659|gb|EEF16069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor 202]
          Length = 312

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I ++ +Q G   LH EL  +D +   +I
Sbjct: 96  IPLLVGGTMLYYKALIEGLSPLPSADPNIRAEIEQRAEQQGWAALHQELLKIDPVAGTRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   +     +P +     I   ER+ L ERI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAEQ-GESLPYDVLQFAIAPQERAVLHERIEQRFH 214

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+  G  +E++ L  + +L +DLP ++ +G R +   L+GEI+ DE + +GI AT + A
Sbjct: 215 KMIALGFEEEVKKLYERSDLHIDLPSIRCVGYRQMWEYLQGEISLDEAIFKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|225076486|ref|ZP_03719685.1| hypothetical protein NEIFLAOT_01532 [Neisseria flavescens
           NRL30031/H210]
 gi|224952165|gb|EEG33374.1| hypothetical protein NEIFLAOT_01532 [Neisseria flavescens
           NRL30031/H210]
          Length = 313

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 116/191 (60%), Gaps = 10/191 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YF ALT  L+ +P   TA+R +++ +  ++G   L+  L  +D I A ++ 
Sbjct: 96  PLIVGGTMMYFHALTEGLNDLPSADTAVRAQLQAEKNEHGLAGLYRRLQEVDPITAGRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALKERIRR 130
            +D QRI RALE+ L++G+ + E +   KQA     PL     + ++PE R  L ++I +
Sbjct: 156 ANDSQRIERALEVYLLTGKPLSEHFTEQKQA----APLLDLCTVALIPEDRHLLHQQIEK 211

Query: 131 RFTQMLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RF  MLE G +DEI +L +    L  D+P M+ +G R     L+GE +YD  +++GI+AT
Sbjct: 212 RFLNMLEHGFLDEIHALRRDYPQLYADMPSMRCVGYRQAWDYLEGETDYDTFVEKGIVAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQLAKRQLTWL 282


>gi|148549973|ref|YP_001270075.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida F1]
 gi|166230732|sp|A5W9T1|MIAA_PSEP1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148514031|gb|ABQ80891.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida F1]
          Length = 323

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALIDGLADMPAADATVRAELEAQAEALGLAELHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTAHRRRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWPDVHWLDSLACDNL 309


>gi|330807230|ref|YP_004351692.1| tRNA isopentenyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375338|gb|AEA66688.1| tRNA isopentenyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 323

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LH++L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALVDGLADMPAADPEVRAQIEEEAARLGWQALHEQLAIIDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPF---------IPLESAHKIIILPERSA 123
           HP+D QR++RALE+  VSGQS+     +Q+             +P   A+  I    R  
Sbjct: 156 HPNDPQRLSRALEVYRVSGQSMTALRQRQSAQSTEAAASGLQQLPYTVANLAIAPANRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RFT MLE G +DE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHRRIEQRFTLMLEQGFVDEVVALRERSDLHAGLPSIRAVGYRQVWDYLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWTDLHWLDSLDCDNL 309


>gi|260582014|ref|ZP_05849809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae NT127]
 gi|260094904|gb|EEW78797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae NT127]
          Length = 311

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWATLHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHILHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L+++LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|261254058|ref|ZP_05946631.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           orientalis CIP 102891]
 gi|260937449|gb|EEX93438.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           orientalis CIP 102891]
          Length = 316

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++    G   LHDEL  +D + A +I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTGGWDKLHDELKEIDPVSAERI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  R+ 
Sbjct: 158 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKERAELHRRIELRYE 216

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           ++LE+G  DE+R+L  + +L  DLP ++ +G R +   L G    D+ + +G+ AT + A
Sbjct: 217 KILEAGFEDEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDAIFKGVCATRQLA 276

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 277 KRQITWLRSWDDLTWLDSENIE 298


>gi|251825690|gb|ACT20912.1| tRNA isopentenyltransferase [Pseudomonas fluorescens]
          Length = 323

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LH++L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALVEGLADMPAADPEVRAQIEEEAARLGWQALHEQLAVIDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPF---------IPLESAHKIIILPERSA 123
           HP+D QR++RALE+  VSGQS+     +Q+             +P   A+  I    R  
Sbjct: 156 HPNDPQRLSRALEVYRVSGQSMTALRQRQSAQSTEAAASGLQQLPYTVANLAIAPANRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RFT MLE G IDE+ +L  + +L   LP ++A+G R +   L G++   E  +
Sbjct: 216 LHRRIEQRFTLMLEQGFIDEVVALRERSDLHPGLPSIRAVGYRQVWDYLDGKLTSAEMQE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWTDLHWLDSLDCDNL 309


>gi|33151910|ref|NP_873263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           ducreyi 35000HP]
 gi|46576929|sp|Q7U338|MIAA_HAEDU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33148131|gb|AAP95652.1| tRNA delta-2-isopentylpyrophosphate transferase [Haemophilus
           ducreyi 35000HP]
          Length = 313

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I     QYG   LH +L+ +D + A +I
Sbjct: 95  IPLLVGGTMLYYKALLEGLSPLPSANEHIRTEIEAHANQYGWASLHQQLTQIDPLAASRI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           + +D QRI RALE+  ++G+++ E   Q     +P +     I   ER+ L +RI +RF 
Sbjct: 155 NANDSQRINRALEVFYLTGKNLTELTAQQ-GECLPYQVLQFAIAPQERAVLHQRIEQRFH 213

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G + E+  L  + +L  DLP ++ +G R +   L GEI+ DE + +GI AT + A
Sbjct: 214 KMMELGFLTEVEKLYARGDLHPDLPAIRCVGYRQMWQHLAGEISLDEAIYKGICATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 274 KRQLTWL 280


>gi|212212504|ref|YP_002303440.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212218527|ref|YP_002305314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuK_Q154]
 gi|239977355|sp|B6J7C0|MIAA_COXB1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977356|sp|B6J017|MIAA_COXB2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|212010914|gb|ACJ18295.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212012789|gb|ACJ20169.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuK_Q154]
          Length = 301

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 116/207 (56%), Gaps = 13/207 (6%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+++D   A +I+
Sbjct: 87  PLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLNAIDPKSAARIN 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEF-----WKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           P+D QRI RA E+   +GQ +  +     +K  P  FI L      I+ PE RS L +RI
Sbjct: 147 PNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINL------ILAPENRSWLHQRI 200

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML++  ++E+R L  + +L+ DLP ++ +G R +   L GE +Y+    + I A
Sbjct: 201 EKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRHKAIAA 260

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T + AKRQ TWL     A W      D
Sbjct: 261 TRQLAKRQLTWLRRWPDAKWFNSEDKD 287


>gi|209363987|ref|YP_001424549.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|207081920|gb|ABS77397.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii Dugway 5J108-111]
          Length = 337

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 116/207 (56%), Gaps = 13/207 (6%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+++D   A +I+
Sbjct: 123 PLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLNAIDPKSAARIN 182

Query: 75  PSDGQRIARALEIKLVSGQSIIEF-----WKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           P+D QRI RA E+   +GQ +  +     +K  P  FI L      I+ PE RS L +RI
Sbjct: 183 PNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINL------ILAPENRSWLHQRI 236

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML++  ++E+R L  + +L+ DLP ++ +G R +   L GE +Y+    + I A
Sbjct: 237 EKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRHKAIAA 296

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T + AKRQ TWL     A W      D
Sbjct: 297 TRQLAKRQLTWLRRWPDAKWFNSEDKD 323


>gi|29654389|ref|NP_820081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 493]
 gi|164685700|ref|ZP_01946750.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|46576987|sp|Q820W3|MIAA_COXBU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081950|sp|A9KE31|MIAA_COXBN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|29541656|gb|AAO90595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 493]
 gi|164601207|gb|EAX32617.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii 'MSU Goat Q177']
          Length = 311

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 116/207 (56%), Gaps = 13/207 (6%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+++D   A +I+
Sbjct: 97  PLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLNAIDPKSAARIN 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEF-----WKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           P+D QRI RA E+   +GQ +  +     +K  P  FI L      I+ PE RS L +RI
Sbjct: 157 PNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINL------ILAPENRSWLHQRI 210

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML++  ++E+R L  + +L+ DLP ++ +G R +   L GE +Y+    + I A
Sbjct: 211 EKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRHKAIAA 270

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T + AKRQ TWL     A W      D
Sbjct: 271 TRQLAKRQLTWLRRWPDAKWFNSEDKD 297


>gi|74317530|ref|YP_315270.1| tRNA isopentenyltransferase [Thiobacillus denitrificans ATCC 25259]
 gi|123731795|sp|Q3SIR0|MIAA_THIDA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|74057025|gb|AAZ97465.1| tRNA isopentenyltransferase [Thiobacillus denitrificans ATCC 25259]
          Length = 313

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 113/188 (60%), Gaps = 4/188 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYFRAL   L  +P    A+R+++ +   + G   LH EL++LD   A ++
Sbjct: 98  VPLLVGGTMLYFRALLQGLDDLPRADAALRKRLEQDAAERGWPALHAELAALDPATAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI  ++G+ +     Q P   +P +     ++  +R+AL  RI  RF 
Sbjct: 158 APNDSQRIGRALEIVELTGRPMSAQLAQTPR-ALPYDVLQLALVPSDRAALHRRIGERFD 216

Query: 134 QMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE+G +DE+  +++ N  LD  +P M+A+G R   A L G+I+ +   ++G+ AT + 
Sbjct: 217 AMLEAGLVDEV-EMLRRNHVLDSTMPAMRAVGYRQAWAYLDGDIDLEALREQGVAATRQL 275

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 276 AKRQLTWL 283


>gi|85703601|ref|ZP_01034705.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseovarius sp. 217]
 gi|85672529|gb|EAQ27386.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseovarius sp. 217]
          Length = 295

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 114/201 (56%), Gaps = 11/201 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PII+GGTGLYF ALT  L+ +P  P ++R +    L   G   L   L +LD +   +I 
Sbjct: 98  PIIIGGTGLYFTALTEGLADVPTPPASLRAEADHLLATQGLSTL---LDALDPLTRSRID 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E++  +G+ +  +    P P +PL +   ++I  ++  L  RI RRF  
Sbjct: 155 TRNPMRVQRAWEVQRATGRGLAAWQDDTPPPLLPLHACTPLLITADKEWLTARIARRFDM 214

Query: 135 MLESGAIDEIRSLMKMNLSL---DLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           ML +GA+DE R+    NL L    LP MKAIG  +++A L+GE+  D+  +   IAT +Y
Sbjct: 215 MLAAGALDEARA----NLPLWDPALPSMKAIGAPELVAHLRGEMTLDQAREAATIATRQY 270

Query: 192 AKRQKTWLCHQFQADWIRISS 212
           AKRQ+TW   + +A W  I++
Sbjct: 271 AKRQRTWFRARMRA-WHPIAA 290


>gi|161830090|ref|YP_001596644.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 331]
 gi|189081951|sp|A9NCK4|MIAA_COXBR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|161761957|gb|ABX77599.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 331]
          Length = 311

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 116/207 (56%), Gaps = 13/207 (6%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+++D   A +I+
Sbjct: 97  PLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLNAIDPKSAARIN 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEF-----WKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           P+D QRI RA EI   +GQ +  +     +K  P  FI L      I+ PE RS L +RI
Sbjct: 157 PNDAQRIQRAFEIYETTGQPLSSYQSLKRFKALPYQFINL------ILAPENRSWLHQRI 210

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML++  ++E+R L  + +L+ DLP ++ +G R +   L GE +Y+    + I A
Sbjct: 211 EKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYEMMRHKAIAA 270

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T + AKRQ TWL     A W      D
Sbjct: 271 TRQLAKRQLTWLRRWPDAKWFNSEDKD 297


>gi|325271236|ref|ZP_08137781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas sp.
           TJI-51]
 gi|324103639|gb|EGC00941.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas sp.
           TJI-51]
          Length = 323

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R ++  +    G   LH +L+ +D + A +I
Sbjct: 96  IPLLVGGTMLYYKALVDGLADMPAADAGVRAELEAQAAALGLGELHRQLAEVDPVSAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G IDE+RSL  + +L   LP ++A+G R +   L G+++  E  +
Sbjct: 216 LHQRIALRFSQMLEQGFIDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLSESEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWPDVHWLDSLACDNL 309


>gi|307611573|emb|CBX01253.1| hypothetical protein LPW_29511 [Legionella pneumophila 130b]
          Length = 305

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 113/194 (58%), Gaps = 4/194 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 82  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 141

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           A +IH  D QRI RALE+  ++G S +  +   P+   P      + + PE RS L ERI
Sbjct: 142 AARIHAHDTQRIQRALEVYYLTG-STLSTYLTGPHE-QPDYCFVNLALFPEQRSWLHERI 199

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y    ++GI A
Sbjct: 200 AQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILEYLAGHYDYGAMREKGIAA 259

Query: 188 TNKYAKRQKTWLCH 201
           T + AKRQ TWL H
Sbjct: 260 TRQLAKRQLTWLRH 273


>gi|119502791|ref|ZP_01624876.1| tRNA isopentenyltransferase [marine gamma proteobacterium HTCC2080]
 gi|119461137|gb|EAW42227.1| tRNA isopentenyltransferase [marine gamma proteobacterium HTCC2080]
          Length = 348

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 111/197 (56%), Gaps = 3/197 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGT LYFRAL   L  MP     +R+KI       G   LH  L  +D ++A ++
Sbjct: 89  LPILVGGTMLYFRALLEGLDDMPASDPVVRQKIEADAAAEGWPALHARLQLVDPVLAARL 148

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+  QRIAR LE+  ++G+ + + W+         E+   ++I P ERS L  RI  R 
Sbjct: 149 HPNHSQRIARGLEVWQMTGKPLSD-WQSGKGHGGLGETPISLVICPKERSVLHARIADRL 207

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            +ML +G +DE+R L  + +LS DLP ++A+G R +   L GE + DE +Q  + AT + 
Sbjct: 208 DKMLSAGLLDEVRQLWSRGDLSPDLPAIRAVGYRQLWKYLDGEASLDEAVQNVLFATRQL 267

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TWL       W+
Sbjct: 268 AKRQMTWLRRWPADGWL 284


>gi|88810491|ref|ZP_01125748.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrococcus
           mobilis Nb-231]
 gi|88792121|gb|EAR23231.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrococcus
           mobilis Nb-231]
          Length = 303

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 115/202 (56%), Gaps = 13/202 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGG+ LYFRAL G L+ +P     +R  +  + +  G   LH  L+ LD+  A ++
Sbjct: 86  IPLLVGGSMLYFRALVGGLADLPAADQQLRASLEREAQCAGWPALHGRLARLDAKTAARL 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----QAPNPFIPLESAHKIIILPE-RSALKER 127
           HP+D QRI RALE+  ++G+++ +  +     Q P P I      K ++ P  R  L  R
Sbjct: 146 HPNDAQRIQRALEVYELTGETLSDLTRRHASEQLPFPLI------KFVMAPAMREVLHRR 199

Query: 128 IRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I  RF +ML SG +DE+  L  + +L L  P M+A+G R I   L+G  +Y+  +  G+ 
Sbjct: 200 IEARFRRMLASGFVDEVAELRGRGDLDLSKPSMRAVGYRQIWRHLEGSYDYNTMIACGVS 259

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT ++AKRQ TWL  +  A+W 
Sbjct: 260 ATRQFAKRQLTWLRRERGAEWF 281


>gi|88858903|ref|ZP_01133544.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas tunicata D2]
 gi|88819129|gb|EAR28943.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas tunicata D2]
          Length = 306

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q +++  +P++VGGT +YF+AL   +S +PE   AIR+++  + + YG   LH EL+ +D
Sbjct: 88  QLHQQGKIPVLVGGTMMYFKALLEGISPLPEADAAIRQQLEAEAQMYGWPHLHQELAKVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
                +I  +D QRI RALE+  ++G+++ E  K    P +P       I   +RS L +
Sbjct: 148 PEAGLRIKANDSQRINRALEVYRLTGKTMTELQKVKSEP-LPFNVLQFAIAPSDRSVLHQ 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  MLE G   E+++L +  +L   LP ++ +G R +   L G + YDE + RGI
Sbjct: 207 RIEKRFKIMLEQGFETEVKALYQRDDLHPALPSIRCVGYRQMWDYLDGLVEYDEMVFRGI 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            AT + AKRQ TWL       W+   + ++L
Sbjct: 267 AATRQLAKRQLTWLRSWPDVTWLESGAEENL 297


>gi|330432915|gb|AEC17974.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 310

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P+    +R +I ++ +Q G   LH +L+ +D   A++I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPQANAEVRAQIEKQAQQIGWQGLHQQLAVIDPQSAQRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+  ++G+S+ E  +Q   P +P       I   ER+ L +RI  RF 
Sbjct: 156 HPNDPQRINRALEVYYLTGKSLTELTEQKGEP-LPYRLLQFAIAPQERAVLHQRIELRFQ 214

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML  G   E+  L  + +L L+LP ++ +G R +   L+G+ ++ E   R I AT + A
Sbjct: 215 QMLAQGFQQEVEKLFARKDLHLNLPSIRCVGYRQMWEFLQGKYDFAEMEYRSICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|254498701|ref|ZP_05111418.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           drancourtii LLAP12]
 gi|254352081|gb|EET10899.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           drancourtii LLAP12]
          Length = 310

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 110/194 (56%), Gaps = 4/194 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
            K  +P++VGGT +YF AL   LS +PE   AIR ++ ++   +G  +LH +L  +D   
Sbjct: 90  NKGNIPLLVGGTMMYFNALQQGLSTLPEANPAIRLQLEDEAVVHGWDVLHQKLMQVDPKA 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERI 128
           A +IH  D QRI RALE+  ++G S+  F +Q      P        + P +R+ L ERI
Sbjct: 150 ATRIHAHDTQRIQRALEVYYLTGTSLSVFLEQQKKD--PDYQFVNFALFPTQRTWLHERI 207

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
             RF QML  G I+E+  L  K NL+++LP M+ +G R  +  L G+ +Y     +GI A
Sbjct: 208 ALRFEQMLAQGFIEEVEQLQEKWNLTMNLPSMRCVGYRQALEYLHGDYDYALMRDKGIAA 267

Query: 188 TNKYAKRQKTWLCH 201
           T + AKRQ TWL H
Sbjct: 268 TRQLAKRQLTWLRH 281


>gi|165919134|ref|ZP_02219220.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 334]
 gi|165917146|gb|EDR35750.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 334]
          Length = 290

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 115/200 (57%), Gaps = 13/200 (6%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+++D   A +I+
Sbjct: 97  PLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLNAIDPKSAARIN 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEF-----WKQAPNPFIPLESAHKIIILPE-RSALKERI 128
           P+D QRI RA E+   +GQ +  +     +K  P  FI L      I+ PE RS L +RI
Sbjct: 157 PNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINL------ILAPENRSWLHQRI 210

Query: 129 RRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QML++  ++E+R L  + +L+ DLP ++ +G R +   L GE +Y+    + I A
Sbjct: 211 EKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRHKAIAA 270

Query: 188 TNKYAKRQKTWLCHQFQADW 207
           T + AKRQ TWL     A W
Sbjct: 271 TRQLAKRQLTWLRRWPDAKW 290


>gi|86138425|ref|ZP_01056999.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           MED193]
 gi|85824950|gb|EAQ45151.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           MED193]
          Length = 288

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 114/198 (57%), Gaps = 9/198 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF  LT  L+ +P  P  IR        Q  S  L   L+ LD   A +I 
Sbjct: 97  PIIVGGTGLYFSTLTEGLAEIPPPPAEIR-------TQGDSLSLAVLLAQLDPQTAGRID 149

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +GQS+ E+    P P +P+E+ + +++   +  L+ RIRRRF Q
Sbjct: 150 LNNRARVQRAWEVLQSTGQSLAEWQDDTPAPILPIETCNSLVMHSPKDWLEPRIRRRFDQ 209

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E GA++E+ + M+      LP  KAIGV +++  + G +  +E  ++  IAT +YAKR
Sbjct: 210 MIEQGALEEVEA-MRDRYDPALPACKAIGVPELMGYITGSLTLEEAREQAAIATRRYAKR 268

Query: 195 QKTWLCHQFQADWIRISS 212
           Q++W   + +  W+RI S
Sbjct: 269 QRSWFRSRMK-HWVRIES 285


>gi|149202147|ref|ZP_01879120.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseovarius sp. TM1035]
 gi|149144245|gb|EDM32276.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Roseovarius sp. TM1035]
          Length = 295

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 108/190 (56%), Gaps = 4/190 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           II+GGTGLYF ALT  L+ +P  P A+R +    +   G   L   L++LD     +I  
Sbjct: 99  IIIGGTGLYFSALTEGLAEIPPTPPALRAEADHLMATQGLSTL---LAALDPTTLARIDT 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            +  R+ RA E++  +G  +  +    P P +PL +   ++I   +  L  RI RRF  M
Sbjct: 156 RNPMRVQRAWEVQRATGHGLAAWQDDTPPPLLPLTACTPLLITANKDWLNARIARRFDAM 215

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           L +GA+DE+R+ + +  +  LP MKAIG  ++IA L+GE+  D+  +   IAT +YAKRQ
Sbjct: 216 LAAGALDEVRANLPL-WNPALPSMKAIGAPELIAHLRGEMTLDQAREAATIATRQYAKRQ 274

Query: 196 KTWLCHQFQA 205
           +TW   + +A
Sbjct: 275 RTWFRARMRA 284


>gi|61213984|sp|Q5ZS23|MIAA_LEGPH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 313

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 115/197 (58%), Gaps = 10/197 (5%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 90  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALK 125
           A +IH  D QRI RALE+  ++G ++  +     + P+ +        + + PE RS L 
Sbjct: 150 AARIHAHDTQRIQRALEVYYLTGSTLSTYLTGPHERPDYYFV-----NLALFPEQRSWLH 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           ERI +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++G
Sbjct: 205 ERIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILQHLAGHYDYETMREKG 264

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL H
Sbjct: 265 IAATRQLAKRQLTWLRH 281


>gi|323491081|ref|ZP_08096272.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           brasiliensis LMG 20546]
 gi|323314661|gb|EGA67734.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           brasiliensis LMG 20546]
          Length = 316

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 116/202 (57%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR++I ++   +G   LH +L  +D + A +I
Sbjct: 98  IPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTHGWDKLHSQLREIDPVSAERI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P       I   ER+ L  RI  R+ 
Sbjct: 158 HPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPFRVKQFAIAPKERAELHRRIELRYE 216

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E+G  +E+R+L  + +L  DLP ++ +G R +   L G    DE + +G+ AT + A
Sbjct: 217 KMIEAGFEEEMRALYARKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEAIFKGVCATRQLA 276

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+   +I+
Sbjct: 277 KRQITWLRSWDNLTWLDSENIE 298


>gi|301156623|emb|CBW16094.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Haemophilus parainfluenzae T3T1]
          Length = 317

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I EK ++ G   LH EL  +D I A +I
Sbjct: 100 IPLLVGGTMLYYKALIEGLSPLPSADEKLRLEIEEKAQKLGWPALHQELQKIDPISAERI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+S+ E  +Q     +P +     I   +R+ L +RI +RF 
Sbjct: 160 NPNDSQRINRALEVFYLTGKSLTELTEQKGEE-LPYQFLQFAIAPEDRAVLHQRIEQRFH 218

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G  +E+  L  + +L  DLP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 219 KMIELGFQEEVEKLYQREDLHPDLPSIRCVGYRQMWEYLRGDYDHEEMVFRGICATRQLA 278

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 279 KRQITWL 285


>gi|261867645|ref|YP_003255567.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412977|gb|ACX82348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 314

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 115/187 (61%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I  K ++ G   LH EL+ +D I A++I
Sbjct: 99  IPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEAKAERIGWAALHQELNKIDPISAQRI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  +SG+++ E  +Q  +  +P E     I   +R  L +RI +RF 
Sbjct: 159 NPNDSQRINRALEVFYLSGKTLTELTEQKGDA-LPYEILQFAIAPEQRDLLHQRIEQRFH 217

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  +LP ++ +G R +   L+G+ ++DE + RGI AT + A
Sbjct: 218 KMIELGFQQEVEKLYRRADLHENLPSIRCVGYRQMWEYLRGDYSHDEMVFRGICATRQLA 277

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 278 KRQITWL 284


>gi|52842902|ref|YP_096701.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52630013|gb|AAU28754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 321

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 115/197 (58%), Gaps = 10/197 (5%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD + 
Sbjct: 98  KRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDPVT 157

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALK 125
           A +IH  D QRI RALE+  ++G ++  +     + P+ +        + + PE RS L 
Sbjct: 158 AARIHAHDTQRIQRALEVYYLTGSTLSTYLTGPHERPDYYFV-----NLALFPEQRSWLH 212

Query: 126 ERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           ERI +RF  ML  G I+E++ L  K  + ++LP M+ +G R I+  L G  +Y+   ++G
Sbjct: 213 ERIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILQHLAGHYDYETMREKG 272

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL H
Sbjct: 273 IAATRQLAKRQLTWLRH 289


>gi|289662672|ref|ZP_06484253.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 327

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 111/202 (54%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A+R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSQLPEADQAVRASIAAEAEQLGWAGLHAQLAGVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P ER+ L  RI  R 
Sbjct: 158 HATDPQRIQRALEVYRISGRPISYWQALPPGPRLPVR-VLKVVLAPRERAVLHTRIAHRL 216

Query: 133 TQMLES---GAIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML     G +  +R+L +M      LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQDFLGEVQRLRALPQMQAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|293392158|ref|ZP_06636492.1| hypothetical protein D7S_2331 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952692|gb|EFE02811.1| hypothetical protein D7S_2331 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 314

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I  K ++ G   LH EL  +D I A++I
Sbjct: 99  IPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEAKAERIGWAALHQELDKIDPISAQRI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  +SG+++ E  +Q  +  +P E     I   +R  L +RI +RF 
Sbjct: 159 NPNDSQRINRALEVFYLSGKTLTELTEQKGD-VLPYEILQFAIAPEQRDLLHQRIEQRFH 217

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  +LP ++ +G R +   L+G+ ++DE + RGI AT + A
Sbjct: 218 KMIELGFQQEVEKLYRRADLHENLPSIRCVGYRQMWEYLRGDYSHDEMVFRGICATRQLA 277

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 278 KRQITWL 284


>gi|145642150|ref|ZP_01797719.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
 gi|145273141|gb|EDK13018.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.4-21]
          Length = 311

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 114/187 (60%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH EL+ +D I A +I
Sbjct: 94  IPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +PSD QRI RALE+  ++G+S+ E  ++     +P +     I   +R  L ERI +RF 
Sbjct: 154 NPSDSQRINRALEVFYITGKSLTELTEEK-GEALPYDFVQFAIAPQDRHILHERIEQRFH 212

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L++ LP ++ +G R +   L+G+ +++E + RGI AT + A
Sbjct: 213 KMIELGFQAEVEKLYARGDLNIHLPSIRCVGYRQMWEYLQGDYDHEEMIFRGICATRQLA 272

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 273 KRQLTWL 279


>gi|21242483|ref|NP_642065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|25008755|sp|Q8PLQ5|MIAA_XANAC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21107931|gb|AAM36601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 327

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A+R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSQLPEADQAVRASIAAEAQQIGWAGLHAQLARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P ER+ L  RI  R 
Sbjct: 158 HATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVR-VLKVVLAPRERAVLHARIAHRL 216

Query: 133 TQMLESGAIDEIR------SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML    + E+R       L  +   LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQDFLTEVRRLRALPQLQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|254456127|ref|ZP_05069556.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083129|gb|EDZ60555.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 303

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 118/201 (58%), Gaps = 2/201 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K++ +PI+VGGTGLYF++LT  L  +P IP   R KIR+  K  G    + +L  LD   
Sbjct: 92  KRKKVPILVGGTGLYFKSLTDGLVKIPNIPIQFRNKIRKLHKDLGQKKFYQKLLKLDPNY 151

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
            + I+P+D  R  RA E+KL + +S+ E+++   + F+  E  +KI I   R  L +RI 
Sbjct: 152 KKNINPTDAHRSIRAYEVKLFTKKSLHEWFESTKSDFMD-EEFYKIYIDYPRQDLIKRIA 210

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R  +ML+SGAI E++  +K+N+  D  + KAIG+ +I   L+ +    +  ++  I T 
Sbjct: 211 TRTDEMLKSGAIPEVKRFIKLNVKKDKSVNKAIGIGEIKEFLRNKKKLSDISEKISIKTR 270

Query: 190 KYAKRQKTWLCHQFQADWIRI 210
           +YAKRQ TW     ++ W+++
Sbjct: 271 QYAKRQSTWARGNMKS-WLKL 290


>gi|190151317|ref|YP_001969842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|189916448|gb|ACE62700.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 228

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 10  IPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 69

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 70  NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 128

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 129 KMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 188

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 189 KRQITWL 195


>gi|126729703|ref|ZP_01745516.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sagittula
           stellata E-37]
 gi|126709822|gb|EBA08875.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sagittula
           stellata E-37]
          Length = 301

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 108/200 (54%), Gaps = 5/200 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PII GGTGLYF ALT  L+ +P++P A+R +  +     G   L   +  LD+  A  I 
Sbjct: 104 PIITGGTGLYFTALTEGLAEIPDVPAAVRAEADQIRTTRGLSAL---VEQLDAPTAAAID 160

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ I  +  + P P +    A   +    +  L  RI RRF Q
Sbjct: 161 LRNPMRVQRAWEVLHTTGKGITAWQAETPPPLLARAEAQPFLFDAPKEWLTPRIERRFRQ 220

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML  GA+DE R  M    S DLP  KAIG  ++IA L+G++  D  ++R  I T ++AKR
Sbjct: 221 MLRDGALDEARENMG-TWSPDLPSAKAIGAAELIAHLRGQMTLDAAIERATILTRRFAKR 279

Query: 195 QKTWLCHQFQADWIRISSID 214
           Q+TW   +  +DW R++  D
Sbjct: 280 QRTWFKSRM-SDWPRVTPED 298


>gi|329895359|ref|ZP_08270984.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC3088]
 gi|328922372|gb|EGG29716.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC3088]
          Length = 313

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 108/189 (57%), Gaps = 4/189 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGT LYF+A    LS MPE    +R  I  +    G   LH +L ++D I A  IH
Sbjct: 81  PILVGGTMLYFKAFLEGLSPMPESEPNMRAAIETEADLLGWPALHAQLEAVDPITAANIH 140

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE--SAHKIIILP-ERSALKERIRRR 131
           P+   RI RALE+  +SG  + ++ +Q+     P +     +  + P +R+ L ERI RR
Sbjct: 141 PNHSSRITRALEVYRLSGTPLSQWQQQSQERVAPTQQYCVSQFALAPFDRAVLHERIERR 200

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  ML+ G I+E+++L  + +L  DLP ++A+G R +   L GE +    + RG+ AT +
Sbjct: 201 FELMLDQGFIEEVKALRARGDLHADLPAIRAVGYRQVWQYLGGEFDLQACIDRGVAATRQ 260

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 261 LAKRQLTWL 269


>gi|261380283|ref|ZP_05984856.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           subflava NJ9703]
 gi|284796795|gb|EFC52142.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           subflava NJ9703]
          Length = 313

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YF ALT  L+ +P    A+R +++ + K++G   L+  L  +D I A ++ 
Sbjct: 96  PLIVGGTMMYFHALTEGLNDLPGADAAVRAQLQAEKKEHGLAGLYRRLQEVDPITAGRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            +D QRI RALE+ L++G+ + E + +       L+     +I  +R  L ++I +RF  
Sbjct: 156 ANDSQRIERALEVYLLTGRPLSEHFTEQKQAASLLDLCTVALIPEDRHLLHQQIEKRFLS 215

Query: 135 MLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           MLE G +DEI +L +    L  D+P M+ +G R     L+GE +YD  +++GIIAT + A
Sbjct: 216 MLEHGFLDEIHALRRDYPQLHADMPSMRCVGYRQAWDYLEGETDYDTFVEKGIIATRQLA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQLTWL 282


>gi|294011451|ref|YP_003544911.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           japonicum UT26S]
 gi|292674781|dbj|BAI96299.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           japonicum UT26S]
          Length = 314

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 114/199 (57%), Gaps = 4/199 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +K   LPI+VGGTGLY R L   ++ +P+I  AIR  +R           HD L+  D  
Sbjct: 99  HKAGRLPILVGGTGLYLRTLLDGIAPVPDIDPAIRAAVRALAVAD----AHDALAKEDPE 154

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A ++ P+D  R+ARALE+   +G+ + ++ +          +   +I+LP R  L  R 
Sbjct: 155 AAARLAPADTTRVARALEVVRSTGKPLAQWQQHKSGGIADGIALSPLILLPPRDWLIARC 214

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF QML+ GA  E+ +L+  NLS DLP+M+AIGV +I A L G+I+ D  L+RG IAT
Sbjct: 215 DLRFGQMLDGGAAAEVEALLARNLSPDLPVMRAIGVPEIAAWLAGQIDRDTMLKRGRIAT 274

Query: 189 NKYAKRQKTWLCHQFQADW 207
            +YAKRQ TW   Q   +W
Sbjct: 275 RQYAKRQYTWFSRQPPPEW 293


>gi|120555681|ref|YP_960032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           aquaeolei VT8]
 gi|239977409|sp|A1U4C6|MIAA_MARAV RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120325530|gb|ABM19845.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           aquaeolei VT8]
          Length = 347

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 117/220 (53%), Gaps = 25/220 (11%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   +S +P    A+R +I  + ++ G   LH+EL+  D   AR I
Sbjct: 104 IPLLVGGTMMYFKALLHGMSNLPSANQALRAEIEREAERDGWGALHEELAEKDPDAARLI 163

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-------QAPNPFI-----------------PL 109
           HP++ QR+ RA+E+  ++ + I  FW+       Q P   I                 P 
Sbjct: 164 HPNNRQRLMRAIEVIRLTDKPISSFWQSESGTSGQHPQSGIEDYTYFTSWQADESAGLPY 223

Query: 110 ESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDII 168
                 +   ERS L  RI++RF  MLE+G +DE+R+LM + +LS DLP M+ +G R   
Sbjct: 224 TVFQFALAPAERSVLHSRIQKRFLAMLEAGFLDEVRALMARGDLSPDLPSMRCVGYRQAW 283

Query: 169 ALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWI 208
             L G  +YD  + +G+ AT + AKRQ TWL       W+
Sbjct: 284 DYLSGNEDYDSFVAKGVAATRQLAKRQLTWLRKWRDVHWL 323


>gi|170723844|ref|YP_001751532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida W619]
 gi|229621759|sp|B1JAD5|MIAA_PSEPW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169761847|gb|ACA75163.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida W619]
          Length = 323

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 119/214 (55%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R  +  + +  G   LH +L+ +D   A +I
Sbjct: 96  VPLLVGGTMLYYKALIDGLADMPPADAAVRAALEAQAQALGLTELHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 156 HPNDPQRLIRALEVFQVSGESMTAHRQRQFAESSGADAGAGGHLPYTVASLAIAPTDRHI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 216 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRGWSDVHWLDSLACDNL 309


>gi|329297958|ref|ZP_08255294.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Plautia stali
           symbiont]
          Length = 298

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 111/191 (58%), Gaps = 2/191 (1%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           +K  +P++VGGT LYF+AL   LS +P     +R++I +   + G   LH +L  +D + 
Sbjct: 82  QKGKIPLLVGGTMLYFKALQEGLSPLPSADPEVRQRIEQMAAEKGWEALHRQLCEIDPVA 141

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
             +IHP+D QR++RALE+  +SG+++ E         +P +     I    R  L + I 
Sbjct: 142 GSRIHPNDPQRLSRALEVFFISGKTLTEL-TTTTGEALPYDVYQFAIAPASRELLHQCIA 200

Query: 130 RRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            R+ QML SG   E R+L  + +L  D+P ++ +G R + + L GEI+YDE + RGI AT
Sbjct: 201 LRYDQMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDYDEMVYRGICAT 260

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 261 RQLAKRQMTWL 271


>gi|6225673|sp|O30762|MIAA_PSEPU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|2353324|gb|AAB69443.1| tRNA:isopentenyladenine transferase [Pseudomonas putida]
          Length = 322

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 121/214 (56%), Gaps = 12/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALIDGLADMP-ADAAVRAELERQAEALGLAELHRQLAEVDPESAARI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  VSG+S+    ++               +P   A   I   +R  
Sbjct: 155 HPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTVASLAIAPTDRHI 214

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF+QMLE G +DE+RSL  + +L   LP ++A+G R +   L G++  +E  +
Sbjct: 215 LHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKLTENEMRE 274

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 275 RGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 308


>gi|331005122|ref|ZP_08328525.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC1989]
 gi|330421091|gb|EGG95354.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC1989]
          Length = 323

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 114/193 (59%), Gaps = 8/193 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF AL   L+ MP    A R  I E+    G  +LH+EL+++D   A QIH
Sbjct: 98  PVLVGGTMMYFNALLKGLADMPATDLATRAAIEEEALVKGWSLLHEELAAVDPESAAQIH 157

Query: 75  PSDGQRIARALEIKLVSGQSI----IEFWKQAP--NPFIPLESAHKIIILP-ERSALKER 127
           P+  QRIARAL +  +SG+ +     E  +Q+P    F       +  ++P ER+ L +R
Sbjct: 158 PNHSQRIARALAVYRMSGKPMSVYRAEQLQQSPVDTHFSERYDVTQFALIPQERALLHQR 217

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I RR+  MLE G  +E+  L  + +LSLDLP M+A+G R +   +    +YDE +++G+ 
Sbjct: 218 IARRYEMMLEDGFEEEVTQLYQRGDLSLDLPSMRAVGYRQMWEYINKVYSYDEMIEKGLA 277

Query: 187 ATNKYAKRQKTWL 199
           AT + AKRQ TWL
Sbjct: 278 ATRQLAKRQLTWL 290


>gi|322515246|ref|ZP_08068244.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           ureae ATCC 25976]
 gi|322118751|gb|EFX90957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           ureae ATCC 25976]
          Length = 314

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P    AIR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIEAKAEQIGWSSLHRELLTIDPIAGKRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R  L  RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRQVLHHRIEQRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 215 KMMELGFQQEVEKLHARGDLHKDLPSIRCVGYRQMWEHLDGDISLDEAVYKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|307246898|ref|ZP_07528963.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307249034|ref|ZP_07531042.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307253650|ref|ZP_07535517.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307255880|ref|ZP_07537681.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260333|ref|ZP_07542040.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307264671|ref|ZP_07546251.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|239977342|sp|B3H330|MIAA_ACTP7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|306852183|gb|EFM84423.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306854492|gb|EFM86687.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858886|gb|EFM90932.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861148|gb|EFM93141.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865584|gb|EFM97465.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869983|gb|EFN01747.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 304

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 86  IPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 146 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 205 KMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 264

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 265 KRQITWL 271


>gi|165977403|ref|YP_001652996.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250342|ref|ZP_07336541.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251735|ref|ZP_07337906.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|238687529|sp|B0BTY5|MIAA_ACTPJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|165877504|gb|ABY70552.1| tRNA delta-2-isopentylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302649165|gb|EFL79350.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650812|gb|EFL80969.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 314

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 96  IPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 215 KMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|73427060|gb|AAZ76109.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 205

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 107/177 (60%), Gaps = 4/177 (2%)

Query: 25  FRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARA 84
           F+AL   LS +P     +R +I ++  + G   LH +L  +D + A +IHP+D QR++RA
Sbjct: 1   FKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQLQEIDPVAAARIHPNDPQRLSRA 60

Query: 85  LEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRFTQMLESGAIDE 143
           LE+  +SG+++ E   Q     +P +  H+  I P  R  L +RI  RF QML SG   E
Sbjct: 61  LEVFFISGKTLTEL-TQTSGDALPYQ-VHQFAIAPASRELLHQRIELRFHQMLASGFEAE 118

Query: 144 IRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWL 199
           +R+L  + +L  DLP ++ +G R + + ++GEI+YDE + RG+ AT + AKRQ TWL
Sbjct: 119 VRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEMVYRGVCATRQLAKRQMTWL 175


>gi|88704497|ref|ZP_01102211.1| tRNA isopentenyltransferase [Congregibacter litoralis KT71]
 gi|88701548|gb|EAQ98653.1| tRNA isopentenyltransferase [Congregibacter litoralis KT71]
          Length = 313

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 114/196 (58%), Gaps = 4/196 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGT LY+ AL    + MP     +R +I     + G   +H EL+ +D+  A +IH
Sbjct: 81  PILVGGTMLYYSALLQGFAAMPPADPDVRAEIAATAAKEGWPAVHRELARVDAEAAARIH 140

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRFT 133
           P+  QR++RALE+  +SG+++ E  +Q  +     E    + I P ER  L ERI  RF 
Sbjct: 141 PNHSQRLSRALEVYRLSGKTMTELHRQTRDSSS--EQVLAVAIAPAERRVLHERIATRFA 198

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QM+ +G ++E+R L  + +L  DLP ++A+G R + A L+GE + +E  + G++AT + A
Sbjct: 199 QMMAAGFLEEVRGLRERGDLHRDLPAIRAVGYRQLWAHLEGECSVEEAQELGVVATRQLA 258

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL       WI
Sbjct: 259 KRQFTWLRKWPDLQWI 274


>gi|330501622|ref|YP_004378491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina NK-01]
 gi|328915908|gb|AEB56739.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina NK-01]
          Length = 323

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 123/214 (57%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP    AIR ++  +    G  +LH EL+++D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPSADPAIRAELEARALAEGWDVLHRELAAVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ--APNPF--------IPLESAHKIIILPERSA 123
           H +D QR+ RALE+  VSG S+ E  ++  A NP         +P   A   I   +R  
Sbjct: 156 HRNDPQRLTRALEVYRVSGLSMTEHRRRQAAGNPDTGTSGGGQLPYTVAQLAIAPAQRQI 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF  MLE G ++E+ +L  + +L   LP ++A+G R +   L GE++ ++ ++
Sbjct: 216 LHDRIAQRFRAMLEQGFVEEVEALRSRSDLHAGLPSIRAVGYRQVWEYLDGELSREQMVE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RG+IAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGVIATRQLAKRQFTWLRGWDGLHWLDSLACDNL 309


>gi|329849435|ref|ZP_08264281.1| tRNA delta2-isopentenylpyrophosphate transferase [Asticcacaulis
           biprosthecum C19]
 gi|328841346|gb|EGF90916.1| tRNA delta2-isopentenylpyrophosphate transferase [Asticcacaulis
           biprosthecum C19]
          Length = 290

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 100/188 (53%), Gaps = 1/188 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
            IVGGTGLYF +L   L+ +PEI    R   R+     G     D L   D    R+I P
Sbjct: 99  CIVGGTGLYFNSLVFGLAEIPEIGELARTTARDTYDVLGEAAFRDLLRQHDPKAERRIFP 158

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QR+ARA E+ L +G S+ + W+    P +P  S    I+ P+R  L  R   R   M
Sbjct: 159 NDRQRLARAYEVFLHTGTSLTD-WQNKTKPALPKHSYKLEILYPDREDLYARCDARLQIM 217

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           L+ GA+DE+R +M   L  D  I++ +G+R+  A L+GE+  D  L +    T  YAKRQ
Sbjct: 218 LDQGALDEVRDVMAQGLRDDWAIIRVLGLREFSAHLRGEMTLDAALAQARQMTRNYAKRQ 277

Query: 196 KTWLCHQF 203
            TW  +QF
Sbjct: 278 STWFRNQF 285


>gi|307258065|ref|ZP_07539817.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307262463|ref|ZP_07544108.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306863428|gb|EFM95359.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867840|gb|EFM99671.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 304

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 86  IPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 146 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 205 KMMELGFQQEVEKLRARGDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 264

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 265 KRQITWL 271


>gi|163793358|ref|ZP_02187333.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium BAL199]
 gi|159181160|gb|EDP65675.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium BAL199]
          Length = 329

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 107/192 (55%), Gaps = 3/192 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+ GGTGLY RAL   ++ +P +P A+      +    G      EL +LD I A ++ P
Sbjct: 112 IVCGGTGLYLRALLDGIADIPAVPDAVARAAAARYAAMGGDAFRAELHALDPITADRLSP 171

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRFTQ 134
            D QR+ RA  +   +G+ +  +   A  P  P     + ++L P      + + RRF  
Sbjct: 172 GDAQRLQRAWAVATGTGRPLSAWQADAALP--PENMTFRTVLLFPPSPVSADAVERRFRT 229

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E+GAI E+R+L+   L   LP+MKA+GV  I A L G I+ DE ++  + AT +YAKR
Sbjct: 230 MVETGAIVEVRNLLARALDPALPVMKALGVPQITAFLDGRISLDEAVRTSVTATRQYAKR 289

Query: 195 QKTWLCHQFQAD 206
           Q+TW  HQF++D
Sbjct: 290 QRTWFRHQFRSD 301


>gi|260433962|ref|ZP_05787933.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417790|gb|EEX11049.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 317

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 110/193 (56%), Gaps = 9/193 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF  LT  ++ +P  P  IR       K   +  L + L+ +D     +I 
Sbjct: 126 PIIVGGTGLYFTTLTEGMADIPATPPEIR-------KTADAIPLPELLADIDPKTRSRID 178

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E++  +G+++ ++    P P +PL+ A  I++ P+R  L +RI  RF  
Sbjct: 179 TRNRARVQRAWEVERATGRTLADWQDDTPPPVLPLDQAFPIVVTPDRDWLIQRINSRFDL 238

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML++GA+DE+ + M+      LP  KAIGV +++A ++G +  DE  ++  IAT +YAKR
Sbjct: 239 MLQTGALDEV-AAMRDRYDPGLPSCKAIGVPELMAYIEGRMTLDEAREKATIATRQYAKR 297

Query: 195 QKTWLCHQFQADW 207
           Q+TW C      W
Sbjct: 298 QRTW-CRARMKQW 309


>gi|94676728|ref|YP_589011.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|239977173|sp|Q1LSQ3|MIAA_BAUCH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|94219878|gb|ABF14037.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 309

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 114/204 (55%), Gaps = 9/204 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF++L   LS +P     IR  I+ + K  G   LH +L  +D + A +I
Sbjct: 94  IPLLVGGTMLYFKSLLHGLSPLPPANVEIRTLIQREAKAVGWAALHQKLKKIDLVAANRI 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D  R+ RALE+ LVSG ++ E  +++ N        ++  I+P  RS L +RI RRF
Sbjct: 154 HPNDSYRLLRALEVFLVSGNTLTEMIQKSGNAL--KYQVYQFAIMPVNRSLLHDRITRRF 211

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML +G   E+  L  + +L+ ++  ++ +G R + + L GE NY E + R I AT K 
Sbjct: 212 HQMLANGFEYEVSQLFARTDLNTNMSSIRCVGYRQMWSYLAGETNYHEMIFRAISATRKL 271

Query: 192 AKRQKTWLCHQFQADWIRISSIDD 215
           AK Q TWL       W  I  +D 
Sbjct: 272 AKHQITWL-----KSWQNICWLDS 290


>gi|294665637|ref|ZP_06730914.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292604583|gb|EFF47957.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 327

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   ++R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLDGLSHLPEADQSVRASIAAEAQQIGWAGLHAQLAGVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P  R+ L ERI  R 
Sbjct: 158 HATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVR-VLKVVLAPRARAVLHERIAHRL 216

Query: 133 TQMLESGAIDEIRSL------MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML    + E+R L        +   LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQDFLAEVRRLRALPQIQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|294626634|ref|ZP_06705231.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292599054|gb|EFF43194.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 327

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   ++R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLDGLSHLPEADQSVRASIAAEAQQIGWAGLHAQLAGVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P ER+ L  RI  R 
Sbjct: 158 HATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVR-VLKVVLAPRERAVLHARIAHRL 216

Query: 133 TQMLESGAIDEIRSL------MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML    + E+R L        +   LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQDFLAEVRRLRALPQIQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|194365248|ref|YP_002027858.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia R551-3]
 gi|238693480|sp|B4SRA4|MIAA_STRM5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194348052|gb|ACF51175.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia R551-3]
          Length = 317

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 110/201 (54%), Gaps = 6/201 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGTGLYFRAL   LS MPE   A+R  +  +  + G   LH EL+ +D   A +I
Sbjct: 98  MPILAGGTGLYFRALLQGLSPMPEADPAMRAALAAEAAERGWAALHAELAQIDPAAATRI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H +D QRI RALE+  ++G  I E+ ++     +P+ +   I+   +R+ L +RI  RF 
Sbjct: 158 HATDPQRIQRALEVYRLTGTPITEWQRRPGVAPLPVRTLKLILAPHDRAVLHQRIEARFD 217

Query: 134 QMLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            ML  G +DE+R+L  M         LDLP ++A+G R     L GE +      + I A
Sbjct: 218 AMLAQGFLDEVRALRAMPEMAAVEAPLDLPAVRAVGYRQAWEYLDGEGDAARFRDKAIFA 277

Query: 188 TNKYAKRQKTWLCHQFQADWI 208
           T + AKRQ TWL  +  A W 
Sbjct: 278 TRQLAKRQLTWLRGELDARWF 298


>gi|294084283|ref|YP_003551041.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663856|gb|ADE38957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 310

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 108/191 (56%), Gaps = 1/191 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PII+GGTG+Y  A    L+ +P++P  I +       + G       L++LD + A +++
Sbjct: 95  PIIIGGTGMYLNAGLYGLASIPDVPRNIHDNAVTLHAEIGGAGFRQALAALDPVTAERLY 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             D QR+ RA+ +   +G+ I   W+Q P+       A  I +LP R  L +RI  RF  
Sbjct: 155 DGDTQRLIRAMGVVQATGRPI-SAWQQDPHEGAFEGVATTIKLLPARDILYQRINTRFDM 213

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E+GA+DE++ L+  NL   LP+MKA+GVR + A L G++   + +++    +  YAKR
Sbjct: 214 MIEAGALDEVQKLVARNLDPGLPVMKALGVRQLSAYLAGDVAKADAVRQAQQDSRHYAKR 273

Query: 195 QKTWLCHQFQA 205
           Q TWL + F A
Sbjct: 274 QMTWLRNNFNA 284


>gi|254516808|ref|ZP_05128866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium NOR5-3]
 gi|219674313|gb|EED30681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium NOR5-3]
          Length = 315

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 115/200 (57%), Gaps = 2/200 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGT LY+ AL   L+ MP    A+R  I     + G   +H EL+ +D   A +IH
Sbjct: 81  PILVGGTMLYYNALLKGLAAMPGAHPAVRNDIASMAARDGWPAVHRELARVDPESAARIH 140

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRFT 133
           P+  QR++RALE+  V+G+++ +  +Q     + +  A  I I P +R  L  RI  RF 
Sbjct: 141 PNHSQRLSRALEVYRVTGKTLTQLHQQDQTSALNIADALAIAIAPLQREVLHARIEARFR 200

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+  G +DE+R L  + +L  DLP ++A+G R + + L+GE + +E  +RG+IAT + A
Sbjct: 201 EMMRCGFLDEVRCLKERGDLHADLPAIRAVGYRQLWSHLEGECSLEEAQERGVIATRQLA 260

Query: 193 KRQKTWLCHQFQADWIRISS 212
           KRQ TWL       WI   +
Sbjct: 261 KRQFTWLRKWPDLQWIHTDA 280


>gi|260913833|ref|ZP_05920307.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           dagmatis ATCC 43325]
 gi|260631920|gb|EEX50097.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           dagmatis ATCC 43325]
          Length = 315

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 112/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I EK  + G   LH EL+ +D I A++I
Sbjct: 96  IPLLVGGTMLYYKALIEGLSPLPSANEKVRSEIEEKAAKLGWATLHQELAMIDPISAQRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           + +D QRI RALE+  ++G+S+ E  +Q     +P E     I   +R  L +RI  RF 
Sbjct: 156 NQNDSQRINRALEVFYLTGKSLTELTEQK-GESLPYEIIQFAITPKDRYVLHDRIALRFH 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L+G+ +Y+E + RGI AT + A
Sbjct: 215 KMIELGFQQEVEKLYQRPDLHPDLPSIRCVGYRQMWEYLRGDYDYEEMIFRGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|119776158|ref|YP_928898.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           amazonensis SB2B]
 gi|166216986|sp|A1SA22|MIAA_SHEAM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|119768658|gb|ABM01229.1| tRNA isopentenyltransferase [Shewanella amazonensis SB2B]
          Length = 306

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 112/195 (57%), Gaps = 2/195 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+ L   LS +P    A+R +I  +++  G   LHDEL ++D + A +IH
Sbjct: 97  PLLVGGTMMYFKTLLDGLSPLPSADDAVRAQIAAEVEARGWQALHDELRNIDPVSAERIH 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RA+E+  +SG+++ E  K      +P       I   +R+ L   I +RF Q
Sbjct: 157 PNDPQRLSRAIEVYRISGKTLTELTKIKAES-LPYHMVQFAIAPQDRTVLHGLIAKRFQQ 215

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML  G I E+ +L  + +L L+LP M+ +G R     L GE ++   +++ + AT + AK
Sbjct: 216 MLAEGFIGEVETLKARGDLHLELPSMRCVGYRQAWQYLDGEFDHATMVEKAVAATRQLAK 275

Query: 194 RQKTWLCHQFQADWI 208
           RQ TWL    +  W+
Sbjct: 276 RQLTWLRGWPELHWL 290


>gi|89900327|ref|YP_522798.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodoferax
           ferrireducens T118]
 gi|122479504|sp|Q21Y86|MIAA_RHOFD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|89345064|gb|ABD69267.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodoferax
           ferrireducens T118]
          Length = 350

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 108/202 (53%), Gaps = 16/202 (7%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+AL   L  MP+   A R  I  +  + G   LH  L+ +D + A+++
Sbjct: 111 LPLLVGGTMLYFKALLEGLDPMPKADPATRALIATEAAEQGWPALHAALAEVDPVSAKRL 170

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPE---------- 120
           HP+D QRIARALE+  +SGQ +  F      A N  +      K + +PE          
Sbjct: 171 HPADSQRIARALEVYRLSGQPLSSFQTTKLIATNEGVTGARGQKCLNIPENDRCLISLEP 230

Query: 121 --RSALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
             R+ L +RI  RF  ML +G IDE+R+L  + +L  DLP M+ +G R     L G    
Sbjct: 231 QNRAWLHQRIAERFDAMLAAGFIDEVRALRARGDLQADLPAMRCVGYRQAWQALDGLWPM 290

Query: 178 DETLQRGIIATNKYAKRQKTWL 199
            E   +GI AT + AKRQ TWL
Sbjct: 291 SELRDKGICATRQLAKRQLTWL 312


>gi|114564473|ref|YP_751987.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           frigidimarina NCIMB 400]
 gi|122298758|sp|Q07XW6|MIAA_SHEFN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114335766|gb|ABI73148.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           frigidimarina NCIMB 400]
          Length = 296

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 108/186 (58%), Gaps = 2/186 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT +YF+AL   LS +P    AIR++I  + +  G   LH EL ++D +   +IH
Sbjct: 87  PLLVGGTMMYFKALLEGLSPLPSADEAIRQQILAQAQTEGWEALHQELCNIDPVAGERIH 146

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+++ E   Q  +  +P +     I   +R  L E I +RF  
Sbjct: 147 PNDPQRLSRALEVYRISGKTMTEL-TQTKSAALPYDVVQFAIAPNDRKVLHELIAKRFNI 205

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE G I+E+  L  + +L L+LP M+ +G R     L  E ++   +++   AT + AK
Sbjct: 206 MLEQGFIEEVARLKARDDLHLELPSMRCVGYRQCWQYLDNEFDHATMVEKATAATRQLAK 265

Query: 194 RQKTWL 199
           RQ TWL
Sbjct: 266 RQLTWL 271


>gi|148244845|ref|YP_001219539.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Vesicomyosocius okutanii HA]
 gi|239977473|sp|A5CW57|MIAA_VESOH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|146326672|dbj|BAF61815.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 305

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 116/194 (59%), Gaps = 7/194 (3%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + K  LPI+VGGT  YF  L   LS +PE  T  +EK  + L+  G+  LH +L  +D  
Sbjct: 93  FAKNELPILVGGTSFYFHVLEHGLSNLPESSTKSKEKFNQLLRNKGTIKLHQDLKKIDPQ 152

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI--PLESAHKIIILPERSALKE 126
            A +IHP+D QRI RALE+  +SG++I E  +    P I  P++   KII++P+R+ L  
Sbjct: 153 AANKIHPNDSQRIIRALEVFNLSGKTISEL-QGNKKPIIDYPIK---KIILMPKRNELHT 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +I  RF  M+++G ++E++ L +  NL  +L  ++ +G R     L G+I+  E +++ I
Sbjct: 209 KIETRFLLMMKNGFLNEVQHLKQNPNLHQNLSSIRCVGYRQAWQYLNGKIDKTEMIEKII 268

Query: 186 IATNKYAKRQKTWL 199
           IAT +  KRQ TWL
Sbjct: 269 IATRQLCKRQITWL 282


>gi|53729028|ref|ZP_00134307.2| COG0324: tRNA delta(2)-isopentenylpyrophosphate transferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
          Length = 314

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 96  IPLLAGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 156 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 214

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 215 KMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 274

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 275 KRQITWL 281


>gi|126209414|ref|YP_001054639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae L20]
 gi|307251233|ref|ZP_07533154.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|239977160|sp|A3N3P8|MIAA_ACTP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|126098206|gb|ABN75034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|306856749|gb|EFM88884.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 304

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D I  ++I
Sbjct: 86  IPLLAGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAIDPIAGKRI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ E   Q  +  +P       I   +R+ L +RI +RF 
Sbjct: 146 NPNDSQRINRALEVFYITGKTMTELTAQQGDS-LPYNVLQFAIAPQDRAVLHQRIEQRFY 204

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L  + +L  DLP ++ +G R +   L G+I+ DE + +GI AT + A
Sbjct: 205 KMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGICATRQLA 264

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 265 KRQITWL 271


>gi|78047323|ref|YP_363498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|123585339|sp|Q3BUR5|MIAA_XANC5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78035753|emb|CAJ23444.1| tRNA isopentenyltransferase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 327

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE    +R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSHLPEADQTVRASIAAEAQQIGWAGLHAQLARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P ER+ L  RI  R 
Sbjct: 158 HATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVR-VLKVVLAPRERAVLHARIAHRL 216

Query: 133 TQMLES---GAIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML     G +  +R+L +M      LDLP ++A+G R     L G     E   + I 
Sbjct: 217 DAMLAQDFLGEVQRLRALPQMQAVAAPLDLPAVRAVGYRQAWQYLDGAGGLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|294789559|ref|ZP_06754794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Simonsiella
           muelleri ATCC 29453]
 gi|294482496|gb|EFG30188.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Simonsiella
           muelleri ATCC 29453]
          Length = 321

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +YF ALT  L+ +P+  +A R++++   ++YG   L+++L   D I A+++
Sbjct: 96  LPLIVGGTMMYFHALTHGLNDLPQADSATRQQLQTDKRKYGLSHLYNQLQKYDPITAQRL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIE-FWKQAPNPFIPLESAHKIIILPE-RSALKERIRRR 131
             +D QRI RALE+ L++G+ + + F +Q   P + L +   + ++PE R+ L  +I +R
Sbjct: 156 ESNDSQRIERALEVFLLTGKPLSQHFAEQKSAPALDLFT---LTLIPENRTQLHNQIAQR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  +L++G +DE++ L +    L  +LP M+ +G R     L+   NY+E +++G IAT 
Sbjct: 213 FDLILKNGFLDEMKYLREKYPQLHENLPSMRCVGYRQAWDFLENRFNYNELIEKGTIATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|254787457|ref|YP_003074886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Teredinibacter
           turnerae T7901]
 gi|237685337|gb|ACR12601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Teredinibacter
           turnerae T7901]
          Length = 323

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS MP    A+R +I ++    G   +H  L  +D   AR++H
Sbjct: 100 PLLVGGTMLYFKALLEGLSDMPASQPAVRAQIEQEALAIGWPGMHQHLMDIDPETARELH 159

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRFT 133
           P+   RI+RALE+  +SG+++  F   + +  +      ++ + P +R+ L +RI  RF 
Sbjct: 160 PNHSHRISRALEVYRISGKTMSHFRANSGSGLLDSYQWVQLAVAPRDRAVLHQRIATRFE 219

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML++G + E+ +L +  +L  DLP ++A+G R +   L GEI+  E + RG+ AT + A
Sbjct: 220 NMLDAGLLGEVEALYRRGDLHPDLPAIRAVGYRQVWEYLSGEIDRSEMVARGVAATRQLA 279

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 280 KRQLTWL 286


>gi|39997098|ref|NP_953049.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           sulfurreducens PCA]
 gi|61214210|sp|Q74BP1|MIAA_GEOSL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|39983988|gb|AAR35376.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           sulfurreducens PCA]
 gi|298506111|gb|ADI84834.1| tRNA (N6-dimethylallyl-A37)-dimethylallyltransferase [Geobacter
           sulfurreducens KN400]
          Length = 311

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 105/197 (53%), Gaps = 7/197 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGTGLY + L G L+  P     IR ++ E  +  G+  LHD L+ +D   A ++H
Sbjct: 101 PILVGGTGLYIKTLIGGLAPSPGADDTIRAELEEDARSEGAAALHDRLAQVDPAAAARLH 160

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPERSALKERIRRR 131
           P+D  RI RALE+ L++G+ + EF ++   A  P+  L    K+ I  ER  L  RI  R
Sbjct: 161 PNDRVRIVRALEVFLMTGKPLSEFQEEHRFADEPYDCL----KLGISVERDDLYRRINER 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             +M   G ++E+  L+    S DL  M AIG +++ A L G  + DE  +     T +Y
Sbjct: 217 VNRMFAEGFVEEVSGLLNAGYSPDLKAMGAIGYKEVCAYLAGTCSLDEARELVQRNTRRY 276

Query: 192 AKRQKTWLCHQFQADWI 208
           AKRQ TW        W+
Sbjct: 277 AKRQLTWFRKDPAIKWV 293


>gi|83648043|ref|YP_436478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hahella
           chejuensis KCTC 2396]
 gi|123531241|sp|Q2SBC1|MIAA2_HAHCH RecName: Full=tRNA dimethylallyltransferase 2; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 2; Short=DMAPP:tRNA
           dimethylallyltransferase 2; Short=DMATase 2; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           2; Short=IPP transferase 2; Short=IPPT 2; Short=IPTase 2
 gi|83636086|gb|ABC32053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hahella
           chejuensis KCTC 2396]
          Length = 332

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/216 (33%), Positives = 121/216 (56%), Gaps = 17/216 (7%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +Y++AL   L  MP     +R +I  + +Q G   LH++L  +D + A +I
Sbjct: 99  IPLLVGGTIMYYKALCQGLGDMPSADENVRGQILAEAEQVGWPALHEQLRQVDPVAAAKI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW-KQAPNP------------FIPLESAHKIIILPE 120
           HP++ QRI RALE+  ++G+ +  +W     NP             +P  + +  +   +
Sbjct: 159 HPNNRQRIQRALEVYRLTGKPLSHYWAADGANPENELNWDSVNGAALPYNALNLALAPVK 218

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF  MLE G IDE+  L +  +L+++LP ++A+G R + + L+GE   +E
Sbjct: 219 REDLHARIAKRFQIMLEQGMIDEVEQLRRRGDLNVELPSIRAVGYRQVWSYLEGEFGREE 278

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            +++   AT + AKRQ TWL    + +W+   S DD
Sbjct: 279 MVEKATAATRQLAKRQMTWLRSWPEINWL---SADD 311


>gi|152979929|ref|YP_001352151.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Janthinobacterium sp. Marseille]
 gi|166198913|sp|A6SV54|MIAA_JANMA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151280006|gb|ABR88416.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Janthinobacterium sp. Marseille]
          Length = 314

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 107/188 (56%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+ L   L  +P+   A+R ++  +    G   +H +L++LD I A ++
Sbjct: 96  LPLLVGGTMLYFKGLKDGLDALPQADAALRAELDAEAAAIGYPAMHAKLAALDPITAERL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI  ++GQ +     QAP   +P       +   +RS L  RI  RF 
Sbjct: 156 KPNDSQRIQRALEIIALTGQPMSALLAQAPKTELPFTLLPIALEPSDRSVLHTRIATRFD 215

Query: 134 QMLESGA-IDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML+ GA +DE+++L  + +L L LP M+ +G R     L G  +  E  +RGI AT + 
Sbjct: 216 AMLKGGALLDEVKALRARGDLHLGLPSMRCVGYRQSWEYLDGAYSLAELRERGIAATRQL 275

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 276 AKRQLTWL 283


>gi|241760079|ref|ZP_04758177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           flavescens SK114]
 gi|241319533|gb|EER55963.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           flavescens SK114]
          Length = 313

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 112/191 (58%), Gaps = 10/191 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P IVGGT +YF ALT  L+ +P    A+R +++ +  ++G   L+  L  +D I A ++ 
Sbjct: 96  PFIVGGTMMYFHALTEGLNDLPSADAAVRAQLQAEKNEHGLAGLYRRLQEVDPITAGRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALKERIRR 130
            +D QRI RALE+ L++G+ + E +   KQA     PL     + ++PE R  L  +I +
Sbjct: 156 ANDSQRIERALEVYLLTGKPLNEHFTEQKQA----APLLDLCTVALIPEDRHLLHRQIEK 211

Query: 131 RFTQMLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RF  MLE G +DE+  L +    L  D+P M+ +G R     L+GE +YD  +++GI+AT
Sbjct: 212 RFLNMLEHGFLDEMHGLRRDYPQLHADMPSMRCVGYRQAWDYLEGETDYDTFVEKGIVAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQLAKRQLTWL 282


>gi|89094655|ref|ZP_01167592.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanospirillum
           sp. MED92]
 gi|89081125|gb|EAR60360.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanospirillum
           sp. MED92]
          Length = 301

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 116/190 (61%), Gaps = 7/190 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGT LYF AL   L+ +PE    +RE++ ++ +  G   +H  L+++D   A ++
Sbjct: 86  VPILTGGTMLYFHALKNGLAQLPEADPVVRERLLKEAEADGWEAIHARLATVDPESAARL 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW--KQAPNPFIPLESAHKIIILPE-RSALKERIRR 130
           +P+D QR+ RALEI  ++G+++ E W  ++   P  P+ S   + ++PE R+ L +RI+R
Sbjct: 146 NPNDSQRLQRALEIYEITGRTMTELWAEQEKQKPAFPIIS---LAVMPEDRAELHDRIQR 202

Query: 131 RFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF  ML+ G  +E+R L  + +L + +P ++ +G R +     G  +YD    +G++AT 
Sbjct: 203 RFDIMLDQGFEEEVRLLWERGDLDMQMPSVRCVGYRQMWEYFAGTWDYDTMKFKGVVATR 262

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 263 QLAKRQVTWL 272


>gi|118497643|ref|YP_898693.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. novicida U112]
 gi|195536344|ref|ZP_03079351.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. novicida FTE]
 gi|166198909|sp|A0Q6S4|MIAA_FRATN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|118423549|gb|ABK89939.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           novicida U112]
 gi|194372821|gb|EDX27532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. novicida FTE]
          Length = 308

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 112/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +LS +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLSEIDPQSAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  E     ++  +RS L + I  RF QM
Sbjct: 156 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEELKLCALVPNDRSILHKNIESRFRQM 215

Query: 136 LESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQNLRKNRMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|259416939|ref|ZP_05740859.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Silicibacter
           sp. TrichCH4B]
 gi|259348378|gb|EEW60155.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Silicibacter
           sp. TrichCH4B]
          Length = 287

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 115/198 (58%), Gaps = 11/198 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS-SLDSIVARQI 73
           PIIVGGTGLYF  LT  ++ +P  P AIR +        G  +  + LS +LD     +I
Sbjct: 97  PIIVGGTGLYFLTLTEGMAEIPATPAAIRAE--------GDQMSLEALSDALDDTTRMRI 148

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
              +  R+ RA E+   +G+++ ++    P P +P ES   +++  +R  L+ RIRRRF+
Sbjct: 149 DMKNRARVQRAWEVLRATGRALADWQDDTPPPVLPYESCTALVVEADRDWLEARIRRRFS 208

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M+ +GA++E RS++      +LP  KAIGV +++A L G+++  E  +   +AT +YAK
Sbjct: 209 MMIANGALEEARSMLG-RYDPNLPSCKAIGVPELMAHLNGDLSLAEAEESASVATRQYAK 267

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ+TW   + +  W R+S
Sbjct: 268 RQRTWFRSRMK-KWQRVS 284


>gi|114775685|ref|ZP_01451253.1| tRNA isopentenyltransferase [Mariprofundus ferrooxydans PV-1]
 gi|114553796|gb|EAU56177.1| tRNA isopentenyltransferase [Mariprofundus ferrooxydans PV-1]
          Length = 303

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 112/191 (58%), Gaps = 8/191 (4%)

Query: 15  PIIVGGTGLYFRAL-TGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           P+IVGGTGLY RAL  G   I PE P  +R +     ++ G+ +L+  L   D  +A  +
Sbjct: 96  PLIVGGTGLYLRALLEGFADIPPEDPL-VRARFESLQREAGTAVLYQLLLHKDPAIAAVL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLES-AHKIIILP-ERSALKERIRRR 131
            P D QRI RAL +   +G + +  W+Q P+    +ES A  + +L  ER  L++RI  R
Sbjct: 155 KPGDSQRIMRALCVNESTG-TPLSVWQQRPSG---VESVACPVFVLDVERERLRQRIGDR 210

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  M++ G +DE+R L  + L    P M+A+G R ++  L+G+ + +E +Q+GI AT +Y
Sbjct: 211 FQSMMDMGWLDEVRWLASLELPDTHPAMRAVGYRQLLNHLQGDCSLEEAVQQGITATRRY 270

Query: 192 AKRQKTWLCHQ 202
           AKRQ TW  HQ
Sbjct: 271 AKRQVTWFSHQ 281


>gi|114328146|ref|YP_745303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Granulibacter
           bethesdensis CGDNIH1]
 gi|122326895|sp|Q0BS22|MIAA_GRABC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114316320|gb|ABI62380.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 319

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 104/193 (53%), Gaps = 1/193 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +++  LPI+ GGTGLYF AL    + +P+     R++ R  L + G   LH  L+  D
Sbjct: 88  ESWQQGRLPILCGGTGLYFHALMHGFADIPDPGEEARQEARSLLAELGPESLHARLAEAD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P D QRIARA E+   +   +  +  Q P P +P      I I P R  L++
Sbjct: 148 PATAARLKPQDSQRIARAWEVWRGTESGLSAWQNQPPRP-LPGWDFAAIRIDPPREELRQ 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
            I  R   ML++GA+ E+ +L    L   LP M+A GV + +A L+G+I+  E +QR   
Sbjct: 207 AITARLHGMLDNGALAEVEALRVQALDPSLPAMRAHGVPEFLAFLRGDISLPEAMQRAAQ 266

Query: 187 ATNKYAKRQKTWL 199
           AT +Y KRQ TW 
Sbjct: 267 ATIRYTKRQATWF 279


>gi|78356827|ref|YP_388276.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|123741269|sp|Q310R5|MIAA_DESDG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78219232|gb|ABB38581.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 310

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 108/195 (55%), Gaps = 2/195 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTGLY RAL   ++ +P+IP  + +K +E+    G+  LH  L + D   A ++
Sbjct: 98  LPLLVGGTGLYLRALLDGIAAIPDIPETVSQKWQERCAARGAPALHRLLEAQDPQTAERL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE++  +G+  + +W   P P  P  +  KI +      L  R+ +R  
Sbjct: 158 HPNDSQRIVRALEVQEATGRP-LSWWHAQPVPPSPYRAV-KIGVSATLDGLTPRLAKRIE 215

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML +GA+DE R+ M +  +   P    IG  ++ + +KG ++ DE  +  +  T +YAK
Sbjct: 216 MMLAAGALDEARNAMGICDNPRAPGWSGIGCAELYSYIKGAVSLDECKRLWLHNTRQYAK 275

Query: 194 RQKTWLCHQFQADWI 208
           RQ TW   +    W+
Sbjct: 276 RQLTWFRREPNLHWL 290


>gi|325982605|ref|YP_004295007.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           sp. AL212]
 gi|325532124|gb|ADZ26845.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           sp. AL212]
          Length = 318

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 106/188 (56%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYFRAL   LS +P     +R  +  + +++G  ++H +LS LD ++A +I
Sbjct: 95  IPLLVGGTMLYFRALQEGLSALPAADQDLRLTLENRAEKHGWPVMHQKLSELDPVIAARI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++ Q + E  K       P       +I  ERS L  RI  RF 
Sbjct: 155 KPTDSQRIQRALEVCYLTQQPMSEILKNFQPADFPYRKISIALIPSERSQLHLRIAERFR 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML +G I+E++S+ +    LS + P M+ +G R     L  +I+ DE    GI AT + 
Sbjct: 215 SMLNAGLIEEVQSIRQKFPALSAESPSMRCVGYRQTCLYLDDKIDSDELHDMGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|149377525|ref|ZP_01895266.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           algicola DG893]
 gi|149358217|gb|EDM46698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           algicola DG893]
          Length = 331

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 112/223 (50%), Gaps = 28/223 (12%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   +S +P     +RE + ++ ++ G   LH EL   D + AR I
Sbjct: 86  IPLLVGGTMMYFKALLHGMSDLPSADPGVRESLAQEARERGWGALHQELERQDPVAARLI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN---------------------------PF 106
           H ++ QR+ RALE+  ++G+ I   W+   +                           P 
Sbjct: 146 HQNNRQRLIRALEVIRLTGRPISSIWQDKASSVQAEGRQNSDGIEDYTYFTQWQADESPS 205

Query: 107 IPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVR 165
           +P       +   ER  L ERI  RF  ML +G +DE+R L  + +L+  LP M+ +G R
Sbjct: 206 LPYTVVQLAMAPAERRVLHERIALRFNAMLNAGFLDEVRVLKARGDLNAGLPSMRCVGYR 265

Query: 166 DIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWI 208
              A L G+ +YD  + +G+ AT + AKRQ TWL      DW+
Sbjct: 266 QGWAHLAGDYDYDTMVDKGVAATRQLAKRQLTWLRKWSDVDWL 308


>gi|296133001|ref|YP_003640248.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermincola sp.
           JR]
 gi|296031579|gb|ADG82347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermincola
           potens JR]
          Length = 316

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 1   MLSKKLQR-YKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M+   ++R Y K  +PI+VGGTGLY R++       P  +  ++REK++E+ + +GS  L
Sbjct: 81  MVENYIKRIYDKGKVPILVGGTGLYIRSVIDHYDFTPVAVDPSLREKLKEEAEMFGSASL 140

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H +L  +D   A +IHP+D +RI RALE+ L SG+ I  F +       P        + 
Sbjct: 141 HRKLQQVDPKAAEKIHPNDMRRIIRALEVYLSSGRQISSFHRLEDESLPPKYRLGYYGLT 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L  RI  R  +M+E G I+E+R L+K      +  M+ IG ++II  L+GE   +
Sbjct: 201 MQRHNLYRRIEERVDKMIEKGLIEEVRCLLKKGYHEGMVSMQGIGYKEIIGYLRGEYTLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
           + +Q     T ++AKRQ TW     +  W  + +
Sbjct: 261 DAVQLLKRNTRRFAKRQLTWFRRDARIKWFDVEA 294


>gi|119386699|ref|YP_917754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paracoccus
           denitrificans PD1222]
 gi|239977428|sp|A1B964|MIAA_PARDP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|119377294|gb|ABL72058.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paracoccus
           denitrificans PD1222]
          Length = 302

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 113/192 (58%), Gaps = 4/192 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+ GGTGLY  AL+  L+++P  P  IR +  + ++Q G   L   +  LDS    +I  
Sbjct: 108 IVTGGTGLYLNALSRGLAVIPPTPPEIRAQADQLVRQPGG--LARMIEDLDSSTRARIDL 165

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            +  R+ RA E+   +G+ I  +  + P P I   +AH +++ P+R  L ERI RRF  M
Sbjct: 166 RNPARVQRAWEVLTTTGRGIAAWQAETPPPLIDPAAAHLLVLNPDRDWLAERIARRFHLM 225

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           LE GA+DE+R+++  + + D    KAIG  +++A L+G I+ DE  +R +IAT +YAK Q
Sbjct: 226 LEQGALDEVRAMLP-HWNPDALWAKAIGAPELVAHLQGRIDLDEAARRAVIATRQYAKAQ 284

Query: 196 KTWLCHQFQADW 207
           +++   + + DW
Sbjct: 285 RSFFRGRMR-DW 295


>gi|308273175|emb|CBX29778.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [uncultured
           Desulfobacterium sp.]
          Length = 318

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 117/211 (55%), Gaps = 8/211 (3%)

Query: 10  KKRFLPIIVGGTGLYFRALT-GQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           K+  +P IVGGTGLY +AL  G   + P   +  +  ++++ K+YG+  L+D+L  LDS 
Sbjct: 97  KENKVPFIVGGTGLYIKALVHGLFDVKPASDSDFKIHLKKQAKEYGTKFLYDQLKKLDSK 156

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPERSALK 125
            A +IH +D  RI RALE+   +G SI E  K+   + N F  L    K+ +  ER AL 
Sbjct: 157 AADKIHQNDTFRIIRALEVFESTGVSISEHQKKHGFSENRFNVL----KVGLNMEREALY 212

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            +I +R   M+E+G  DE++ L+ MN + DL  M++IG R +   + G    DE ++   
Sbjct: 213 RQIEKRVDFMIEAGFEDEVKRLLDMNYAADLKSMQSIGYRHMTDYITGRTTLDEAIRTLK 272

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             T ++AKRQ TW        W+R   ++D+
Sbjct: 273 QDTRRFAKRQLTWFNADQNIIWVRPDQVEDI 303


>gi|67459106|ref|YP_246730.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           felis URRWXCal2]
 gi|75536461|sp|Q4ULK8|MIAA_RICFE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|67004639|gb|AAY61565.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           felis URRWXCal2]
          Length = 309

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 110/192 (57%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   +RE++R    + G+  L ++L  LD++ A +I
Sbjct: 95  LPILIGGTGLYINSLVFGYNNIPDISEDLREQVRNLHTEIGNIGLWNKLEELDTLAASKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ L +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 155 NQNDTQRLIRAYEVFLQTGKSIFSF-QTLPKEQILSDFNFKIIFLNPERKFLYKTCDERL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K  +  D   +KA+GV++I+A L G +  DE L    I T  YA
Sbjct: 214 DKIFKEGAIDEIALIKKQFIPQDYSNLKAVGVKEILAYLDGNLTLDEALSAAQIRTRHYA 273

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW   Q +
Sbjct: 274 KRQVTWFKKQIE 285


>gi|268316883|ref|YP_003290602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodothermus
           marinus DSM 4252]
 gi|262334417|gb|ACY48214.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodothermus
           marinus DSM 4252]
          Length = 307

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 118/201 (58%), Gaps = 10/201 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGG+ LY  AL   L+ +P++  A+R ++ E+L+  G   L+ EL  +D   A ++
Sbjct: 114 VPLVVGGSTLYLYALQFGLAEIPDVDPAVRRRLNERLRTEGPEALYAELQRVDPEAAARL 173

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQA-PNPFIPLESAHKIIILPERSALKERIRRRF 132
            P+  QR+ RALE+   +G+ I  + +   P+P+    +   I++  +R  L ERI RR 
Sbjct: 174 DPTKTQRVIRALEVYHGTGRPITYYHRHHRPSPY----TFRTIVLYRDRPVLYERINRRV 229

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN--K 190
            QMLE+G ++E+R +++   S +L +++ IG  ++I  L+G   YD    R +I  N  +
Sbjct: 230 DQMLEAGLVEEVRGILEAGYSPELDVLRTIGYEEVIGYLQG--AYDRETMRRLIQRNTRR 287

Query: 191 YAKRQKTWLCHQFQADWIRIS 211
           YAKRQ TW   +F  +W+++ 
Sbjct: 288 YAKRQLTWF-RRFDFEWVKLD 307


>gi|255595624|ref|XP_002536358.1| conserved hypothetical protein [Ricinus communis]
 gi|223519989|gb|EEF26025.1| conserved hypothetical protein [Ricinus communis]
          Length = 461

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 113/188 (60%), Gaps = 3/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF AL   LS +PE    +R ++  + ++ G   +H+EL  +D   A ++
Sbjct: 10  IPLLVGGTMLYFNALQHGLSNLPEADPTVRAQLIARAEEVGWPAMHEELQRVDPETAARL 69

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P+D QRI RALE+ LVSG+ + E  ++      P     KI +LP +R+ L +RI +RF
Sbjct: 70  QPNDAQRIERALEVFLVSGRPMSELLRENKASEFPYR-LLKIALLPSDRAVLHQRIAQRF 128

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE G I+E+++L  +  L+  +P M+ +G R     L+GEI+     ++GI +T + 
Sbjct: 129 DLMLEQGMIEEVQTLRERYALNPSMPSMRCVGYRQTWDYLEGEIDKKSLREQGIASTRQL 188

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 189 AKRQLTWL 196


>gi|289207680|ref|YP_003459746.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thioalkalivibrio sp. K90mix]
 gi|288943311|gb|ADC71010.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thioalkalivibrio sp. K90mix]
          Length = 314

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 109/186 (58%), Gaps = 4/186 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LY RAL      +PE+P  +RE++R +L   G   LH EL+ +D   A +IHP
Sbjct: 102 LMVGGTLLYLRALLDGFDEIPEVPNVVREQVRARLDVEGGQALHRELAGVDPEAAARIHP 161

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRFTQ 134
           +D QRI RALE+   +G+ +  F +Q     +P E    + + PE R  L+ERI RRF  
Sbjct: 162 NDPQRILRALEVFEATGRPLSSF-QQGAAARVP-EGWVSLALWPEDRDVLRERIARRFDA 219

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           MLE G +DE+ +L  +  L+ + P  +A+G R     L GE+++ +  +R I AT + AK
Sbjct: 220 MLEVGFVDELMALQQRPELTAEHPSQRAVGYRQGWQWLAGELDFAQFRERAIAATRQLAK 279

Query: 194 RQKTWL 199
           RQ T L
Sbjct: 280 RQLTGL 285


>gi|254374457|ref|ZP_04989939.1| hypothetical protein FTDG_00627 [Francisella novicida GA99-3548]
 gi|151572177|gb|EDN37831.1| hypothetical protein FTDG_00627 [Francisella novicida GA99-3548]
          Length = 308

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 112/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +L+ +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLNEIDPQSAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  E     ++  +RS L + I  RF QM
Sbjct: 156 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEELKLCALVPNDRSILHKNIESRFRQM 215

Query: 136 LESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQNLRKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|188991939|ref|YP_001903949.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|229621761|sp|B0RTZ0|MIAA_XANCB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167733699|emb|CAP51904.1| tRNA isopentenyltransferase [Xanthomonas campestris pv. campestris]
          Length = 327

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 114/203 (56%), Gaps = 10/203 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGTGLYFRA    L+ MPE   A+R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  IPILAGGTGLYFRAALEGLAQMPEADPAVRLAIAAEAEQVGWGALHAQLARIDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAP-NPFIPLESAHKIIILP-ERSALKERIRRR 131
           H +D QRI RALE+  +SG+  I +W+  P  P  P+    K+++ P +R+ L  RI  R
Sbjct: 158 HATDRQRIQRALEVYRISGKP-ISYWQTRPAGPRAPVR-VLKLVLAPRQRAVLHARIAMR 215

Query: 132 FTQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
              ML  G    ++++R+L +M      LDLP ++A+G R     L G  +  E+  + +
Sbjct: 216 LDVMLADGFLTEVEQLRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAESRDKAV 275

Query: 186 IATNKYAKRQKTWLCHQFQADWI 208
            AT + AKRQ TWL  +  A W 
Sbjct: 276 QATRQLAKRQLTWLRGELDARWF 298


>gi|126462129|ref|YP_001043243.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|239977477|sp|A3PJF5|MIAA_RHOS1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|126103793|gb|ABN76471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 314

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF ALT  L+ +P  P  +R +   +L + G   L   ++ LD+  A +I 
Sbjct: 121 PVIVGGTGLYFSALTEGLAEIPHTPPEVRAEADARLAEAG---LARMVAELDAETAARID 177

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ +  +  +   P +PL  A  ++I P+ + L +RI  RF  
Sbjct: 178 LQNPARVQRAWEVLRATGRGLARWQAETAPPLLPLSDATALVIRPDPAWLAQRIDSRFDL 237

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA+DE+R+ +       LP  +AIG  +++A L+GEI  DE +    +A+ +YAKR
Sbjct: 238 MMADGALDEVRATLP-GWDPALPSARAIGAPELVAHLRGEIPLDEAIAAAKLASRQYAKR 296

Query: 195 QKTWLCHQFQ 204
           Q+TW  ++ +
Sbjct: 297 QRTWFRNRMR 306


>gi|157827308|ref|YP_001496372.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           bellii OSU 85-389]
 gi|166216983|sp|A8GWV8|MIAA_RICB8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157802612|gb|ABV79335.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           bellii OSU 85-389]
          Length = 315

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 113/192 (58%), Gaps = 3/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   +R+++R+   + G+  LH+ L+ LD + + +I
Sbjct: 95  LPILIGGTGLYINSLVFGYNNIPDISEDLRQQVRKLHNEIGNTELHNRLTKLDPLASSKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + SD QR+ RA E+ L +G+SI  F +  P   I  E   KII L PER  L +    R 
Sbjct: 155 NQSDTQRLIRAYEVVLQTGKSIFSF-QTLPKEQILSEFNFKIIFLNPERKFLYKICDERL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             + + GAIDEI +L+K   + D   +KA+G+++I+A L+ ++   E L      T +YA
Sbjct: 214 ANIFKDGAIDEI-ALIKKQFNPDYLNLKAVGIKEILAYLENKLTLSEALNLAQTRTRRYA 272

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  HQ +
Sbjct: 273 KRQITWFKHQIK 284


>gi|91205594|ref|YP_537949.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           bellii RML369-C]
 gi|122425570|sp|Q1RIF4|MIAA_RICBR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91069138|gb|ABE04860.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           bellii RML369-C]
          Length = 315

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 113/192 (58%), Gaps = 3/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   +R+++R+   + G+  LH+ L+ LD + + +I
Sbjct: 95  LPILIGGTGLYINSLVFGYNNIPDISEDLRQQVRKLHNEIGNTELHNRLTKLDPLASSKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + SD QR+ RA E+ L +G+SI  F +  P   I  E   KII L PER  L +    R 
Sbjct: 155 NQSDTQRLIRAYEVVLQTGKSIFSF-QTLPKEQILSEFNFKIIFLNPERKFLYKICDERL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             + + GAIDEI +L+K   + D   +KA+G+++I+A L+ ++   E L      T +YA
Sbjct: 214 ANIFKDGAIDEI-ALIKKQFNPDYLNLKAVGIKEILAYLENKLTLSEALNLAQTRTRRYA 272

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  HQ +
Sbjct: 273 KRQITWFKHQIK 284


>gi|238020298|ref|ZP_04600724.1| hypothetical protein GCWU000324_00176 [Kingella oralis ATCC 51147]
 gi|237867278|gb|EEP68284.1| hypothetical protein GCWU000324_00176 [Kingella oralis ATCC 51147]
          Length = 325

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + ++ LP+IVGGT +Y+ ALT  L+ +PE   A+R +++     +G   L++EL  LD  
Sbjct: 90  HARQRLPLIVGGTMMYYHALTQGLNALPEASPALRAQLQATKAAHGLAFLYNELQRLDPE 149

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKER 127
            A ++ P+D QRI RALEI  ++G+ + +          PL + H + ++P +RS L  +
Sbjct: 150 TAARLKPNDSQRIERALEIYQLTGKPMSQHLAAHATAAAPL-NLHTLALIPSDRSLLHAQ 208

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSL--DLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           I +RF QM+E G +DE+R L +   +L  D+P M+ +G R     L G   + + +++G 
Sbjct: 209 INQRFNQMIEHGFLDEVRQLRQRYPALHPDMPSMRCVGYRQAWQHLDGATRFAQFVEQGQ 268

Query: 186 IATNKYAKRQKTWL 199
            AT + AKRQ TWL
Sbjct: 269 AATRQLAKRQLTWL 282


>gi|154252905|ref|YP_001413729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parvibaculum
           lavamentivorans DS-1]
 gi|239977429|sp|A7HVY9|MIAA_PARL1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|154156855|gb|ABS64072.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 314

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 113/192 (58%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTGLYFRAL   L+ +P IP  +R  +R ++   G H  H  L+  D  +A  I
Sbjct: 97  LPVVVGGTGLYFRALIEGLAPIPAIPDDVRAAVRAEVGDAGPHA-HALLAEADPALAATI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            PSD QRIAR +E+   +G+ +  + +  P P +    A KI+++P+R+ L+ R  RRF 
Sbjct: 156 RPSDLQRIARGIEVARATGRPLSAWQQIPPEPLVSGTFA-KIMLMPDRAWLQARCDRRFD 214

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLE GA++E  ++  + L   LP  KA+G+R ++  L GEI  +E    G   T  YAK
Sbjct: 215 LMLEEGALEEAAAMTALGLDPALPAAKALGLRPLMRHLAGEITLEEAAAAGKAETRAYAK 274

Query: 194 RQKTWLCHQFQA 205
           RQ+TWL  Q  A
Sbjct: 275 RQETWLRTQMIA 286


>gi|300310167|ref|YP_003774259.1| tRNA delta2-isopentenylpyrophosphate transferase [Herbaspirillum
           seropedicae SmR1]
 gi|300072952|gb|ADJ62351.1| tRNA delta2-isopentenylpyrophosphate transferase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 315

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 108/188 (57%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+ L   L  +P+   A+R ++ E+  + G   +H  L+ LD + A ++
Sbjct: 98  LPLLVGGTMLYFKVLRDGLDELPQADPALRAQLDEEAARVGMPAMHARLAELDPVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI L++GQ +     Q P   +P+      +   ER+ L +RI  RF 
Sbjct: 158 KPNDSQRIQRALEISLLTGQPMSALLAQKPAEPLPMRLLPLALEPSERAILHDRIALRFD 217

Query: 134 QMLESGAID-EIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML  G ++ E+R+L  + +L L LP M+ +G R +   L G I+     ++GI AT + 
Sbjct: 218 LMLRDGGLEREVRALRARGDLHLGLPSMRCVGYRQMWEYLDGSIDAAAMREKGIAATRQL 277

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 278 AKRQLTWL 285


>gi|254487511|ref|ZP_05100716.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           GAI101]
 gi|214044380|gb|EEB85018.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           GAI101]
          Length = 296

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 11/198 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSS-LDSIVARQI 73
           PII+GGTGLYF ALT  L+ +P  P AIR          G+ +   EL++ LD   A +I
Sbjct: 107 PIIIGGTGLYFAALTQGLADIPATPDAIRAA--------GNAMSLAELTAALDPKTAARI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             ++  R+ R  E+   +G+S+ ++    P P +PL +   I +  ++  L  RI RRF 
Sbjct: 159 DLNNPMRVKRGWEVLTATGRSLADWQDATPPPLLPLGACTAIAVEADKDWLNARIIRRFD 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           QML+ GA+DE+ + +  +    LP  +AIGV ++IA L+G        +  IIAT +YAK
Sbjct: 219 QMLDQGALDEV-ARVAPSYDPTLPAHRAIGVPELIAYLEGRHTLKVARENAIIATRRYAK 277

Query: 194 RQKTWLCHQFQADWIRIS 211
           RQ+TWL  +  ADW++ +
Sbjct: 278 RQRTWL-RRNTADWLKYA 294


>gi|209965269|ref|YP_002298184.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodospirillum
           centenum SW]
 gi|239977443|sp|B6ITS0|MIAA_RHOCS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|209958735|gb|ACI99371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodospirillum
           centenum SW]
          Length = 314

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 109/196 (55%), Gaps = 8/196 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGTGLY RAL   L+ +P +P  +R + +   +  G+  LH  L++ D   A ++
Sbjct: 96  VPVVVGGTGLYLRALAEGLADIPPVPEPVRAEAQALHRALGTPALHARLAAEDPDGAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW----KQAPNPFIPLESAHKIIILPERSALKERIR 129
           HP D  R+ RA E+   +G+ +  +W    + AP P +   +   ++  P R  L     
Sbjct: 156 HPGDTTRVLRAWEVLRATGRPL-GYWQTAGRAAPPPGLRFLT---LVCEPPRDRLYAACD 211

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            RF +MLE+GA++E+R L  + L   LP MKA+GV +++A L+G++  +        AT 
Sbjct: 212 ARFLRMLEAGALEEVRRLAALGLDPGLPAMKALGVPELLAHLRGDLPLEAATATAQQATR 271

Query: 190 KYAKRQKTWLCHQFQA 205
            YAKRQ TW  HQ  A
Sbjct: 272 NYAKRQLTWFRHQIAA 287


>gi|302878542|ref|YP_003847106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gallionella
           capsiferriformans ES-2]
 gi|302581331|gb|ADL55342.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gallionella
           capsiferriformans ES-2]
          Length = 319

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 111/188 (59%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P    ++R ++   + Q+G   LH +L+ +D   A ++
Sbjct: 106 IPLLVGGTMLYFKALREGLSALPVANPSVRAELDAVIAQHGISHLHQQLAIVDPETAARL 165

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFIPLESAHKIIILPERSALKERIRRRF 132
            P+D QRI RA+EI  ++G ++   +K Q  N  +P +     ++  +RS L +RI  RF
Sbjct: 166 SPNDTQRIQRAMEIYRITGTAMSALFKLQTENAALPYQITSIALVPSDRSVLHQRIETRF 225

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QM+E G + E++ L  K  L  +LP M+ +G R      +GEI   + ++ GIIAT + 
Sbjct: 226 HQMIEQGLLTELQDLRKKYALDPELPSMRCVGYRQAWQYSEGEITQAQFVETGIIATRQL 285

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 286 AKRQLTWL 293


>gi|77463255|ref|YP_352759.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|123592079|sp|Q3J2X6|MIAA_RHOS4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|77387673|gb|ABA78858.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodobacter sphaeroides 2.4.1]
          Length = 314

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 110/190 (57%), Gaps = 4/190 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF ALTG L+ +P  P  +R     +L + G   L   ++ LD+  A +I 
Sbjct: 121 PVIVGGTGLYFSALTGGLAEIPHTPPEVRAAADARLAEAG---LARMVAELDAETAARID 177

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ +  +  +   P +PL  A  ++I P+ + L +RI  RF  
Sbjct: 178 LQNPARVQRAWEVLRATGRGLARWQAETAPPLLPLSDATALVIRPDPAWLAQRIDSRFDL 237

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA+DE+R+ +  +    LP  +AIG  +++A L+GEI  DE +    +A+ +YAKR
Sbjct: 238 MMADGALDEVRAALP-DWDPTLPSARAIGAPELVAHLRGEIPLDEAVAAAKLASRQYAKR 296

Query: 195 QKTWLCHQFQ 204
           Q+TW  ++ +
Sbjct: 297 QRTWFRNRMR 306


>gi|255021200|ref|ZP_05293250.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969315|gb|EET26827.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 304

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 107/194 (55%), Gaps = 7/194 (3%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
           L R + R +P++VGGTGLYFRAL   ++ +P      R  +  + ++ G   LH EL +L
Sbjct: 86  LARAQGR-IPVLVGGTGLYFRALERGIAELPGASAEFRAGLSARAEREGWPALHAELEAL 144

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   AR+I P D QRI RALEI  + G +   + +    P +      K+ + P R+ L 
Sbjct: 145 DPARARRIDPHDRQRIQRALEIHRLGGSTQSGWSRGLDGPIL------KVALCPPRAVLH 198

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   ML SG ++E+  L       DLP M+A+G R   +  +GEI+ +   ++ +
Sbjct: 199 QRIAMRLDAMLASGFLEEVERLYHRYGEQDLPAMRAVGYRQFFSWRRGEIDLEAAKRQAL 258

Query: 186 IATNKYAKRQKTWL 199
            AT + AKRQ+TWL
Sbjct: 259 AATRQLAKRQETWL 272


>gi|83942308|ref|ZP_00954769.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sulfitobacter
           sp. EE-36]
 gi|83846401|gb|EAP84277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sulfitobacter
           sp. EE-36]
          Length = 296

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 107/195 (54%), Gaps = 9/195 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  L  +P  P A+R+      +          + +LD   AR+I 
Sbjct: 107 PIIVGGTGLYFAALTKGLVDIPPTPDAVRDAGNTMTRAA-------MIDALDPETARRID 159

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E++  +G+ +  +    P P +P+E    + +   +  L +RI RRF Q
Sbjct: 160 LYNPMRVQRAWEVQQATGRGLAAWQDDTPPPVLPMERCQPVAVAASKDWLNDRIIRRFDQ 219

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML+ GA+DE+ + ++ +    LP  +AIG  +++  L G    D   Q  IIAT +YAKR
Sbjct: 220 MLDQGALDEV-AAVRPDYDPTLPAHRAIGAPELMRYLDGVTPLDVARQDAIIATRQYAKR 278

Query: 195 QKTWLCHQFQADWIR 209
           Q+TW+  +  ADW++
Sbjct: 279 QRTWM-RKNTADWLQ 292


>gi|254373009|ref|ZP_04988498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. novicida GA99-3549]
 gi|151570736|gb|EDN36390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           novicida GA99-3549]
          Length = 308

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/185 (37%), Positives = 112/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +L+ +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSALPESQAEIREVLEYQKKAKGLQYLHQQLNEIDPQSAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  E     ++  +RS L + I  RF QM
Sbjct: 156 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEELKLCALVPNDRSILHKNIESRFRQM 215

Query: 136 LESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQNLRKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|94971585|ref|YP_593633.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Koribacter versatilis Ellin345]
 gi|226704714|sp|Q1IHU1|MIAA_ACIBL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|94553635|gb|ABF43559.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Koribacter versatilis Ellin345]
          Length = 307

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY RAL   L   PE    +RE +R + ++ G   LH  LS +D + A +I
Sbjct: 95  LPIVVGGTGLYLRALLDGLFAGPERSEELREHLRRREQERGPTYLHRILSRMDRVAAAKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D  ++ RA+E+ L + + + E W+Q  +P        +I + P+R AL +RI RR  
Sbjct: 155 HPNDAAKLIRAIEVCLAARKPMTELWQQGRDPLTGFRIL-RIGLDPDRPALYDRINRRAA 213

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +M E G ++E ++L+     +  P + ++G R    LL G++  ++ +         YAK
Sbjct: 214 EMFEQGLVEETQALLAKYGRIGGP-LDSLGYRQAFELLDGKLTREQAVAAAQQGHRNYAK 272

Query: 194 RQKTWLCHQFQADWIR 209
           RQ TW   + +  W++
Sbjct: 273 RQMTWFRREPEVRWLK 288


>gi|308389628|gb|ADO31948.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Neisseria meningitidis alpha710]
          Length = 313

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 112/190 (58%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G IDE+ +L ++  +L+ D P ++ +G R     L G+ ++   +++GI AT 
Sbjct: 213 FHLMLEQGFIDEVENLRRLYPSLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|217970233|ref|YP_002355467.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thauera sp.
           MZ1T]
 gi|217507560|gb|ACK54571.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thauera sp.
           MZ1T]
          Length = 327

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 107/204 (52%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYF+AL   LS +P     +R  + ++    G   LH EL+ LD   A ++
Sbjct: 101 IPLLAGGTMLYFKALRDGLSDLPAADPELRRALDDEAAGRGWPALHAELARLDPEAAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D QRI RALEI  ++G+ + + + +  +  +P       +   +R AL  RI  RF 
Sbjct: 161 EPGDAQRIQRALEIVRLTGRPLADSYAKKEDDPLPCRLLPIALAPSDRGALHARIEERFD 220

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML +G +DE+R L  +  L   +P M+ +G R +   L G   YDE   +G+ AT + A
Sbjct: 221 AMLHAGLVDEVRQLRARYRLDPSMPSMRCVGYRQVWEYLDGGTGYDELRFKGVAATRQLA 280

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW   QF+  W     +D L
Sbjct: 281 KRQLTWQ-RQFRETWPGFVELDCL 303


>gi|325924509|ref|ZP_08186028.1| tRNA isopentenyltransferase MiaA [Xanthomonas gardneri ATCC 19865]
 gi|325545004|gb|EGD16339.1| tRNA isopentenyltransferase MiaA [Xanthomonas gardneri ATCC 19865]
          Length = 327

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 109/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE    +R  I  + +Q G   LH +L+ +D I A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSQLPEADPQVRLTIAAEAEQLGWAALHAQLAQVDPIAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +P+    K+++ P ER+ L  RI +R 
Sbjct: 158 HSTDPQRIQRALEVYRISGRPISYWQALPPGPRLPVR-VLKVVLAPRERAVLHTRIEQRL 216

Query: 133 TQMLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML    + E+  L  +         LDLP ++A+G R     L G  +  +  ++ I 
Sbjct: 217 DAMLAQDFLAEVERLRALPQLRAVAAPLDLPAIRAVGYRHAWEYLDGAGSLAQFREKAIH 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|254512123|ref|ZP_05124190.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodobacteraceae bacterium KLH11]
 gi|221535834|gb|EEE38822.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodobacteraceae bacterium KLH11]
          Length = 330

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 108/191 (56%), Gaps = 20/191 (10%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS---SLDSIVAR 71
           PIIVGGTGLYF ALT  ++ +P  P  +R +              D LS    LD + AR
Sbjct: 140 PIIVGGTGLYFTALTEGMADIPATPPDVRARA-------------DALSLPQMLDGVDAR 186

Query: 72  QIHPSDGQ---RIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            +   D Q   R+ RA E++  +G++++++  + P P + L +   ++    +  L +RI
Sbjct: 187 TLQGLDTQNRARVQRAWEVEHATGRALVDWQAETPAPILDLATTVPLVFNAPKDWLLDRI 246

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            RRF QML+ GA+DE+ + M+      LP  KAIGV +++A L+G++  DE   R  IAT
Sbjct: 247 NRRFDQMLQQGALDEV-AAMRDRYDPSLPACKAIGVPELMAYLEGQMTLDEARDRATIAT 305

Query: 189 NKYAKRQKTWL 199
            ++AKRQ+TW 
Sbjct: 306 RQFAKRQRTWF 316


>gi|304311743|ref|YP_003811341.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HdN1]
 gi|301797476|emb|CBL45696.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HdN1]
          Length = 370

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 111/191 (58%), Gaps = 6/191 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LY+RAL   ++ +P     +R +I    +  G   +H  L+++D I A +IH
Sbjct: 155 PVLVGGTMLYYRALQQGMADLPPANPEVRAEIEAIAQTAGWPQVHALLAAVDPIAANRIH 214

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNP-----FIPLESAHKIIILPERSALKERIR 129
           P+D QR+ RALE+  ++G  + E+ ++  +       IP       +  P+RS+L E I 
Sbjct: 215 PTDPQRLQRALEVYKITGVPLSEWHQRQKDAEIQSGAIPWNITAVALCPPQRSSLHEAIA 274

Query: 130 RRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RRF QMLE G  +E+  L  + +L+L  P M+A+G R +   L G    D+ +++GI+AT
Sbjct: 275 RRFRQMLEDGFEEEVLGLRARGDLTLKHPSMRAVGYRQMWEYLDGTTTRDQMIEQGIVAT 334

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 335 RQLAKRQITWL 345


>gi|57340164|gb|AAW50069.1| hypothetical protein FTT0629 [synthetic construct]
          Length = 343

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 112/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +L+ +D   A++I+P
Sbjct: 122 LLVGGTMLYFKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLNEIDPQSAQKINP 181

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  +     ++  +RS L + I  RF QM
Sbjct: 182 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEDLKLCALVPNDRSILHKNIESRFRQM 241

Query: 136 LESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 242 LDQGFLDEVQNLHKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 301

Query: 195 QKTWL 199
           Q TW+
Sbjct: 302 QLTWI 306


>gi|307545955|ref|YP_003898434.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Halomonas
           elongata DSM 2581]
 gi|307217979|emb|CBV43249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Halomonas
           elongata DSM 2581]
          Length = 312

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 115/199 (57%), Gaps = 3/199 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +Y++ L      +P     IR ++  ++++ G   LH+EL+ +D   AR+I
Sbjct: 97  VPLLVGGTMMYYQRLWVGEPNLPSGDPEIRAELDREVERRGLSELHEELARVDPRAARRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW-KQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           HP+D QR+ RALE+  +SG+ + E W +Q P  F P       +   +RS L  RI  RF
Sbjct: 157 HPNDPQRLTRALEVYRISGRPLTEHWDEQQPETF-PWRVLSIGLAPADRSVLHSRIAARF 215

Query: 133 TQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             MLE+G +DE+  L  + +L   LP MK++G R     L+G+ + +   +RGI+AT + 
Sbjct: 216 DAMLEAGFLDEVAGLKARDDLHARLPAMKSVGYRQAWEYLEGQGDREAFRRRGIVATRQL 275

Query: 192 AKRQKTWLCHQFQADWIRI 210
           AKRQ TW+    +  W+ I
Sbjct: 276 AKRQLTWMRGWPELHWVDI 294


>gi|157825775|ref|YP_001493495.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           akari str. Hartford]
 gi|166216982|sp|A8GNL2|MIAA_RICAH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157799733|gb|ABV74987.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           akari str. Hartford]
          Length = 312

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 111/192 (57%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   +RE++R    + G+  L ++L  LD++ A +I
Sbjct: 95  LPILIGGTGLYINSLVFGYNNIPDISEDLREQVRNLHTEIGNIELWNKLEELDTLAASKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ L +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 155 NKNDTQRLIRAYEVFLETGKSICSF-QTLPKEQILSDFNFKIIFLNPERKFLYKTCDERL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K     D   +KA+G+++I+A L G++  D  L    I T +YA
Sbjct: 214 DKIFKEGAIDEIALIKKQFAPKDYVDLKAVGIKEILAYLDGDMTLDRALNAAQIRTRQYA 273

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q Q
Sbjct: 274 KRQVTWFKNQIQ 285


>gi|310815571|ref|YP_003963535.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Ketogulonicigenium vulgare Y25]
 gi|308754306|gb|ADO42235.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Ketogulonicigenium vulgare Y25]
          Length = 301

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 107/191 (56%), Gaps = 8/191 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  L+ +P  P A+R    E         L D ++ LDS  A  I 
Sbjct: 109 PIIVGGTGLYFHALTQGLADIPATPPAVRGAADEM-------DLPDLVAGLDSASAGGID 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +G+ I  +  + P P +PL++ + I ++P+   L  RI +RF  
Sbjct: 162 LNNRARVQRAWEVLQATGEGIAAWQSRTPAPLLPLDAVYPIAMMPDVDWLNARIAQRFDL 221

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA++E R+++       L   KAIG  ++IA L+G +  DE     IIAT +YAKR
Sbjct: 222 MIAGGALEEARAMLPHWDPAHL-SSKAIGAPELIAHLQGAMPLDEARDAAIIATRQYAKR 280

Query: 195 QKTWLCHQFQA 205
           Q+TW   + +A
Sbjct: 281 QRTWFRARMKA 291


>gi|56707754|ref|YP_169650.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|89256254|ref|YP_513616.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica LVS]
 gi|110670225|ref|YP_666782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis FSC198]
 gi|115314711|ref|YP_763434.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica OSU18]
 gi|134302064|ref|YP_001122033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|156502315|ref|YP_001428380.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167011005|ref|ZP_02275936.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica FSC200]
 gi|187931476|ref|YP_001891460.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|208779445|ref|ZP_03246791.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           novicida FTG]
 gi|224456824|ref|ZP_03665297.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|254367593|ref|ZP_04983614.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica 257]
 gi|254370258|ref|ZP_04986263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254874567|ref|ZP_05247277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|290953594|ref|ZP_06558215.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313095|ref|ZP_06803785.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica URFT1]
 gi|61213934|sp|Q5NH42|MIAA_FRATT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|122325266|sp|Q0BM87|MIAA_FRATO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|122500816|sp|Q2A3T6|MIAA_FRATH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123359551|sp|Q14IJ4|MIAA_FRAT1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166198908|sp|A7NBS1|MIAA_FRATF RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166198910|sp|A4IYB1|MIAA_FRATW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238691554|sp|B2SG23|MIAA_FRATM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56604246|emb|CAG45262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|89144085|emb|CAJ79336.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica LVS]
 gi|110320558|emb|CAL08645.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis FSC198]
 gi|115129610|gb|ABI82797.1| tRNA isopentenyltransferase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134049841|gb|ABO46912.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|134253404|gb|EBA52498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica 257]
 gi|151568501|gb|EDN34155.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis FSC033]
 gi|156252918|gb|ABU61424.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|187712385|gb|ACD30682.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|208745245|gb|EDZ91543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           novicida FTG]
 gi|254840566|gb|EET19002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis MA00-2987]
 gi|282158925|gb|ADA78316.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           tularensis subsp. tularensis NE061598]
          Length = 308

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 112/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +L+ +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLNEIDPQSAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  +     ++  +RS L + I  RF QM
Sbjct: 156 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEDLKLCALVPNDRSILHKNIESRFRQM 215

Query: 136 LESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQNLHKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|21231168|ref|NP_637085.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768824|ref|YP_243586.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|25008754|sp|Q8P9X8|MIAA_XANCP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|81305209|sp|Q4UTQ7|MIAA_XANC8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21112807|gb|AAM41009.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66574156|gb|AAY49566.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 327

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 113/203 (55%), Gaps = 10/203 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGTGLYFRA    L+ MPE   A+R  I  + +Q G   LH +L+ +D + A +I
Sbjct: 98  IPILAGGTGLYFRAALEGLAQMPEADPAVRLAIAAEAEQVGWGALHAQLARIDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAP-NPFIPLESAHKIIILP-ERSALKERIRRR 131
           H +D QRI RALE+  +SG+  I +W+  P  P  P+    K+++ P +R+ L  RI  R
Sbjct: 158 HATDRQRIQRALEVYRISGKP-ISYWQTRPAGPRAPVR-VLKLVLAPRQRAVLHARIAMR 215

Query: 132 FTQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
              ML  G    ++++R+L +M      LDLP ++A+G R     L G  +  E   + +
Sbjct: 216 LDVMLADGFLTEVEQLRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAV 275

Query: 186 IATNKYAKRQKTWLCHQFQADWI 208
            AT + AKRQ TWL  +  A W 
Sbjct: 276 QATRQLAKRQLTWLRGELDARWF 298


>gi|239977568|sp|Q5GYM0|MIAA_XANOR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 327

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 111/202 (54%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A R  I  +  Q G   LH EL+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAAQIGWAGLHSELARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+  I +W+  P          K+++ P ER+ L  RI RR 
Sbjct: 158 HATDPQRIQRALEVYRISGRP-ISYWQALPPGLRLPVRVLKVVLAPRERAVLHGRIERRL 216

Query: 133 TQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML  G    ++++R+L +M    + LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|188575914|ref|YP_001912843.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|238689559|sp|B2SUC1|MIAA_XANOP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|188520366|gb|ACD58311.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 327

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 112/202 (55%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A R  I  + +Q G   LH EL+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAEQIGWAGLHSELARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+  I +W+  P          K+++ P ER+ L  RI RR 
Sbjct: 158 HATDPQRIQRALEVYRISGRP-ISYWQALPPGLRLPVRVLKVVLAPRERAVLHGRIERRL 216

Query: 133 TQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML  G    ++++R+L +M    + LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|163741177|ref|ZP_02148569.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385530|gb|EDQ09907.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Phaeobacter
           gallaeciensis 2.10]
          Length = 290

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 111/196 (56%), Gaps = 16/196 (8%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  L+ +P  P A+R+       Q  +  L D  ++LD+  A +I 
Sbjct: 101 PIIVGGTGLYFAALTQGLADIPATPAAVRQ-------QADALSLEDMRAALDATTAARID 153

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ + ++  + P P +PL+    I+   ++  L+ RIRRRF  
Sbjct: 154 LLNRARVQRAYEVLTATGRGLADWQAETPPPPLPLDHCTAIVFDTDKDWLEARIRRRFDA 213

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M++ GAI EI + M+      LP  +AIGV +++A   G++  +E  +R  +AT ++AKR
Sbjct: 214 MMDMGAIAEI-TAMQDRYDPALPSCRAIGVPELMAHHLGDLTEEEARERAAVATRQFAKR 272

Query: 195 QKTWL--------CHQ 202
           Q+TW         CH+
Sbjct: 273 QRTWFRARMKGWHCHR 288


>gi|261392717|emb|CAX50290.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase; isopentenyl-diphosphate:tRNA
           isopentenyltransferase; IPTase; IPPT) [Neisseria
           meningitidis 8013]
          Length = 313

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 107/189 (56%), Gaps = 4/189 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
            P+DGQRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF
Sbjct: 155 KPNDGQRIGRALEVYYLTGKPMSTHLGSPTSHTLPFD-LHTAALIPENRARLHENIALRF 213

Query: 133 TQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
             MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI AT +
Sbjct: 214 HMMLEQGFIGEVENLRRRYPCLTADSPAIRCVGYRQAWKYLDGKTDFPAFVEKGIAATRQ 273

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 274 LAKRQLTWL 282


>gi|84624456|ref|YP_451828.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|123521584|sp|Q2P1M3|MIAA_XANOM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84368396|dbj|BAE69554.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
          Length = 327

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 112/202 (55%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A R  I  + +Q G   LH EL+ +D + A +I
Sbjct: 98  LPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAEQIGWAGLHSELARVDPVAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+  I +W+  P          K+++ P ER+ L  RI RR 
Sbjct: 158 HATDPQRIQRALEVYRISGRP-ISYWQALPPGLRLPVRVLKVVLAPRERAVLHGRIERRL 216

Query: 133 TQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML  G    ++++R+L +M    + LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 277 ATRQLAKRQLTWLRGELDARWF 298


>gi|251792373|ref|YP_003007099.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533766|gb|ACS97012.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           aphrophilus NJ8700]
          Length = 318

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 115/190 (60%), Gaps = 8/190 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I  K  Q G   LH EL+ +D I A++I
Sbjct: 100 IPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIETKAMQIGWGGLHQELAKIDPISAQRI 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPN--PFIPLESAHKIIILPE-RSALKERIRR 130
           +P+D QRI RALE+  ++G+++ E   Q     P+  L+ A    I PE R  L  RI +
Sbjct: 160 NPNDSQRINRALEVFYLTGKTLTELTAQKGEALPYDILQFA----IAPENREVLHLRIEQ 215

Query: 131 RFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +M+E G   E+  L  + +L+ +LP ++++G R +   L+G+ ++ E + RGI AT 
Sbjct: 216 RFHKMIELGFQQEVEKLYQRSDLNENLPSIRSVGYRQMWEYLRGDYDHKEMIFRGICATR 275

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 276 QLAKRQITWL 285


>gi|328676008|gb|AEB28683.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella cf.
           novicida 3523]
          Length = 307

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 116/194 (59%), Gaps = 5/194 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + +R   ++VGGT LYF+ L   LS +PE  T IR+ +  + K  G   L+ +L+ +D  
Sbjct: 89  WARRREVLLVGGTMLYFKGLIEGLSSLPESQTEIRQSLELERKSKGLRYLYQQLNEMDQE 148

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSALKE 126
            A++I+P+D QRI RALE+ +++G+   E  K +      LE   K+  L    RS L  
Sbjct: 149 SAQKINPNDQQRIFRALEVIMITGRKYSELVKTS--KVGGLEEKLKLCALVPNNRSILHN 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            I  RF QML+ G +DE+++L K  NL+ +   ++++G R     L G+I+YDE +++GI
Sbjct: 207 NIELRFKQMLDQGFLDEVQNLRKNPNLTKETTAIRSVGYRQAWEYLDGDISYDEFVEKGI 266

Query: 186 IATNKYAKRQKTWL 199
           +AT + AKRQ TW+
Sbjct: 267 VATRQLAKRQLTWI 280


>gi|239977567|sp|B9KRT8|MIAA_RHOSK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 314

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF ALT  L+ +P  P  +R +   +L + G   L   ++ LD+  A +I 
Sbjct: 121 PVIVGGTGLYFSALTEGLAEIPHTPPEVRAEADARLAEAG---LARMVAELDAETAARID 177

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ +  +  +   P +PL  A  ++I P+ + L +RI  RF  
Sbjct: 178 LQNPARVQRAWEVLRATGRGLARWQAETAPPLLPLSDATALVIRPDPTWLAQRIDSRFNL 237

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA++E+R+ +       LP  +AIG  +++A L+GEI  DE +    +A+ +YAKR
Sbjct: 238 MMADGALEEVRAALP-GWDPTLPSARAIGAPELVAHLRGEIPLDEAVAAAKLASRQYAKR 296

Query: 195 QKTWLCHQFQ 204
           Q+TW  ++ +
Sbjct: 297 QRTWFRNRMR 306


>gi|221639119|ref|YP_002525381.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides KD131]
 gi|221159900|gb|ACM00880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides KD131]
          Length = 328

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 109/190 (57%), Gaps = 4/190 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF ALT  L+ +P  P  +R +   +L + G   L   ++ LD+  A +I 
Sbjct: 135 PVIVGGTGLYFSALTEGLAEIPHTPPEVRAEADARLAEAG---LARMVAELDAETAARID 191

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ +  +  +   P +PL  A  ++I P+ + L +RI  RF  
Sbjct: 192 LQNPARVQRAWEVLRATGRGLARWQAETAPPLLPLSDATALVIRPDPTWLAQRIDSRFNL 251

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA++E+R+ +       LP  +AIG  +++A L+GEI  DE +    +A+ +YAKR
Sbjct: 252 MMADGALEEVRAALP-GWDPTLPSARAIGAPELVAHLRGEIPLDEAVAAAKLASRQYAKR 310

Query: 195 QKTWLCHQFQ 204
           Q+TW  ++ +
Sbjct: 311 QRTWFRNRMR 320


>gi|103486954|ref|YP_616515.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingopyxis
           alaskensis RB2256]
 gi|122985040|sp|Q1GT40|MIAA_SPHAL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|98977031|gb|ABF53182.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingopyxis
           alaskensis RB2256]
          Length = 306

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 112/204 (54%), Gaps = 6/204 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q +    +PI+VGGTGLY R L   ++ +PEI   IRE +R           H  L+  D
Sbjct: 84  QAHAAGRVPILVGGTGLYLRTLLYGIAPVPEIDPHIREAVRA----LPVAQAHAALAEAD 139

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALK 125
              A ++ P+D  R+ARALE+   +G+++   W+QA    I    A   +++LP R  L+
Sbjct: 140 PAAAARLGPADTTRVARALEVVRSTGRTLAS-WQQAREGGIADRVALAPLVLLPPRDWLR 198

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +R   R  +M + GAIDE+ +L+   L  DLP+M+AIGV  I A L G  + DE L    
Sbjct: 199 DRCDVRLVEMFDGGAIDEVEALLARGLDPDLPVMRAIGVPQIAAFLDGTASRDEALAAAQ 258

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT +YAKRQ TW  HQ  A W R
Sbjct: 259 AATRQYAKRQFTWFRHQPPASWPR 282


>gi|315634030|ref|ZP_07889319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           segnis ATCC 33393]
 gi|315477280|gb|EFU68023.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           segnis ATCC 33393]
          Length = 314

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 111/187 (59%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   LS +P     +R +I  K    G   LH ELS +D I A++I
Sbjct: 99  IPLLVGGTMLYYKALLEGLSPLPSADDKVRSEIEAKAALIGWGGLHQELSKIDPISAQRI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           +P+D QRI RALE+  ++G+++ +   Q     +P +     I   +R  L  RI +RF 
Sbjct: 159 NPNDSQRINRALEVFYLTGKTLTQLTAQK-GEALPYDILQFAIAPEQREVLHLRIEQRFH 217

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +M+E G   E+  L +  +L+ +LP ++ +G R +   L+G+ ++DE + RGI AT + A
Sbjct: 218 KMIELGFQQEVEKLYRRPDLNENLPSIRCVGYRQMWEYLRGDYDHDEMVFRGICATRQLA 277

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 278 KRQITWL 284


>gi|58582570|ref|YP_201586.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|58427164|gb|AAW76201.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 354

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 111/202 (54%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRAL   LS +PE   A R  I  +  Q G   LH EL+ +D + A +I
Sbjct: 125 LPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAAQIGWAGLHSELARVDPVAAARI 184

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+  I +W+  P          K+++ P ER+ L  RI RR 
Sbjct: 185 HATDPQRIQRALEVYRISGRP-ISYWQALPPGLRLPVRVLKVVLAPRERAVLHGRIERRL 243

Query: 133 TQMLESG---AIDEIRSLMKMN---LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML  G    ++++R+L +M    + LDLP ++A+G R     L G  +  E   + I 
Sbjct: 244 DAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 303

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +  A W 
Sbjct: 304 ATRQLAKRQLTWLRGELDARWF 325


>gi|146278190|ref|YP_001168349.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|167011779|sp|A4WUI0|MIAA_RHOS5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145556431|gb|ABP71044.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 291

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 5/196 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF +LT  L+ +P  P  +R +    L + G   L   ++ LD   A +I 
Sbjct: 98  PVIVGGTGLYFSSLTNGLADIPHTPPEMRHEADAFLARAG---LSAMVADLDPATAGRID 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ + ++      P +PL     +++ P+R  L ERI RRF  
Sbjct: 155 LRNPARVQRAWEVLRATGRGLADWQAATGAPLLPLAETVALVLRPDRDWLAERIDRRFDL 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+E+GA++E R  +  +    LP  +AIG  +++A LKGE   DE +    +A+ +YAKR
Sbjct: 215 MIEAGALEEARVALA-DWDPALPSSRAIGAPELVAHLKGERTLDEAIAAAKLASRQYAKR 273

Query: 195 QKTWLCHQFQADWIRI 210
           Q+TW  ++ + DW  I
Sbjct: 274 QRTWFRNRMR-DWREI 288


>gi|258405794|ref|YP_003198536.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfohalobium
           retbaense DSM 5692]
 gi|257798021|gb|ACV68958.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfohalobium
           retbaense DSM 5692]
          Length = 314

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTGLY RAL   L+  P IP +IR+K+   ++  G    H  LS LD   A ++
Sbjct: 101 LPVLVGGTGLYLRALVHGLAPTPPIPESIRKKVASVVRHRGRQWAHRVLSRLDPEWAAKV 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ R LE++L +G  + ++ +Q      P  +A  + +  + +AL  R+  R  
Sbjct: 161 HPNDRQRVTRGLEVRLATGTPLSQWHRQQTR--TPRYNALTLGLDTDLAALTPRLESRIR 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +ML++GA DE           D P    IG  +++A+++G+++ +E  +  +  T  YAK
Sbjct: 219 RMLDAGAEDEAHRAWARCPDPDAPGWTGIGCAELLAMIRGQLSREEACRLWLQNTRAYAK 278

Query: 194 RQKTWLCHQFQADWIR 209
           RQ TW   + +  W++
Sbjct: 279 RQMTWFRKESEVFWVQ 294


>gi|304387764|ref|ZP_07369944.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis ATCC 13091]
 gi|254671347|emb|CBA08773.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis alpha153]
 gi|304338240|gb|EFM04370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis ATCC 13091]
          Length = 313

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 110/191 (57%), Gaps = 10/191 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ 
Sbjct: 96  PLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRR 130
           P+D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  
Sbjct: 156 PNDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIAL 211

Query: 131 RFTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RF  MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI AT
Sbjct: 212 RFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQLAKRQLTWL 282


>gi|326316130|ref|YP_004233802.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323372966|gb|ADX45235.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 350

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 106/197 (53%), Gaps = 11/197 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+AL   +  MP    A+R ++  +    G   LH EL+ +D   A ++
Sbjct: 122 LPLLVGGTMLYFKALWDGIDDMPPADAAVRARLEAQAAAEGWPALHAELARVDPPTAARL 181

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-----PERSALKERI 128
            P D QRI RALE+  VSG+ +  F  +A       ++ H  + L      +R+ L ERI
Sbjct: 182 APGDSQRIQRALEVWHVSGRPLSSFHTRAATSGNAADAGHGPMPLFSLEPQDRAWLHERI 241

Query: 129 RRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLK-----GEINYDETLQ 182
            RRF  ML+ G +DE+R L  + +L  DLP M+ +G R     L      G +   E  +
Sbjct: 242 ARRFDAMLDEGFVDEVRRLRARGDLHPDLPSMRCVGYRQAWEALDAEERTGRLPLAELRE 301

Query: 183 RGIIATNKYAKRQKTWL 199
           RGI AT + AKRQ TWL
Sbjct: 302 RGIAATRQLAKRQVTWL 318


>gi|319944427|ref|ZP_08018701.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lautropia
           mirabilis ATCC 51599]
 gi|319742388|gb|EFV94801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lautropia
           mirabilis ATCC 51599]
          Length = 315

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 107/192 (55%), Gaps = 11/192 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY R L   +  +P     IR ++  +  ++G   LH  L++LD I A+++
Sbjct: 94  LPLLVGGTMLYARTLLHPMDDLPGARPDIRARLDAEAAEHGWPYLHQRLATLDPITAQRL 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH---KIIILP--ERSALKERI 128
           H +D QRI RALEI  ++GQ +         P      AH   +I+ L   +RS L  RI
Sbjct: 154 HATDAQRIQRALEIIEITGQPLSTLHAAGQKP-----KAHPDIRIVSLEPGDRSQLHARI 208

Query: 129 RRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            +RF QMLE G IDE++ L  +  L  +LP M+ +G R +  +L GE   D   + G+ A
Sbjct: 209 AQRFAQMLEHGFIDEVKHLHARPELHAELPAMRTVGYRQVWQMLDGERTPDTLFEAGVAA 268

Query: 188 TNKYAKRQKTWL 199
           T + AKRQ TWL
Sbjct: 269 TRQLAKRQLTWL 280


>gi|319638137|ref|ZP_07992900.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa C102]
 gi|317400410|gb|EFV81068.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa C102]
          Length = 313

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 113/191 (59%), Gaps = 10/191 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YF ALT  L+ +P    A+R +++ +  ++G   L+  L  +D I A ++ 
Sbjct: 96  PLIVGGTMMYFHALTEGLNDLPGADAAVRAQLQAEKNEHGLAGLYRRLQEVDPITAGRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFW---KQAPNPFIPLESAHKIIILPE-RSALKERIRR 130
            +D QRI RALE+ L++G+ + + +   KQA     PL     + ++PE R  L  +I +
Sbjct: 156 ANDSQRIERALEVYLLTGKPLSKHFTEQKQA----APLLDLCTVALIPEDRHLLHRQIEK 211

Query: 131 RFTQMLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RF  MLE G +DE+ +L +    L  D+P M+ +G R     L GE +Y+  +++GI+AT
Sbjct: 212 RFLNMLEHGFLDEMHTLRRDYPQLHADMPSMRCVGYRQAWDYLVGETDYESFVEKGIVAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQLAKRQLTWL 282


>gi|91789072|ref|YP_550024.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Polaromonas sp.
           JS666]
 gi|123164670|sp|Q128B6|MIAA_POLSJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91698297|gb|ABE45126.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Polaromonas sp.
           JS666]
          Length = 333

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/201 (38%), Positives = 112/201 (55%), Gaps = 15/201 (7%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+AL   L  MP+   A+R ++  +    G   LH EL+++D + A ++
Sbjct: 100 LPLLVGGTMLYFKALFYGLDDMPKADPAVRAELASEAAAKGWPALHAELATVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK-----IIILP-ERSALKER 127
            P D QRI+RALE+  VSGQ +  F +Q     I  +   +     I + P ERS L  R
Sbjct: 160 APHDSQRISRALEVFRVSGQPLSFFHQQNAAKTIADDGREERTEILISLEPQERSWLHHR 219

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLK--------GEINYD 178
           I  RF  ML +G ++E+++L  + +L+ DLP M+ +G R    LL         G    D
Sbjct: 220 IAERFDAMLAAGFVEEVKTLRARGDLTPDLPSMRCVGYRQAWELLDAQEARSPGGSFPMD 279

Query: 179 ETLQRGIIATNKYAKRQKTWL 199
           E   +GIIAT + AKRQ TWL
Sbjct: 280 ELRDKGIIATRQLAKRQVTWL 300


>gi|161869846|ref|YP_001599015.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis 053442]
 gi|161595399|gb|ABX73059.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis 053442]
          Length = 270

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 110/192 (57%), Gaps = 10/192 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 52  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 111

Query: 74  HPSDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIR 129
            P+D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I 
Sbjct: 112 KPNDSQRIERALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIA 167

Query: 130 RRFTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            RF  MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI A
Sbjct: 168 LRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAA 227

Query: 188 TNKYAKRQKTWL 199
           T + AKRQ TWL
Sbjct: 228 TRQLAKRQLTWL 239


>gi|325916039|ref|ZP_08178329.1| tRNA isopentenyltransferase MiaA [Xanthomonas vesicatoria ATCC
           35937]
 gi|325537715|gb|EGD09421.1| tRNA isopentenyltransferase MiaA [Xanthomonas vesicatoria ATCC
           35937]
          Length = 327

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 108/202 (53%), Gaps = 8/202 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYFRA+   LS +PE    +R  I  + +Q G   LH +L  +D I A +I
Sbjct: 98  LPILAGGTGLYFRAVLEGLSQLPEADPTVRAAIAAEAEQVGWAGLHAQLRRIDPIAAARI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           H +D QRI RALE+  +SG+ I  +    P P +PL    KI++ P +R+ L  RI +R 
Sbjct: 158 HATDPQRIQRALEVYRLSGRPISHWQALPPGPRLPLR-VLKIVLAPQDRAVLHARIAQRL 216

Query: 133 TQMLESGAIDEI---RSLMKMNL---SLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             ML    + E+   R L +M      LDLP ++A+G R     L G  +  E   + I 
Sbjct: 217 DAMLAQDFLAEVTRLRELPQMRTVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEFRDKAIQ 276

Query: 187 ATNKYAKRQKTWLCHQFQADWI 208
           AT + AKRQ TWL  +    W 
Sbjct: 277 ATRQLAKRQLTWLRGELDTRWF 298


>gi|16126337|ref|NP_420901.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           crescentus CB15]
 gi|21263784|sp|Q9A6J5|MIAA_CAUCR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|13423583|gb|AAK24069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           crescentus CB15]
          Length = 295

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 108/209 (51%), Gaps = 3/209 (1%)

Query: 3   SKKLQRYKKRFLP-IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           ++ L   + R  P I+VGGTGLYFRALT  L+ +P +P   RE         G     + 
Sbjct: 87  TQALAEIQARGKPAIVVGGTGLYFRALTHGLADVPPVPETQREISSLLYAARGETEFREI 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD     +I   D QR+ RA  + + +G+S+   W+    P +   S   +++ P R
Sbjct: 147 LKPLDPEAEARIESGDRQRLVRAHAVAITTGKSLTA-WQTDTKPALAPGSWKGLVLDPPR 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L  R   R   M+E GA+DE+R+L    L   LP +KA+G R+  A L+GE + D+ L
Sbjct: 206 AELYARCDARLAVMVEQGALDEVRALETRGLDPALPALKAVGYREFAAHLRGETSLDQAL 265

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRI 210
                 T +YAKRQ TW  +Q   DW RI
Sbjct: 266 DAARQETRRYAKRQLTWFRNQ-TPDWERI 293


>gi|221235120|ref|YP_002517556.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           crescentus NA1000]
 gi|239977195|sp|B8GXU1|MIAA_CAUCN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|220964292|gb|ACL95648.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           crescentus NA1000]
          Length = 301

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 108/209 (51%), Gaps = 3/209 (1%)

Query: 3   SKKLQRYKKRFLP-IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           ++ L   + R  P I+VGGTGLYFRALT  L+ +P +P   RE         G     + 
Sbjct: 93  TQALAEIQARGKPAIVVGGTGLYFRALTHGLADVPPVPETQREISSLLYAARGETEFREI 152

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD     +I   D QR+ RA  + + +G+S+   W+    P +   S   +++ P R
Sbjct: 153 LKPLDPEAEARIESGDRQRLVRAHAVAITTGKSLTA-WQTDTKPALAPGSWKGLVLDPPR 211

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L  R   R   M+E GA+DE+R+L    L   LP +KA+G R+  A L+GE + D+ L
Sbjct: 212 AELYARCDARLAVMVEQGALDEVRALETRGLDPALPALKAVGYREFAAHLRGETSLDQAL 271

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRI 210
                 T +YAKRQ TW  +Q   DW RI
Sbjct: 272 DAARQETRRYAKRQLTWFRNQ-TPDWERI 299


>gi|288959017|ref|YP_003449358.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azospirillum
           sp. B510]
 gi|288911325|dbj|BAI72814.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azospirillum
           sp. B510]
          Length = 338

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 7/195 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTGLY RAL   LS +P IP A+R     +L   G      EL + D   AR +
Sbjct: 104 LPVVVGGTGLYLRALMQGLSEVPPIPDAVRAAAHARLAVLGGEAFRAELVARDPASAR-L 162

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           +P D  R+ RA E+   +G ++   W+       P +    I++L P R+ L  +   RF
Sbjct: 163 NPGDTTRLTRAWEVLEATGHAL-SHWQGRTAQGAPEDLRFTILVLDPPRTDLYAQCDERF 221

Query: 133 TQMLESGAIDEIRSLMKMN----LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             M+E GA++E+R L  +     L+ DLP++KA+GV ++   L GEI  DE +     +T
Sbjct: 222 GLMMEQGALEEVRRLDSLARERALAPDLPVLKALGVPELRRFLHGEIPLDEAVTLARQST 281

Query: 189 NKYAKRQKTWLCHQF 203
            +YAKRQ TW  HQ 
Sbjct: 282 RRYAKRQVTWFRHQI 296


>gi|160872187|ref|ZP_02062319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsiella
           grylli]
 gi|159120986|gb|EDP46324.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsiella
           grylli]
          Length = 321

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 103/187 (55%), Gaps = 2/187 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF  L   +  +P     IR++++ +    G   LH+ LS +D I A++I
Sbjct: 103 IPLLVGGTMLYFHVLQQGIDALPAANFTIRQQLKTEQATLGLKKLHERLSVIDPIAAQRI 162

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP D QRI RALE+  +SG S+      + N  +P    +  +   +R  L + I  RF 
Sbjct: 163 HPHDSQRIFRALEVAQLSGNSLTALQTTSSNT-LPYYFINIALFPNDRYRLHQTIADRFQ 221

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML  G ++E+ +L K  +L  DLP ++ +G R +   L+G  +Y     R IIAT + A
Sbjct: 222 TMLAQGFLEEVETLFKRDDLHTDLPAIRTVGYRHLWNYLQGTFSYAHMKDRAIIATRQLA 281

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 282 KRQLTWL 288


>gi|212703402|ref|ZP_03311530.1| hypothetical protein DESPIG_01445 [Desulfovibrio piger ATCC 29098]
 gi|212673147|gb|EEB33630.1| hypothetical protein DESPIG_01445 [Desulfovibrio piger ATCC 29098]
          Length = 304

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 112/205 (54%), Gaps = 4/205 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGTGLYF+ L   ++ +P I  AI   +  +L + G   LH EL++ D   A +I
Sbjct: 96  VPLLVGGTGLYFQGLLHGIAEIPAIDPAITAALTARLAEEGPAALHAELAASDPAYAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
           HP+D QRI RALE+   +G +   +W +   P  P   A  +++L  E  AL  R+ RR 
Sbjct: 156 HPNDRQRIVRALEVLAGTGHT-FSWWHEHGMPEPP--CAGPLLVLDMELDALTPRLARRI 212

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             MLE GA+DE R+  +       P    IG  +++A L+GE++ +E  +  +  T  YA
Sbjct: 213 DLMLEQGALDEARAARQRCDDAAAPGWSGIGCAEVLAHLRGELSLEECRRLWLHNTRAYA 272

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ+TW   + +A +     +D L 
Sbjct: 273 KRQRTWFRARGEARFFAPQDLDGLL 297


>gi|325130077|gb|EGC52864.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis OX99.30304]
 gi|325136129|gb|EGC58738.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M0579]
 gi|325202277|gb|ADY97731.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M01-240149]
 gi|325207970|gb|ADZ03422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis NZ-05/33]
          Length = 313

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 108/188 (57%), Gaps = 4/188 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ 
Sbjct: 96  PLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRFT 133
           P+D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF 
Sbjct: 156 PNDSQRIGRALEVYYLTGKPMSTHLGSPTSHTLPFD-LHTAALIPENRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L ++  +L+ D P ++ +G R     L G+ ++   +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRLYPSLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|253996217|ref|YP_003048281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           mobilis JLW8]
 gi|253982896|gb|ACT47754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           mobilis JLW8]
          Length = 319

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 108/188 (57%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +PE   A+R++I ++    G   +H +L+ +D   A ++
Sbjct: 98  IPVLVGGTMLYFKALEEGLSQLPEADPAVRQQIEQEASALGWPAMHAKLALVDPESAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+S+    + +    +P       ++  +R  L  RI  RF 
Sbjct: 158 QPNDVQRIERALEVYRITGKSMTALHQASSGDTLPYRLLKIALVPSDRKVLHARIALRFE 217

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           +ML  G +DE+++L++    L+ D   M+ +G R  +  L GE +  E   RGI AT + 
Sbjct: 218 KMLAHGFVDEVKALVRKYPALTSDSTSMRCVGYRQALEYLAGEYDATELRDRGIFATRQL 277

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 278 AKRQLTWL 285


>gi|239977578|sp|A9M4D3|MIAA_NEIM0 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 313

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 110/192 (57%), Gaps = 10/192 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIR 129
            P+D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I 
Sbjct: 155 KPNDSQRIERALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIA 210

Query: 130 RRFTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            RF  MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI A
Sbjct: 211 LRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAA 270

Query: 188 TNKYAKRQKTWL 199
           T + AKRQ TWL
Sbjct: 271 TRQLAKRQLTWL 282


>gi|302383593|ref|YP_003819416.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194221|gb|ADL01793.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 293

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (52%), Gaps = 2/194 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGTGLYF AL   L+ +P +P   RE+        G       L++ D      I  
Sbjct: 97  LIVGGTGLYFNALIKGLADIPGVPMEAREEATALYDTEGEAAFRLRLTTFDPPAEAAIEA 156

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RA  +   +G+S+ + W+ +  P +   +  + +I P+R+AL      R   M
Sbjct: 157 GDRQRLTRAYAVARATGRSLSD-WRASTRPLLEPGTYDRRVIEPDRTALYAACDARVVTM 215

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           L++GA+DE+R+L    L   LP MKA+GVR++ A L G++   E       AT  YAKRQ
Sbjct: 216 LKTGALDEVRALSARGLEPALPAMKAVGVRELAAHLAGDLTLAEATVALQQATRNYAKRQ 275

Query: 196 KTWLCHQFQADWIR 209
            TW  +Q  ADW R
Sbjct: 276 LTWFRNQC-ADWPR 288


>gi|82701227|ref|YP_410793.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosospira
           multiformis ATCC 25196]
 gi|123545279|sp|Q2YCX0|MIAA_NITMU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|82409292|gb|ABB73401.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 323

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 109/188 (57%), Gaps = 3/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYF+ L   LS +P   + +R  I  K ++ G   +H EL  LDS+ A +I
Sbjct: 102 IPLLAGGTMLYFKTLLEGLSELPSADSDVRAAIEAKARKSGWPAMHQELFRLDSVSAERI 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P+D QRI RALE+  ++G+ + E  ++  N  +P E   KI ++P  R AL +RI  RF
Sbjct: 162 KPTDSQRIQRALEVFYLTGKPMSETLRKPKNVSLPYEVV-KIALVPGNRQALHQRIACRF 220

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            QML+ G IDE+R++  K  LS + P M+ +G R +   L+   +     +  + AT + 
Sbjct: 221 EQMLKHGLIDEVRAIRDKFYLSDENPSMRCVGYRQVWMHLENATDALRMREMALAATRQL 280

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 281 AKRQLTWL 288


>gi|161525791|ref|YP_001580803.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           multivorans ATCC 17616]
 gi|189349488|ref|YP_001945116.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           multivorans ATCC 17616]
 gi|238687027|sp|A9AGA7|MIAA_BURM1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160343220|gb|ABX16306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           multivorans ATCC 17616]
 gi|189333510|dbj|BAG42580.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           multivorans ATCC 17616]
          Length = 325

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 107/190 (56%), Gaps = 6/190 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++ GGT LY++ALT  L+ +P    A+R ++  +  + G   LH  L+ +D   A ++ 
Sbjct: 102 PLLAGGTMLYYKALTQGLNDLPTADPAVRAELDAEAARDGWPALHARLAQIDPATAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIRR 130
           P+D QRI RALE+ ++SGQ +      AP P     +A++ + +     +R+ L  RI +
Sbjct: 162 PNDAQRIQRALEVFMLSGQPMSALLA-APRPADEAAAAYRFVPVALEPSDRAVLHARIAQ 220

Query: 131 RFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF  ML +G IDE+  L +  +L L LP M+ +G R     L G+I+Y     +GI AT 
Sbjct: 221 RFDAMLAAGFIDEVERLRRRDDLHLGLPSMRCVGYRQAWEFLDGDIDYRTMRDKGIFATR 280

Query: 190 KYAKRQKTWL 199
           +  KRQ TWL
Sbjct: 281 QLCKRQITWL 290


>gi|167037588|ref|YP_001665166.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040250|ref|YP_001663235.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X514]
 gi|256750827|ref|ZP_05491712.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914334|ref|ZP_07131650.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X561]
 gi|307724430|ref|YP_003904181.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X513]
 gi|320116003|ref|YP_004186162.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687563|sp|B0K1A4|MIAA_THEPX RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238687659|sp|B0K9L7|MIAA_THEP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166854490|gb|ABY92899.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X514]
 gi|166856422|gb|ABY94830.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750410|gb|EEU63429.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889269|gb|EFK84415.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X561]
 gi|307581491|gb|ADN54890.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X513]
 gi|319929094|gb|ADV79779.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 315

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 122/211 (57%), Gaps = 9/211 (4%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLDS 67
           YK+  LPIIVGGTGLY  ++   +     E     REK++E    YGS  L+++L S+D 
Sbjct: 89  YKRGKLPIIVGGTGLYINSIIYIMHFSDFEGSKEFREKMKELANTYGSQYLYEKLKSVDP 148

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIII---LPERSAL 124
             A++IHP+D +RI RALE+   +G+ I  + K +     P      I+I     +R  L
Sbjct: 149 EAAKKIHPNDIRRIIRALEVYEFTGKPISYYQKMSGMRLNP--EYQPIMIGLNFRDRQIL 206

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            +RI +R  +M+++  ++E+ +L+K+  + D   M+A+G ++I+  LKGEI+ +E +++ 
Sbjct: 207 YDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTAMQALGYKEIVEYLKGEISLEEAIEKI 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
              T +YAKRQ TW       D+I+   +DD
Sbjct: 267 KKGTRRYAKRQITWFKG---YDFIKWFFVDD 294


>gi|148553532|ref|YP_001261114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           wittichii RW1]
 gi|148498722|gb|ABQ66976.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           wittichii RW1]
          Length = 290

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 108/200 (54%), Gaps = 7/200 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +PEI  AIR ++R    +     L  E  ++       +
Sbjct: 76  LPILVGGTGLYLRTLIFGIAPVPEIDPAIRAEVRALPVEAAHAALAAEDPAMG-----HL 130

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKERIRRRF 132
            P D  RIARALE+   +G+S+   W+      I  E A    I+LP R  L+ R   RF
Sbjct: 131 RPQDATRIARALEVIRSTGRSL-SHWQAELTGGIGGEIAVAAAIVLPPRDWLRARCDARF 189

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML+ GA++E++ L    L   LP M+AIGVR+I A   G I+ +  + +   AT +YA
Sbjct: 190 EAMLDQGAVEEVKKLRARGLDPMLPAMQAIGVREIAAWQDGLIDRETMVAKAQAATRQYA 249

Query: 193 KRQKTWLCHQFQADWIRISS 212
           KRQ TW  HQ  A W RI +
Sbjct: 250 KRQYTWFRHQPPAAWQRIDT 269


>gi|294507512|ref|YP_003571570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber M8]
 gi|294343840|emb|CBH24618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber M8]
          Length = 333

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGG  LY  AL   L+ +P++   +R+++ ++L+  G   L++EL  +D   A +  
Sbjct: 112 PLVVGGATLYLHALQYGLADIPDVDDEVRDELNQRLESEGQDALYEELQQVDPRQAAETD 171

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+  Q++ RALE+   +G+ +  +++  P P  P +    +++  +R  L +RI +R  +
Sbjct: 172 PTKTQKVIRALEVYHGTGKPLSYYYENQPEP--PFDYV-TVVLNRDREKLYDRINQRVDR 228

Query: 135 MLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML++G +DE+R +M ++ + LD P +  IG R+ I  LKG+I+YDE ++     T +YAK
Sbjct: 229 MLDAGLLDEVRDVMDIDGVQLDEPPLSTIGYREPIQHLKGDIDYDEMVRLVKRNTRRYAK 288

Query: 194 RQKTWLCHQFQADW 207
           RQ TW     +  W
Sbjct: 289 RQLTWFRRYDEYHW 302


>gi|295688746|ref|YP_003592439.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           segnis ATCC 21756]
 gi|295430649|gb|ADG09821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter
           segnis ATCC 21756]
          Length = 306

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 104/197 (52%), Gaps = 2/197 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLYFRALT  L+ +P +P   RE         G     + L  LD     +I  
Sbjct: 111 IVVGGTGLYFRALTHGLADVPPVPETQREISGLLYAARGEAEFREILKPLDPEAEARIEI 170

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RA  + + +G+S+   W+    P +   S   +++ P R+ L  R   R + M
Sbjct: 171 GDRQRLVRAHAVAIATGKSLTA-WQTDTKPALEPGSWKGLVLDPPRAELYARCDARLSVM 229

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           LE GA+DE+R++    L   LP +KA+G R+  A L+GE   ++ L      T +YAKRQ
Sbjct: 230 LEQGALDEVRAMEARGLDPSLPALKAVGYREFAAHLRGETTLEQALDAARQETRRYAKRQ 289

Query: 196 KTWLCHQFQADWIRISS 212
            TW  +Q   DW RIS+
Sbjct: 290 LTWFRNQ-TPDWERISA 305


>gi|167041868|gb|ABZ06608.1| putative IPP transferase [uncultured marine microorganism
           HF4000_133G03]
          Length = 307

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 126/218 (57%), Gaps = 2/218 (0%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           +++K  +++ +  +PI+VGG GLYF+ALT  L  +P+IP  +R +IRE  K+ G    ++
Sbjct: 83  VINKMKEQWNQDRIPILVGGAGLYFKALTNGLVKIPDIPNDLRTEIRELHKKIGQKKFYN 142

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
           +L  LD +V + + PSD QR  RA E+K ++ +S+  F K+  + F   +   K+ I   
Sbjct: 143 KLIKLDPLVKKFLLPSDSQRSMRAYEVKKLTNKSLFVFMKKTKSNF-DNKIFKKLFINIP 201

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R  L ++I +R  +M   G + E+++ +KM ++ +L   K IG+++I   + G+I   +T
Sbjct: 202 RELLHKKIDKRVEKMFAEGVVAEVKNFLKMKVNKELSSNKIIGIKEIKDYIDGKITLIKT 261

Query: 181 LQRGIIATNKYAKRQKTWL-CHQFQADWIRISSIDDLF 217
            +   + T +YAKRQ TW   H    + I   + +DLF
Sbjct: 262 KELIKLKTRQYAKRQFTWARGHMRSWEMIYAPNSNDLF 299


>gi|83955544|ref|ZP_00964175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sulfitobacter
           sp. NAS-14.1]
 gi|83840188|gb|EAP79363.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sulfitobacter
           sp. NAS-14.1]
          Length = 296

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 109/196 (55%), Gaps = 11/196 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL-SSLDSIVARQI 73
           PIIVGGTGLYF ALT  L  +P  P A+R          G+ +    +  +LD+  AR+I
Sbjct: 107 PIIVGGTGLYFAALTKGLVDIPPTPDAVRA--------VGNTMTRAAMIDALDAETARRI 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
              +  R+ RA E++  + + +  +    P P +P+E    + +   +  L +RI RRF 
Sbjct: 159 DLYNPMRVQRAWEVQQATRRGLAAWQDDTPPPVLPMERCQAVAVAASKDWLNDRIIRRFD 218

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           QML+ GA+DE+ + ++ +    LP  +AIGV +++  L G    D   Q  IIAT +YAK
Sbjct: 219 QMLDQGALDEV-AAVRPDYDPALPAHRAIGVPELMRYLDGATPLDVARQDAIIATRQYAK 277

Query: 194 RQKTWLCHQFQADWIR 209
           RQ+TW+  +  ADW++
Sbjct: 278 RQRTWM-RKNTADWLQ 292


>gi|225023649|ref|ZP_03712841.1| hypothetical protein EIKCOROL_00512 [Eikenella corrodens ATCC
           23834]
 gi|224943531|gb|EEG24740.1| hypothetical protein EIKCOROL_00512 [Eikenella corrodens ATCC
           23834]
          Length = 317

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 109/189 (57%), Gaps = 4/189 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +Y+ AL   L+ +P     IR +++E+ +Q+G   L+ +L   D   A ++
Sbjct: 98  LPLIVGGTMMYYHALVNGLNSLPAANPEIRRQLQEQKQQHGLPHLYAQLQQADPATAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P D QRI RALE+ L++G+ + + + + P    P+ S   I ++P +R  L   I +RF
Sbjct: 158 KPGDSQRIERALEVWLLTGRPLSQHFAEQPG-ATPMLSLRSIALIPAQRERLHHNIEQRF 216

Query: 133 TQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
             MLE G +DE+  L      L+ D P ++ +G R   A L+GE + +  + +GI AT +
Sbjct: 217 YAMLEQGFLDEVGRLQVQYPELNPDYPAVRCVGYRQAWAHLQGETDRNTFIAQGIAATRQ 276

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 277 LAKRQLTWL 285


>gi|83814321|ref|YP_445622.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber DSM 13855]
 gi|123528774|sp|Q2S2F9|MIAA_SALRD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|83755715|gb|ABC43828.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber DSM 13855]
          Length = 324

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 114/194 (58%), Gaps = 4/194 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGG  LY  AL   L+ +P++   +R+++ ++L+  G   L++EL  +D   A +  
Sbjct: 103 PLVVGGATLYLHALQYGLADIPDVDDEVRDELNQRLESEGQDALYEELQQVDPRQAAETD 162

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+  Q++ RALE+   +G+ +  +++  P P  P +    +++  +R  L +RI +R  +
Sbjct: 163 PTKTQKVIRALEVYHGTGKPLSYYYENQPEP--PFDYV-TVVLNRDREKLYDRINQRVDR 219

Query: 135 MLESGAIDEIRSLMKMN-LSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML++G +DE+R +M ++ + LD P +  IG R+ I  LKG+I+YDE ++     T +YAK
Sbjct: 220 MLDAGLLDEVRDVMDIDGVQLDEPPLSTIGYREPIQHLKGDIDYDEMVRLVKRNTRRYAK 279

Query: 194 RQKTWLCHQFQADW 207
           RQ TW     +  W
Sbjct: 280 RQLTWFRRYDEYHW 293


>gi|323697722|ref|ZP_08109634.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. ND132]
 gi|323457654|gb|EGB13519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans ND132]
          Length = 308

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 106/199 (53%), Gaps = 9/199 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R+L   ++ +PEIP  IR ++ +++   G   LH EL+  D   A +I
Sbjct: 95  LPILVGGTGLYLRSLLTGIAPIPEIPEDIRRQVLDRVAAEGPQALHAELTRTDPDYAAKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW----KQAPNPFIPLESAHKIIILPERSALKERIR 129
           HP+D QR ARA E+ L +G+++  +W    + AP P+  L+   ++ +    + L+  + 
Sbjct: 155 HPNDTQRNARAAEVFLATGRTMT-WWHTESEHAPAPYDALKIGMRLAL----NDLEPLLA 209

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   MLE G +DE R+        D P    IG  +++  L+G +   E  ++ +  T 
Sbjct: 210 ARIDVMLERGGLDEARAAFARCPDPDAPGWTGIGCAELLGFLRGALTLAEAREKWVRNTR 269

Query: 190 KYAKRQKTWLCHQFQADWI 208
            YAKRQ TW   +    W 
Sbjct: 270 AYAKRQLTWFNREADIHWF 288


>gi|239977569|sp|A5V3W0|MIAA_SPHWW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 314

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 108/200 (54%), Gaps = 7/200 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +PEI  AIR ++R    +     L  E  ++       +
Sbjct: 100 LPILVGGTGLYLRTLIFGIAPVPEIDPAIRAEVRALPVEAAHAALAAEDPAMG-----HL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA-HKIIILPERSALKERIRRRF 132
            P D  RIARALE+   +G+S+   W+      I  E A    I+LP R  L+ R   RF
Sbjct: 155 RPQDATRIARALEVIRSTGRSL-SHWQAELTGGIGGEIAVAAAIVLPPRDWLRARCDARF 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             ML+ GA++E++ L    L   LP M+AIGVR+I A   G I+ +  + +   AT +YA
Sbjct: 214 EAMLDQGAVEEVKKLRARGLDPMLPAMQAIGVREIAAWQDGLIDRETMVAKAQAATRQYA 273

Query: 193 KRQKTWLCHQFQADWIRISS 212
           KRQ TW  HQ  A W RI +
Sbjct: 274 KRQYTWFRHQPPAAWQRIDT 293


>gi|71908784|ref|YP_286371.1| tRNA isopentenyltransferase [Dechloromonas aromatica RCB]
 gi|123626743|sp|Q47B80|MIAA_DECAR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71848405|gb|AAZ47901.1| tRNA isopentenyltransferase [Dechloromonas aromatica RCB]
          Length = 314

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 113/194 (58%), Gaps = 1/194 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +Y+RAL   L+ +P+    +R +I  +    G   +H +L+ +D   A ++
Sbjct: 98  VPVLVGGTMMYYRALLHGLADLPQADAELRAEIDAEAAAEGWPAMHAKLALVDPATAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR+ RALEI  ++G+ + E   ++     P +     ++  +R+ L +RI RRF 
Sbjct: 158 HPTDSQRLQRALEICRLTGRPMSELLAESEKQKPPYDLLQIGLLPSDRAVLHQRIARRFD 217

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +ML +G  +E+R L  K  L+L+LP M+ +G R    + +G I   E   RG+ AT + A
Sbjct: 218 EMLLAGLDEEVRQLRQKYELNLNLPSMRCVGYRQTWEMQEGLIPKREWRDRGVFATRQLA 277

Query: 193 KRQKTWLCHQFQAD 206
           KRQ TWL + F A+
Sbjct: 278 KRQITWLTNSFAAE 291


>gi|88798918|ref|ZP_01114500.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Reinekea sp.
           MED297]
 gi|88778398|gb|EAR09591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Reinekea sp.
           MED297]
          Length = 321

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 117/198 (59%), Gaps = 12/198 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYF++L   +S +P     +R +++ +L++ G   L DELS +D     +I
Sbjct: 97  IPLLTGGTMLYFKSLVEPMSDLPPGDDRVRAELQSQLQEQGLTGLLDELSRVDPEAYGRI 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPF---IPLESAHKI-------IILP-ERS 122
              + QR+ RALE+  ++G+ I  FW +  +     +  E+A +        I++P +R+
Sbjct: 157 DHQNPQRVLRALEVFKITGRPISSFWAEGVHDGRGRLSAEAASQFPYRLLQYIVMPQDRT 216

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
            L +RI  RF  MLE G  +E+ +L +  +L LDLP M+++G R +   L G ++YD  +
Sbjct: 217 VLHDRIAHRFRGMLELGFQNEVEALYRRGDLHLDLPSMRSVGYRQMWQYLDGTLDYDNMV 276

Query: 182 QRGIIATNKYAKRQKTWL 199
           +RGIIAT + AKRQ TWL
Sbjct: 277 ERGIIATRQLAKRQLTWL 294


>gi|220905298|ref|YP_002480610.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|239977366|sp|B8J3C2|MIAA_DESDA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219869597|gb|ACL49932.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 323

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 107/201 (53%), Gaps = 2/201 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGTGLYF+ L    + +P +  A+      +L+  GS  +H EL+ +D   A +I
Sbjct: 111 IPLLVGGTGLYFQTLLHGTAEIPPVDPALTAAFTARLEDVGSQAMHAELARVDPDYATRI 170

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+   +G+    + K A +   P  +   +++      L+ R+ RR  
Sbjct: 171 HPNDRQRIVRALEVHAATGKPFTWWHKHAMS--RPPCNGPLLVLDAPLPWLEPRLARRLD 228

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            MLESGA+DE  + +K     D P    IG  + +A L+G + +D      +  T  YAK
Sbjct: 229 MMLESGAMDEAAAALKNCDDDDAPGWTGIGCAEALAFLRGRLGFDACRDLWLRNTRAYAK 288

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TW   + +A W+   ++D
Sbjct: 289 RQLTWFRARPEAVWLPPDNVD 309


>gi|254439899|ref|ZP_05053393.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Octadecabacter
           antarcticus 307]
 gi|198255345|gb|EDY79659.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Octadecabacter
           antarcticus 307]
          Length = 300

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 106/185 (57%), Gaps = 8/185 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  L+ +P  P  IR K         +  L D +S+LD   A  + 
Sbjct: 102 PIIVGGTGLYFTALTEGLAEIPPTPAHIRTKAD-------ATPLPDLVSALDPATAAGLD 154

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E++  +G+SI ++    P P + L+    + ++P+   L  RI +RF  
Sbjct: 155 LNNRARVQRAWEVQQTTGRSIRDWQDATPQPLLALKDCTALALMPDVDWLNARIEQRFAM 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+++GA+ E ++++  N     P  KAIG  ++I LL G+I  D   +  IIAT +YAKR
Sbjct: 215 MMDAGAMIEAKAMVP-NWDPAAPSSKAIGAAEMIQLLHGDITRDSAREAIIIATRQYAKR 273

Query: 195 QKTWL 199
           Q+TW+
Sbjct: 274 QRTWV 278


>gi|237745901|ref|ZP_04576381.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes HOxBLS]
 gi|229377252|gb|EEO27343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes HOxBLS]
          Length = 313

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 117/207 (56%), Gaps = 17/207 (8%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           ++S+  QR K   LP++ GGT LYF+ALTG L  +P    AIR ++ E+  + G   +H 
Sbjct: 87  LISEIQQRGK---LPLLAGGTMLYFKALTGGLDELPPANPAIRARLDEEAARTGWPAMHK 143

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFW---KQAPNPF--IPLESAHKI 115
            L+ LD I AR++ P+D QRI RALEI  ++G+ +  F    KQ   PF  IP      I
Sbjct: 144 RLAELDPITARRLKPNDSQRIQRALEIIELTGKPLSTFHSGEKQTRLPFRLIP------I 197

Query: 116 IILP-ERSALKERIRRRFTQMLESGA-IDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLK 172
            + P +RS L ERI  RF QMLE+   I+E+  L  + +L   +P M+ +G R     L 
Sbjct: 198 ALEPSDRSKLHERIAHRFDQMLENDRLIEEVAHLRSRDDLHPGMPSMRCVGYRQTWQYLD 257

Query: 173 GEINYDETLQRGIIATNKYAKRQKTWL 199
           GE +      +GI AT + AKRQ TWL
Sbjct: 258 GEFDRKTLRDKGIAATRQLAKRQLTWL 284


>gi|89069567|ref|ZP_01156911.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanicola
           granulosus HTCC2516]
 gi|89044902|gb|EAR50992.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanicola
           granulosus HTCC2516]
          Length = 290

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 109/193 (56%), Gaps = 9/193 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  L+ +P  P  +R +           +L D    LD   A  + 
Sbjct: 98  PIIVGGTGLYFAALTEGLAEIPPTPPGLRAEA----DALPLPVLRD---GLDPATAAGLD 150

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +G+ +  +  + P P +PLE+A  +++ PER  L ERI RRF  
Sbjct: 151 LANRARVQRAWEVLHATGRGMAAWQAETPPPLLPLEAATPLVLRPERDWLAERIARRFDS 210

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           MLE+G ++E R++     S      +AIG  ++IA ++GE++  +     I+A+ +YAKR
Sbjct: 211 MLEAGLVEEARAMEPAWDSAHQ-SARAIGAAEMIAHVRGELSLRQARDAAIVASRQYAKR 269

Query: 195 QKTWLCHQFQADW 207
           Q+TW+  +  ADW
Sbjct: 270 QRTWMRKRM-ADW 281


>gi|285017957|ref|YP_003375668.1| tRNA isopentenyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283473175|emb|CBA15681.1| probable trna isopentenyltransferase protein [Xanthomonas
           albilineans]
          Length = 316

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 102/201 (50%), Gaps = 6/201 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+ GGTGLYF+AL   L+ MP      R  +  + +  G   LH +L  +D + A +I
Sbjct: 98  LPILAGGTGLYFQALLEGLAPMPPADPQFRAALAARARAEGWAALHAQLQRIDPVAAERI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
              D QRI RALE+   SG+ I  +  Q   P +PL     ++   +RS L  RI  RF 
Sbjct: 158 RSGDAQRIQRALEVYQHSGRPISAWQAQPRPPRLPLRVLKLVLAPTDRSVLHRRIEARFD 217

Query: 134 QMLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
            ML  G +DE+R+L  +         L LP ++A+G R     L GE +      RGI A
Sbjct: 218 AMLAQGFLDEVRTLRALPGMRAVEQPLQLPAVRAVGYRQAWEHLDGETDAPTFRARGIAA 277

Query: 188 TNKYAKRQKTWLCHQFQADWI 208
           T + AKRQ TWL  +  A W 
Sbjct: 278 TRQLAKRQLTWLRGELDARWF 298


>gi|240112751|ref|ZP_04727241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
 gi|254493610|ref|ZP_05106781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 1291]
 gi|268598818|ref|ZP_06132985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
 gi|226512650|gb|EEH61995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 1291]
 gi|268582949|gb|EEZ47625.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
          Length = 313

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 102/188 (54%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI  ++G+ +       P   +P E     +I  +R+ L E I  RF 
Sbjct: 155 KPNDSQRIGRALEIYYLTGRPMSAHLNGQPEHTLPFELYTAALIPEDRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|254450728|ref|ZP_05064165.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Octadecabacter
           antarcticus 238]
 gi|198265134|gb|EDY89404.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Octadecabacter
           antarcticus 238]
          Length = 300

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 117/211 (55%), Gaps = 11/211 (5%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           YK    PIIVGGTGLYF ALT  L+ +P  P  IR K         +  L D +S+LD  
Sbjct: 96  YKTGARPIIVGGTGLYFTALTEGLAEIPPTPAGIRAKAD-------AIPLPDLVSALDPA 148

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A  +  ++  R+ RA E++  +G+SI ++    P   + LE    + ++P+   L  RI
Sbjct: 149 TAAGLDLNNRARVQRAWEVQQTTGRSIRDWQDATPPSLLALEECTALALMPDVEWLNARI 208

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           + R+  M+++GA+ E ++++  N     P  KAIG  ++I L+ G+I  D   +  IIAT
Sbjct: 209 QTRYAIMMDAGAMAEAKAMVP-NWDQTAPSSKAIGAAEMIQLIGGDITPDSAREAIIIAT 267

Query: 189 NKYAKRQKTWLCHQFQADW--IRISSIDDLF 217
            +YAKRQ+TWL  + +  W  + + ++DD+ 
Sbjct: 268 RQYAKRQRTWLRSRMK-RWQTVALPNVDDVI 297


>gi|186477235|ref|YP_001858705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           phymatum STM815]
 gi|239977199|sp|B2JGD1|MIAA_BURP8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|184193694|gb|ACC71659.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           phymatum STM815]
          Length = 317

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 106/191 (55%), Gaps = 6/191 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++ALT  L+ +P     +R  +     + G   LH  L+++D++ A ++
Sbjct: 98  VPLLVGGTMLYYKALTQGLNDLPAADPEVRATLDADAAREGWPALHARLAAVDAVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIR 129
            P+D QRI RALE+ +++GQ +      AP     L   ++ + +     +RS L  RI 
Sbjct: 158 APNDSQRIQRALEVFMLTGQPMSALLA-APARSDDLAKGYRFVPIALEPSDRSVLHARIA 216

Query: 130 RRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RF  ML  G IDE+R L  + +L   LP M+ +G R     L GE +YD    +G+ AT
Sbjct: 217 QRFDAMLAKGFIDEVRRLRARGDLHPGLPAMRCVGYRQAWEYLDGETDYDTMRDKGVFAT 276

Query: 189 NKYAKRQKTWL 199
            +  KRQ TWL
Sbjct: 277 RQLCKRQLTWL 287


>gi|33591484|ref|NP_879128.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           pertussis Tohama I]
 gi|33603033|ref|NP_890593.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           bronchiseptica RB50]
 gi|46576931|sp|Q7U366|MIAA_BORPE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|46576933|sp|Q7U383|MIAA_BORBR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33568664|emb|CAE34422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           bronchiseptica RB50]
 gi|33571126|emb|CAE40623.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           pertussis Tohama I]
          Length = 313

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 114/199 (57%), Gaps = 17/199 (8%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   L  +P+   A+R ++  +  + G   LH EL+ LD   A ++
Sbjct: 95  IPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----QAPNPF----IPLESAHKIIILPERSAL 124
            P+D QRI RALEI  ++GQ +    +      AP+P+    + LE +       ER+AL
Sbjct: 155 SPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPS-------ERAAL 207

Query: 125 KERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
             RI +RF  ML +G ++E+R L  + +L   LP ++ +G R + + L G+I+ D   ++
Sbjct: 208 HARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQ 267

Query: 184 GIIATNKYAKRQKTWLCHQ 202
           G+ AT + AKRQ TWL  Q
Sbjct: 268 GVAATRQLAKRQLTWLRAQ 286


>gi|118444282|ref|YP_878180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           novyi NT]
 gi|239977395|sp|A0Q0M8|MIAA_CLONN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|118134738|gb|ABK61782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           novyi NT]
          Length = 314

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 113/199 (56%), Gaps = 8/199 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLK----QYGSHILHDELSSLDSIV 69
           LP+IVGGTG Y  +L           T   E+ RE LK    ++G   +H+ L  +D + 
Sbjct: 94  LPMIVGGTGFYIDSLIFNYDFAN---TYKDEEYREHLKNLASEHGKEYVHELLKDIDEVS 150

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
            ++++P+D +R+ RALE+  ++G++I EF K+     IP  + +  ++  +RS L ERI 
Sbjct: 151 YKKLYPNDLKRVIRALEVFKLTGKTISEFNKEQDIFDIPY-NVYYFVLNMDRSKLYERIN 209

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           +R   M+E G I+E++SL  M  + D+  MK IG ++I+  L G+++ DE ++     + 
Sbjct: 210 KRVDIMMEKGLIEEVKSLQNMGCTPDMQSMKGIGYKEILYYLDGKLSLDEAVELIKKGSR 269

Query: 190 KYAKRQKTWLCHQFQADWI 208
            YAKRQ TW     + +WI
Sbjct: 270 HYAKRQLTWFRKDNRVNWI 288


>gi|307728545|ref|YP_003905769.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. CCGE1003]
 gi|307583080|gb|ADN56478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. CCGE1003]
          Length = 319

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R ++     + G   LH  L+++D   A ++
Sbjct: 100 LPLLVGGTMLYYKALTQGLNDLPAADATVRAQLDADAARDGWPALHARLAAVDPATAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP------ERSALKER 127
            P+D QRI RALE+ L++G+ +         P    E+A +   +P      ERS L  R
Sbjct: 160 APNDSQRIQRALEVFLLTGEPMSALLAA---PARSDEAAAQWQFVPIALEPSERSVLHAR 216

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML +G +DE+  L  + +LS D+P M+ +G R +   L G ++Y     +G+ 
Sbjct: 217 IEQRFDAMLANGFVDEVVKLRARGDLSPDMPSMRCVGYRQVWEYLDGAVDYSTMRDKGVF 276

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 277 ATRQLCKRQLTWL 289


>gi|291613847|ref|YP_003524004.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sideroxydans
           lithotrophicus ES-1]
 gi|291583959|gb|ADE11617.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sideroxydans
           lithotrophicus ES-1]
          Length = 341

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 114/218 (52%), Gaps = 32/218 (14%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P+    +R K+ E + Q+G   LH  L+ +D+  A ++
Sbjct: 96  IPLLVGGTMLYFKALREGLSPLPQADAEVRIKLDEIIAQHGIEHLHARLAEVDAETAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH-------------------- 113
           H +D QRI RA+EI LVSGQ +    K++P+P    E+                      
Sbjct: 156 HATDTQRIQRAMEIYLVSGQPMSVLIKKSPSPQPSDETTSHSTKPASGQVAGYPEGRGSQ 215

Query: 114 ----------KIIILP-ERSALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKA 161
                      I ++P +R+ L +RI  RF  ML+ G + E+R L  K  L  D+  M+ 
Sbjct: 216 FAGDLPYRILSIALIPSDRAVLHQRIATRFADMLQQGLVAELRGLRAKYPLHRDMTSMRC 275

Query: 162 IGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWL 199
           +G R     L+ EI   E L++GI AT + AKRQ TWL
Sbjct: 276 VGYRQAWEYLESEITESELLEKGIAATRQLAKRQLTWL 313


>gi|59801335|ref|YP_208047.1| putative tRNA delta transferase [Neisseria gonorrhoeae FA 1090]
 gi|240117797|ref|ZP_04731859.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|268603496|ref|ZP_06137663.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|293399194|ref|ZP_06643359.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae F62]
 gi|75507369|sp|Q5F852|MIAA_NEIG1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|59718230|gb|AAW89635.1| putative tRNA delta transferase [Neisseria gonorrhoeae FA 1090]
 gi|268587627|gb|EEZ52303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|291610608|gb|EFF39718.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae F62]
          Length = 313

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 102/188 (54%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +       P   +P E     +I  +R+ L E I  RF 
Sbjct: 155 KPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFELYTAALIPEDRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|33598140|ref|NP_885783.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           parapertussis 12822]
 gi|46576932|sp|Q7U372|MIAA_BORPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33566698|emb|CAE38908.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           parapertussis]
          Length = 313

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 114/199 (57%), Gaps = 17/199 (8%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   L  +P+   A+R ++  +  + G   LH EL+ LD   A ++
Sbjct: 95  IPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----QAPNPF----IPLESAHKIIILPERSAL 124
            P+D QRI RALEI  ++GQ +    +      AP+P+    + LE +       ER+AL
Sbjct: 155 SPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPS-------ERAAL 207

Query: 125 KERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
             RI +RF  ML +G ++E+R L  + +L   LP ++ +G R + + L G+I+ D   ++
Sbjct: 208 HARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQ 267

Query: 184 GIIATNKYAKRQKTWLCHQ 202
           G+ AT + AKRQ TWL  Q
Sbjct: 268 GVAATRQLAKRQLTWLRAQ 286


>gi|121604063|ref|YP_981392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Polaromonas
           naphthalenivorans CJ2]
 gi|239977433|sp|A1VLE3|MIAA_POLNA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120593032|gb|ABM36471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Polaromonas
           naphthalenivorans CJ2]
          Length = 331

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 10/209 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           L ++VGGT LYF+AL   L  MP+   A+R  +  +  + G   LH EL+ +D + A ++
Sbjct: 107 LALLVGGTMLYFKALFDGLDEMPKADAAVRAVLAIEAAEKGWPALHAELAQVDPVTAARL 166

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLE----SAHKIIIL--PERSALKER 127
            P+D QRI+RALE+  VSGQ +  F ++  +  I       SA  +I L   +R+ L  R
Sbjct: 167 APNDSQRISRALEVFRVSGQPLSFFQQRNASKNIADNAGGTSAATLISLEPTDRAWLHGR 226

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML SG +DE+R+L  + +L+ DLP M+ +G R     L G     E   +G+ 
Sbjct: 227 IAQRFDAMLASGFVDEVRALRARGDLTPDLPAMRCVGYRQAWEALDGTSPMSELRDKGVF 286

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           AT + AKRQ TWL    Q    R+ + DD
Sbjct: 287 ATRQLAKRQITWLRSMPQR---RVVACDD 312


>gi|260426142|ref|ZP_05780121.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citreicella sp.
           SE45]
 gi|260420634|gb|EEX13885.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citreicella sp.
           SE45]
          Length = 321

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 106/192 (55%), Gaps = 5/192 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLYF ALT  L+ +P  P A+R++   +L       + +EL   DS    +I  
Sbjct: 125 IVVGGTGLYFSALTEGLAEIPPTPPAVRDEAMARLDAGERAAMVEEL---DSDTRVRIDT 181

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           ++  R+ RA E+   +G+ I  +  + P P +PL  A  I+    +  L  RI  RF +M
Sbjct: 182 ANPMRVQRAWEVLRSTGRGIAAWQDETPPPLLPLSEAQPIVFDAPKDWLSPRIETRFRKM 241

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +  GA+DE R+ +    +  LP  KAIG  ++I  L+GE+  D+ + R  + T ++AKRQ
Sbjct: 242 VREGALDEARANLA-TWTPALPSAKAIGAAELIGHLRGEMTLDDAIDRATVLTRQFAKRQ 300

Query: 196 KTWLCHQFQADW 207
           +TW   + + DW
Sbjct: 301 RTWFRARMR-DW 311


>gi|218768020|ref|YP_002342532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis Z2491]
 gi|11386931|sp|Q9JUU5|MIAA_NEIMA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|121052028|emb|CAM08337.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Neisseria meningitidis Z2491]
          Length = 313

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 109/191 (57%), Gaps = 10/191 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ 
Sbjct: 96  PLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRLK 155

Query: 75  PSDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRR 130
           P+D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  
Sbjct: 156 PNDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIAL 211

Query: 131 RFTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           RF  MLE G I E+ +L +   +L+ D P ++ +G R     L G  +    +++GI AT
Sbjct: 212 RFHLMLEQGFIGEVENLRRRYPSLTADSPAIRCVGYRQAWEYLDGATDRQTFIEKGIAAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQLAKRQLTWL 282


>gi|187477233|ref|YP_785257.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           avium 197N]
 gi|123752222|sp|Q2KX23|MIAA_BORA1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115421819|emb|CAJ48335.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           avium 197N]
          Length = 312

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 4/192 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   L  +P+    +R ++  +    G   LH EL+  D I A ++
Sbjct: 95  IPLLAGGTMLYYKALREGLDDLPQADPVLRAELEARAANEGWPALHAELARHDPITAARL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSALKERIRRR 131
            P+D QRI RALE+ L+SG+++         P  P +     I L   +R+ L  RI +R
Sbjct: 155 SPNDSQRIQRALEVCLLSGRAMSALLTGTRRP-APSDLRFVTISLEPSDRAGLHARIAQR 213

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  ML++G   E+RSL  + +L   LP ++ +G R + A L GE+++DE  ++GI AT +
Sbjct: 214 FDAMLQAGLEAEVRSLKQRTDLHPGLPSVRCVGYRQMWAYLDGEVSFDEAREQGIAATRQ 273

Query: 191 YAKRQKTWLCHQ 202
            AKRQ TWL  Q
Sbjct: 274 LAKRQLTWLRAQ 285


>gi|126666950|ref|ZP_01737926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           sp. ELB17]
 gi|126628666|gb|EAZ99287.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           sp. ELB17]
          Length = 352

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 123/230 (53%), Gaps = 30/230 (13%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF+AL   +S +P     +R+++ ++ +  G   LH EL++ D + AR I
Sbjct: 107 IPLLVGGTMMYFKALLHGMSDLPSANPRVRKQLVQEAQLQGWDALHQELAAADPVAARLI 166

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-------PLESAH------------- 113
           HP++ QR+ RALE+  ++GQ I  FW QAP   I       P ++ +             
Sbjct: 167 HPNNRQRLIRALEVLRLTGQPISSFW-QAPPAVIANTPDTKPADNENYTYFTGWQADAGS 225

Query: 114 -------KIIILP-ERSALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGV 164
                  ++++ P +R  L +RI +RF  ML++G + E+  LM + +L   +P M+ +G 
Sbjct: 226 SLPYTISQLVVAPLQRQILHDRIYQRFLAMLDAGLLSEVEGLMARGDLEPSMPSMRCVGY 285

Query: 165 RDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           R     L G+ ++   + +G+ AT + AKRQ TWL     A W+   + D
Sbjct: 286 RQAWEYLSGQCDHTAFVDKGVAATRQLAKRQLTWLRKWPDALWLDSDNKD 335


>gi|325128106|gb|EGC51001.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis N1568]
          Length = 313

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 105/189 (55%), Gaps = 4/189 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
            P+D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF
Sbjct: 155 KPNDSQRIERALEVYYLTGKPMSAHLGSPTSHTLPFD-LHTAALIPENRARLHENIALRF 213

Query: 133 TQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
            QMLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT +
Sbjct: 214 RQMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGATDRQTFIEKGIAATRQ 273

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 274 LAKRQLTWL 282


>gi|240080886|ref|ZP_04725429.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae FA19]
 gi|268597003|ref|ZP_06131170.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae FA19]
 gi|268550791|gb|EEZ45810.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae FA19]
          Length = 313

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 101/188 (53%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +       P   +P E     +I   R+ L E I  RF 
Sbjct: 155 KPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFELYTAALIPENRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|194098423|ref|YP_002001482.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae NCCP11945]
 gi|239998825|ref|ZP_04718749.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 35/02]
 gi|240014260|ref|ZP_04721173.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae DGI18]
 gi|240016696|ref|ZP_04723236.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae FA6140]
 gi|240121823|ref|ZP_04734785.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID24-1]
 gi|240123351|ref|ZP_04736307.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID332]
 gi|240125600|ref|ZP_04738486.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|240128055|ref|ZP_04740716.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|260440687|ref|ZP_05794503.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae DGI2]
 gi|268594668|ref|ZP_06128835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 35/02]
 gi|268681976|ref|ZP_06148838.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID332]
 gi|268684188|ref|ZP_06151050.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268686444|ref|ZP_06153306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291043997|ref|ZP_06569713.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae DGI2]
 gi|238690194|sp|B4RL47|MIAA_NEIG2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|193933713|gb|ACF29537.1| putative tRNA delta transferase [Neisseria gonorrhoeae NCCP11945]
 gi|268548057|gb|EEZ43475.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 35/02]
 gi|268622260|gb|EEZ54660.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID332]
 gi|268624472|gb|EEZ56872.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626728|gb|EEZ59128.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291012460|gb|EFE04449.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae DGI2]
 gi|317164114|gb|ADV07655.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 313

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 101/188 (53%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +       P   +P E     +I   R+ L E I  RF 
Sbjct: 155 KPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFELYTAALIPENRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|167647311|ref|YP_001684974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter sp.
           K31]
 gi|189081946|sp|B0T4U9|MIAA_CAUSK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167349741|gb|ABZ72476.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Caulobacter sp.
           K31]
          Length = 309

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 107/198 (54%), Gaps = 2/198 (1%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLYFRALT  L+ +P +    RE         G     D L++LD     +I  
Sbjct: 97  IVVGGTGLYFRALTHGLADIPPVSETQREVSALLYAAQGEPEFRDVLAALDPEAEARIEI 156

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            D QR+ RA  + + +G+S+   W+    P +   +   +++ P R+ L +R   R   M
Sbjct: 157 GDRQRLLRAHAVAIATGKSLTA-WQTDTKPTLADGTWTGLVLDPPRAQLYDRCDARLGLM 215

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E GA+DE+R++    L   LP +KA+G R++ A L+GE + D+ L      T +YAKRQ
Sbjct: 216 VERGALDEVRAMEARGLEPALPALKALGYRELAAHLRGETSLDQALDAARQETRRYAKRQ 275

Query: 196 KTWLCHQFQADWIRISSI 213
            TW  +Q   DW R+ ++
Sbjct: 276 MTWFRNQ-TPDWERVETL 292


>gi|134093679|ref|YP_001098754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Herminiimonas
           arsenicoxydans]
 gi|239977399|sp|A4G288|MIAA_HERAR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|133737582|emb|CAL60625.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) (Isopentenyl-diphosphate:tRNA
           isopentenyltransferase) (IPTase) (IPPT) [Herminiimonas
           arsenicoxydans]
          Length = 320

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 103/188 (54%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           L ++VGGT LYF+ L   L  +P+   A+R ++  +    GS  +H +L+ LD I A ++
Sbjct: 101 LALLVGGTMLYFKGLKDGLDALPQADAALRAELDAEAALIGSPAMHAKLAKLDPITAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI  ++GQ +     QAP   +P       +   ERS L  RI  RF 
Sbjct: 161 KPNDTQRIQRALEIITLTGQPMSALLAQAPKSELPFTLLPIALEPSERSVLHARIATRFD 220

Query: 134 QMLESGA-IDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            ML+ G  +DE+R+L  + +L   LP M+ +G R     L G     E  ++GI AT + 
Sbjct: 221 AMLKDGGLLDEVRALRARGDLHPGLPSMRCVGYRQSWEYLDGAYGLAELREKGIAATRQL 280

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 281 AKRQLTWL 288


>gi|218667239|ref|YP_002426337.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|239977157|sp|B7JC25|MIAA_ACIF2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218519452|gb|ACK80038.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 339

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 106/197 (53%), Gaps = 10/197 (5%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
           L R + R +P++VGGTGLYFRAL   +  +P    A+R+ +    +  G   LH  L++L
Sbjct: 110 LARERGR-IPLLVGGTGLYFRALECGIDTLPPANPALRQSLMALAETAGWPALHQRLATL 168

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSI--IEFWKQA-PNPFIPLESAHKIIILPERS 122
           D   A  I P D QRI RALEI L SGQ+I     W+   P P       +KII+ P RS
Sbjct: 169 DPEAAAGIAPHDRQRIQRALEIILGSGQTISGARHWQGTFPGPL------YKIILRPPRS 222

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L +RI +RF  ML  G +DEI  L   + + +LP M+A+G R       G  +  E  Q
Sbjct: 223 WLHQRITQRFDVMLNEGFLDEIADLSARHYAPELPAMRAVGYRQYFTWHDGLCSAAEAYQ 282

Query: 183 RGIIATNKYAKRQKTWL 199
             + AT + AKRQ TW 
Sbjct: 283 AALAATRQLAKRQDTWF 299


>gi|254369243|ref|ZP_04985255.1| hypothetical protein FTAG_00196 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122193|gb|EDO66333.1| hypothetical protein FTAG_00196 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 308

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 111/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IRE +  + K  G   LH +L+ +D   A++I+ 
Sbjct: 96  LLVGGTMLYFKGLIEGLSALPESQAEIREALEYQKKAKGLQYLHQQLNEIDPQSAQKINH 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ ++SG+   E  K +    +  +     ++  +RS L + I  RF QM
Sbjct: 156 NDQQRIFRALEVIMISGKKYSELVKTSKVGGLDEDLKLCALVPNDRSILHKNIESRFRQM 215

Query: 136 LESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE+++L K   L+ +   ++++G R     L G+I+YDE +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQNLHKNPMLTKETTAIRSVGYRQAWEYLDGDISYDEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|198283708|ref|YP_002220029.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|239977158|sp|B5EJE8|MIAA_ACIF5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|198248229|gb|ACH83822.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
          Length = 315

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 106/197 (53%), Gaps = 10/197 (5%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
           L R + R +P++VGGTGLYFRAL   +  +P    A+R+ +    +  G   LH  L++L
Sbjct: 86  LARERGR-IPLLVGGTGLYFRALECGIDTLPPANPALRQSLMALAETAGWPALHQRLATL 144

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSI--IEFWKQA-PNPFIPLESAHKIIILPERS 122
           D   A  I P D QRI RALEI L SGQ+I     W+   P P       +KII+ P RS
Sbjct: 145 DPEAAAGIAPHDRQRIQRALEIILGSGQTISGARHWQGTFPGPL------YKIILRPPRS 198

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L +RI +RF  ML  G +DEI  L   + + +LP M+A+G R       G  +  E  Q
Sbjct: 199 WLHQRITQRFDVMLNEGFLDEIADLSARHYAPELPAMRAVGYRQYFTWHDGLCSAAEAYQ 258

Query: 183 RGIIATNKYAKRQKTWL 199
             + AT + AKRQ TW 
Sbjct: 259 AALAATRQLAKRQDTWF 275


>gi|152984449|ref|YP_001350993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PA7]
 gi|166215166|sp|A6VD58|MIAA_PSEA7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150959607|gb|ABR81632.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PA7]
          Length = 323

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 115/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  +  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAALEAEARAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  V G S+ E           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRVGGVSMSELRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|34580437|ref|ZP_00141917.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           sibirica 246]
 gi|28261822|gb|EAA25326.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           sibirica 246]
          Length = 363

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 108/192 (56%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++E++R    + G+  L  +L   D + A +I
Sbjct: 149 LPILIGGTGLYINSLVFGYNNIPDISADLQEQVRNLHVKIGNIELWSKLEKFDPLAASKI 208

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ + +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 209 NQNDTQRLIRAYEVFMQTGKSIFSF-QTLPKEQILSDFNFKIIFLNPERKFLYKTCDERL 267

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K     D   +KA+G+++I+A L G +  DE L    I T +YA
Sbjct: 268 DKIFKEGAIDEIALIKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYA 327

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q Q
Sbjct: 328 KRQVTWFKNQIQ 339


>gi|90416480|ref|ZP_01224411.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2207]
 gi|90331679|gb|EAS46907.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2207]
          Length = 317

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 112/190 (58%), Gaps = 5/190 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS MP     IR +I E  + +G   +H++L ++D   A  +
Sbjct: 86  IPLLVGGTMLYFKALLEGLSDMPSADADIRAEILEHAEAFGWASVHEQLRAVDPESAASL 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA--HKIIILP-ERSALKERIRR 130
           HP+  QRI RALE+  +SG   +   +  PN     ES    +I +LP  R  +  RI+ 
Sbjct: 146 HPNHSQRIQRALEVYRISGVP-MSVLRSEPNVGGVAESYGIKQIALLPNNRKLIHNRIKV 204

Query: 131 RFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF +M+  G   E+R+L  + +L  DLP ++++G R +   ++G  + DE +++GIIAT 
Sbjct: 205 RFGKMMADGFEAEVRALFQRGDLHEDLPAIRSVGYRQLWQHMQGHCSLDEAVEKGIIATR 264

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 265 QLAKRQITWL 274


>gi|297538673|ref|YP_003674442.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           sp. 301]
 gi|297258020|gb|ADI29865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           sp. 301]
          Length = 313

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 111/188 (59%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +PE    +R ++ ++    G   +H++L+ +D + A ++
Sbjct: 96  IPLLVGGTMLYFKALQEGLSGLPEANQEVRARLDKRAAFIGWPAMHEKLALVDPVTAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+++   + +  +  +P +     ++  +R  L ERI  RF 
Sbjct: 156 EPNDTQRIQRALEVFELTGEAMSALYAKQTSEVLPYKLLKIALVPSDRKVLHERIAIRFD 215

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           QML+ G +DE++ L+    +L+ +   M+ +G R  +  L GE +  E   RGI AT + 
Sbjct: 216 QMLKDGFVDEVKVLIAKYPSLTPESTSMRCVGYRQALEHLAGEYDLAELRDRGIFATRQL 275

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 276 AKRQLTWL 283


>gi|110679815|ref|YP_682822.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter
           denitrificans OCh 114]
 gi|122972730|sp|Q166F7|MIAA_ROSDO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|109455931|gb|ABG32136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter
           denitrificans OCh 114]
          Length = 279

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/186 (36%), Positives = 107/186 (57%), Gaps = 10/186 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE-LSSLDSIVARQI 73
           PIIVGGTGLYF ALT  L+ +P  P  IR K        G  +   E L++LD+    +I
Sbjct: 91  PIIVGGTGLYFTALTRGLADIPPTPAEIRAK--------GDRLERAEMLAALDARTRDRI 142

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             ++  R+ RA E+++ +G+ +  +  +   P +PL +A  I+   ++  L  RI +RF 
Sbjct: 143 DNANRARVQRAWEVQMATGRGLAAWQDETGAPALPLSAAQAIVFDVDKEVLNARIEKRFD 202

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML +GA++E R ++  +    LP  +AIG  ++IA LKG+I+ +   +  I AT +YAK
Sbjct: 203 LMLAAGALEEARRVLP-DYDPTLPAHRAIGAPELIAHLKGQISLEAAREAAITATRQYAK 261

Query: 194 RQKTWL 199
           RQ+TW 
Sbjct: 262 RQRTWF 267


>gi|15892579|ref|NP_360293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           conorii str. Malish 7]
 gi|126302569|sp|Q92HW4|MIAA_RICCN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|15619744|gb|AAL03194.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           conorii str. Malish 7]
          Length = 363

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 108/192 (56%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++E++R    + G+  L  +L   D + A +I
Sbjct: 149 LPILIGGTGLYINSLVFGYNNIPDISEDLQEQVRNLHVKIGNIELWSKLEKFDPLAASKI 208

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ + +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 209 NQNDTQRLIRAYEVFMQTGKSIFSF-QTLPKEQILSDFNFKIIFLNPERKFLYKTCDERL 267

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K     D   +KA+G+++I+A L G +  DE L    I T +YA
Sbjct: 268 DKIFKEGAIDEIALIKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYA 327

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q Q
Sbjct: 328 KRQVTWFKNQIQ 339


>gi|107104044|ref|ZP_01367962.1| hypothetical protein PaerPA_01005117 [Pseudomonas aeruginosa PACS2]
 gi|313109946|ref|ZP_07795874.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 39016]
 gi|310882376|gb|EFQ40970.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 39016]
          Length = 313

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 114/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A +I
Sbjct: 86  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 146 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 206 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 266 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 299


>gi|332041839|gb|EGI78188.1| tRNA dimethylallyltransferase [Hylemonella gracilis ATCC 19624]
          Length = 383

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 116/226 (51%), Gaps = 35/226 (15%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + +  LP++VGGT LYF+AL   L  +P     +R  +  + +  G + LH ELS +D +
Sbjct: 111 HARGHLPLLVGGTMLYFKALLQGLDDLPPADATVRAALEAEARTRGWNALHAELSRVDPV 170

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-----P-ERS 122
            A ++ P D QRI RALE++ ++G+ +  F  +  +P  P  S+    I      P +R+
Sbjct: 171 TAARLPPGDTQRIQRALEVQRLTGRPLSSFHTRTESPAPPDTSSPATAITLIALEPRDRA 230

Query: 123 ALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINY---- 177
            L ERI +RF  ML++G +DE+R+L  + +L  DLP M+ +G R     L  ++++    
Sbjct: 231 WLHERIAQRFDTMLQAGLLDEVRALRARGDLHPDLPSMRCVGYRQAWEFLDAQLSHEARA 290

Query: 178 ------------------------DETLQRGIIATNKYAKRQKTWL 199
                                   DE  +RGI AT + AKRQ TWL
Sbjct: 291 ARDTDGAHGQAQVRPRKPASATPLDELRERGITATRQLAKRQITWL 336


>gi|49083702|gb|AAT51113.1| PA4945 [synthetic construct]
          Length = 324

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|229586748|ref|YP_002845249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           africae ESF-5]
 gi|228021798|gb|ACP53506.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           africae ESF-5]
          Length = 344

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 105/191 (54%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++E++R    + G+  L  +L   D + A +I
Sbjct: 133 LPILIGGTGLYINSLVFGYNNIPDISEDLQEQVRNLHVKIGNIELWSKLEKFDPLAASKI 192

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           + +D QR+ RA E+ + +G+SI  F        +P  +   I + PER  L +    R  
Sbjct: 193 NQNDTQRLIRAYEVFMQTGKSIFSFQTLPKEQILPDFNFKIIFLNPERKFLYKTCDERLD 252

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ++ + GAIDEI  + K     D   +KA+G+++I+A L G +  DE L    I T +YAK
Sbjct: 253 KIFKEGAIDEIALIKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYAK 312

Query: 194 RQKTWLCHQFQ 204
           RQ TW  +Q Q
Sbjct: 313 RQVTWFKNQIQ 323


>gi|71282631|ref|YP_267090.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Colwellia
           psychrerythraea 34H]
 gi|123634100|sp|Q48A23|MIAA_COLP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71148371|gb|AAZ28844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Colwellia
           psychrerythraea 34H]
          Length = 316

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 111/196 (56%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT +YF++L   +S +P     IR+ I  +    G   +HD+L+ +D + A +I
Sbjct: 103 IPLLVGGTMMYFKSLIEGISPLPTANPEIRQAIEAEALSKGWQAMHDQLAEIDPVSAERI 162

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QRI RALE+  ++  ++ +   Q     +  +     I   ERS L ERI  R+ 
Sbjct: 163 HPNDPQRITRALEVYRLTSNTLTQL-TQIKGAKLAGDVLQLAITPRERSTLHERIALRYQ 221

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QM++ G   E+  L  + +L  DLP ++ +G R +   L+GE ++DE + RG+ AT + A
Sbjct: 222 QMIDLGFEQEVIKLKSRDDLHQDLPSIRCVGYRQMWQHLEGEFDHDEMIFRGVCATRQLA 281

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TWL +     W+
Sbjct: 282 KRQLTWLRNWPDLHWL 297


>gi|325524964|gb|EGD02891.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. TJI49]
          Length = 324

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 6/190 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++ GGT LY++ALT  L+ +P    A+R ++  +  + G   LH  L+ +D   A ++ 
Sbjct: 102 PLLAGGTMLYYKALTQGLNDLPSANPAVRAELDAEAARDGWPALHARLAQVDPATAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIRR 130
           P+D QRI RALEI ++SGQ +       P    P  +A++ + +     +R+ L  RI R
Sbjct: 162 PNDSQRIQRALEIFMLSGQPMSALLAAPPRADDP-AAAYRFVPVALEPSDRAVLHARIAR 220

Query: 131 RFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF  ML++G IDE+  L +  +L   LP M+ +G R     L GE +Y     +GI AT 
Sbjct: 221 RFDAMLDAGFIDEVERLRRREDLHPGLPSMRCVGYRQAWEFLDGETDYRTMRDKGIFATR 280

Query: 190 KYAKRQKTWL 199
           +  KRQ TWL
Sbjct: 281 QLCKRQITWL 290


>gi|254238340|ref|ZP_04931663.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa C3719]
 gi|126170271|gb|EAZ55782.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa C3719]
          Length = 323

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|116053094|ref|YP_793413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|254244165|ref|ZP_04937487.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 2192]
 gi|122256893|sp|Q02F73|MIAA_PSEAB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115588315|gb|ABJ14330.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126197543|gb|EAZ61606.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 2192]
          Length = 323

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 114/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|15600138|ref|NP_253632.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAO1]
 gi|218894040|ref|YP_002442909.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa LESB58]
 gi|21263786|sp|Q9HUL9|MIAA_PSEAE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704736|sp|B7V208|MIAA_PSEA8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|9951225|gb|AAG08330.1|AE004907_8 delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAO1]
 gi|218774268|emb|CAW30085.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa LESB58]
          Length = 323

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|329120647|ref|ZP_08249310.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327460871|gb|EGF07205.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 313

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 103/188 (54%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT +YF ALT  L+ +PE   A+R +++      G   L+  L   D   A ++
Sbjct: 95  LPLIVGGTMMYFHALTCGLNELPEADPAVRAQLQADKAARGLAALYRRLQEADPATAARL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI L++G+ + E   +  +   PL+     +I  +R+ L + I  RF 
Sbjct: 155 QPADSQRIERALEIFLITGRPMSEHLAERVSAPPPLDLYTFALIPHDRARLYQTIAARFQ 214

Query: 134 QMLESGAIDEIRSLMK--MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G  DE+R L      L+ + P M+ +G R  +  L G ++Y E  +R   AT + 
Sbjct: 215 TMLEQGFTDEVRRLRADYPALTAEHPSMRCVGYRQALDYLDGAVSYREFAERATAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|167627764|ref|YP_001678264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|189081953|sp|B0TZB0|MIAA_FRAP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167597765|gb|ABZ87763.1| tRNA isopentenyltransferase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 308

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 112/187 (59%), Gaps = 5/187 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IR+ +  + K  G   LH +L+ +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSSLPESQLEIRQTLELERKAKGLQYLHQQLNKMDQESAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSALKERIRRRFT 133
           +D QRI RALE+ +++G+   E  K +      LE   K+  L   +RS L   I  RF 
Sbjct: 156 NDQQRIFRALEVIMITGKKYSELVKTS--KVGGLEEQLKLCALVPNDRSILHNNIELRFK 213

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML+ G +DE++SL K   L+ +   ++++G R     L G+I+Y+E +++GI+AT + A
Sbjct: 214 QMLDQGFLDEVQSLRKNPKLTKETTAIRSVGYRQAWEYLDGDISYEEFVKKGIVATRQLA 273

Query: 193 KRQKTWL 199
           KRQ TW+
Sbjct: 274 KRQLTWI 280


>gi|186973101|pdb|3CRM|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
 gi|186973102|pdb|3CRQ|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
 gi|186973103|pdb|3CRR|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
          Length = 323

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 115/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|309380103|emb|CBX21514.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 313

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 108/190 (56%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPEDRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G I E+ +L +   NL+ D P ++ +G R     L G  +    +++GI AT 
Sbjct: 213 FHLMLEQGFIGEVENLRRRYPNLTADSPAIRCVGYRQAWEYLDGATDRQTFIEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|261401121|ref|ZP_05987246.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           lactamica ATCC 23970]
 gi|269208893|gb|EEZ75348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           lactamica ATCC 23970]
          Length = 313

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 108/190 (56%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L   D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKADPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPEDRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRS--LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G I E+ +  L    L+ D P ++ +G R     L G+ ++ E +++GI AT 
Sbjct: 213 FHLMLEQGFIGEVENLRLRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPEFVEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|254447172|ref|ZP_05060639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HTCC5015]
 gi|198263311|gb|EDY87589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HTCC5015]
          Length = 337

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 112/193 (58%), Gaps = 13/193 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +PI+ GGT LYFRAL   ++ MPE   A R  +  +L Q G+  LH EL  +DS  A +I
Sbjct: 120 VPILAGGTMLYFRALLDGMAEMPESDPAARAGLEAELAQRGAQALHQELQQVDSHAAERI 179

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAH-----KIIILPE-RSALKER 127
           H +D QR+ RALE+   SG  + E+  +A       +SA+     K+ ++PE R   +  
Sbjct: 180 HLNDPQRLLRALEVYRSSGVPLSEWHVRA------QQSAYAGPVLKLGLIPEDRPRHRAL 233

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           +  RF  M+E+G  DE+++L +  +L LD+P ++ +G R +     G+ ++D  +++ I 
Sbjct: 234 VASRFMAMIEAGFADEVQALYRRGDLRLDMPSVRCVGYRQLWQYFNGDWDWDLAVEKAIT 293

Query: 187 ATNKYAKRQKTWL 199
           AT + AKRQ TWL
Sbjct: 294 ATRQLAKRQMTWL 306


>gi|319410269|emb|CBY90610.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase; isopentenyl-diphosphate:tRNA
           isopentenyltransferase; IPTase; IPPT) [Neisseria
           meningitidis WUE 2594]
          Length = 313

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 105/189 (55%), Gaps = 4/189 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
            P+D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF
Sbjct: 155 KPNDSQRIERALEVYYLTGKPMSAHLGSPTSHTLPFD-LHTAALIPENRARLHENIALRF 213

Query: 133 TQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
            QMLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT +
Sbjct: 214 RQMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQTWEHLDGATDRQTFIEKGIAATRQ 273

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 274 LAKRQLTWL 282


>gi|296391785|ref|ZP_06881260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAb1]
          Length = 323

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 114/214 (53%), Gaps = 11/214 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A +I
Sbjct: 96  IPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESAARI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF----------WKQAPNPFIPLESAHKIIILPERSA 123
           HP+D QR+ RALE+  + G S+ +           +  +    +P   A   I   +R  
Sbjct: 156 HPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQRQV 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF QMLE G I E+ +L  + +L   LP ++A+G R +   L G+++Y E  +
Sbjct: 216 LHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAEMTE 275

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 276 RGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|254804816|ref|YP_003083037.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis alpha14]
 gi|254668358|emb|CBA05416.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis alpha14]
          Length = 313

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 109/190 (57%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI AT 
Sbjct: 213 FHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|56696543|ref|YP_166900.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruegeria
           pomeroyi DSS-3]
 gi|81676293|sp|Q5LSV5|MIAA_SILPO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56678280|gb|AAV94946.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruegeria
           pomeroyi DSS-3]
          Length = 291

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 110/196 (56%), Gaps = 9/196 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF ALT  ++ +P  P  +R        +  +  L   L+ +D   A  + 
Sbjct: 101 PIIVGGTGLYFTALTEGMADIPATPPDVR-------AEADTLPLDRLLAGIDPATAAGLD 153

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E++  +G+++  +    P P +PL     +++  ++  L +RI RRF Q
Sbjct: 154 RNNRARVQRAWEVERATGRALHLWQADTPPPPLPLARTVPLVLEVDKLWLWDRIARRFDQ 213

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML+ GA+DE+ + M       LP  KAIGV +++A L+GEI  D   +R  IAT +YAKR
Sbjct: 214 MLDQGALDEV-AAMAARYDPALPAFKAIGVPELMAHLRGEITLDAARERASIATRQYAKR 272

Query: 195 QKTWLCHQFQADWIRI 210
           Q++W   +   DW R+
Sbjct: 273 QRSWFRARM-GDWHRL 287


>gi|296314749|ref|ZP_06864690.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           polysaccharea ATCC 43768]
 gi|296838390|gb|EFH22328.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           polysaccharea ATCC 43768]
          Length = 313

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 105/189 (55%), Gaps = 4/189 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRF 132
            P+D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF
Sbjct: 155 KPNDSQRIGRALEVYYLTGKPMSTHLGSPTSHTLPFD-LHTTALIPENRARLHENIALRF 213

Query: 133 TQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
             MLE G I E+ +L ++   L+ D P ++ +G R     L G  +    +++GI AT +
Sbjct: 214 HLMLEQGFIGEVENLRRLYPGLTADSPAIRCVGYRQAWEYLDGATDRQTFIEKGIAATRQ 273

Query: 191 YAKRQKTWL 199
            AKRQ TWL
Sbjct: 274 LAKRQLTWL 282


>gi|224826522|ref|ZP_03699623.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lutiella
           nitroferrum 2002]
 gi|224601123|gb|EEG07305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lutiella
           nitroferrum 2002]
          Length = 319

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 106/188 (56%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS MP    A R ++  +  +YG   LH +L+  D I A ++
Sbjct: 96  VPLLVGGTMLYFKALIDGLSDMPPADVATRAQLDLEAAKYGWPALHAQLAEADPITAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P D QRI RALE+  ++G+ +  +  +  N     +     +I  +R+ L ERI  RF 
Sbjct: 156 EPLDSQRIQRALEVFRLTGKPLSAWHAEGRNQAARFQMLKLALIPHDRAWLHERIALRFR 215

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE   +DE+  L +   +L+ DLP M+ +G R     L G+ +Y + L +GI AT + 
Sbjct: 216 LMLEQFFLDEVVRLRQRYPDLTPDLPSMRCVGYRQAWEHLDGQASYADFLDKGIAATRQL 275

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 276 AKRQLTWL 283


>gi|313888264|ref|ZP_07821935.1| tRNA dimethylallyltransferase [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845667|gb|EFR33057.1| tRNA dimethylallyltransferase [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 307

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 107/199 (53%), Gaps = 12/199 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
           LP++VGGTGLY  +L   L     E     RE++ + LK+ GS  L+ +L +L+  +A Q
Sbjct: 92  LPLVVGGTGLYINSLVYNLDFTETEADYVYREELYKILKEKGSEFLYKKLYTLNKDMAEQ 151

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP---FIPLESAHKIIILPERSALKERIR 129
           IHP++GQRI RALEI     +    F ++       FI L          +R  L ERI 
Sbjct: 152 IHPNNGQRIIRALEISKDGNEKGSNFRQENEEYNLIFIGLN--------MDRERLYERIN 203

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R  +M+E G ++E++SL+   L  +   +KAIG +++I+ L GEI YDE ++     + 
Sbjct: 204 NRVDKMIELGLVEEVKSLLDEGLDKNSQSLKAIGYKEVISYLDGEIEYDEMIELIKKNSR 263

Query: 190 KYAKRQKTWLCHQFQADWI 208
            YAKRQ TW     +  W 
Sbjct: 264 HYAKRQLTWFRRDNRIQWF 282


>gi|34498844|ref|NP_903059.1| tRNA isopentenyltransferase [Chromobacterium violaceum ATCC 12472]
 gi|46576902|sp|Q7MBE2|MIAA_CHRVO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|34104696|gb|AAQ61053.1| tRNA isopentenyltransferase [Chromobacterium violaceum ATCC 12472]
          Length = 325

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 105/192 (54%), Gaps = 12/192 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++AL   LS +P+   A+R ++       G   +H  L+ LD   A ++
Sbjct: 96  LPLLVGGTMLYYKALLEGLSDLPQADAALRAELDADAALLGWPAMHARLAELDPATASRL 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNP-----FIPLESAHKIIILPERSALKERI 128
           +P+D QRI RALE+ L+SG+ + E   Q         F+PL      ++  ER  L  RI
Sbjct: 156 NPNDSQRIHRALEVCLLSGKPMSELIAQGKEAAAGFRFLPL-----ALVPRERGWLHARI 210

Query: 129 RRRFTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
             RF  MLE G +DE+  L      L+L+LP M+ +G R       G   +DE ++RG+ 
Sbjct: 211 AERFRIMLEQGFLDEVSRLRAKYPELTLNLPSMRCVGYRQAWEHQDGLYGHDEFVERGVA 270

Query: 187 ATNKYAKRQKTW 198
           AT + AKRQ TW
Sbjct: 271 ATRQLAKRQLTW 282


>gi|160900585|ref|YP_001566167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Delftia
           acidovorans SPH-1]
 gi|239977363|sp|A9BN87|MIAA_DELAS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160366169|gb|ABX37782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Delftia
           acidovorans SPH-1]
          Length = 329

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 107/197 (54%), Gaps = 18/197 (9%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+AL   +  MP    A+RE++  +  Q G   +H  L+ +D   A ++
Sbjct: 103 LPLLVGGTMLYFKALQDGIDDMPAADPAVRERLDAQAAQIGWPAMHALLAQVDPATAARL 162

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ----------APNPFIPLESAHKIIILPERSA 123
            P+D QRI RALE+  VSG+ +  F  +          +P  F  LE         +R+ 
Sbjct: 163 APADSQRIQRALEVWHVSGKPLSSFHTRSGKNAEQGLVSPGGFFSLEPQ-------DRAW 215

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI +RF  ML++G IDE+  L  + +L LDLP ++ +G R     L G  + +   +
Sbjct: 216 LHARIAQRFDAMLDAGFIDEVLQLRARGDLHLDLPSIRCVGYRQAWESLDGLYSMNSLRE 275

Query: 183 RGIIATNKYAKRQKTWL 199
           RGI AT + AKRQ TWL
Sbjct: 276 RGIAATRQLAKRQITWL 292


>gi|157964546|ref|YP_001499370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           massiliae MTU5]
 gi|239977444|sp|A8F1N7|MIAA_RICM5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157844322|gb|ABV84823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           massiliae MTU5]
          Length = 363

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 104/191 (54%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   +RE++R    + G+  L  +L  LD + A +I
Sbjct: 149 LPILIGGTGLYINSLVFGYNNIPDISEDLREQVRNLHAKIGNIELWGKLEKLDPLAASKI 208

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           + +D QR+ RA E+ + + +SI  F        +P  +   I + PER  L +    R  
Sbjct: 209 NQNDTQRLIRAYEVFMQTNKSIFSFQTLPKEQILPDFNFKIIFLNPERKFLYKTCDERLD 268

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ++ + GAIDEI  + K     D    KA+G+++I+A L G +  DE L    I T +YAK
Sbjct: 269 KIFKEGAIDEIALIKKQFAPKDYTNWKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYAK 328

Query: 194 RQKTWLCHQFQ 204
           RQ TW  +Q Q
Sbjct: 329 RQVTWFKNQIQ 339


>gi|255003230|ref|ZP_05278194.1| tRNA isopentenylpyrophosphate transferase (miaA) [Anaplasma
           marginale str. Puerto Rico]
          Length = 284

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++K+   I+VGG+GLY  +L   LS +P     IR+K R  L + G+    + L   D+ 
Sbjct: 66  WEKKSPAIVVGGSGLYISSLIYGLSEIPPADAHIRQKARALLSEVGNDTFFELLLRRDAN 125

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           V + I   +  ++ RA E+   +G SI  + ++ P    P E+    ++ P +  L  +I
Sbjct: 126 VCK-IDRRNSNQLLRAFEVFESTGVSIFSWRERCPKKR-PFENCEVCVLFPPKEELHPKI 183

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R   M+ S A+ E+  LM +NL  D PIMKAIGVR++I  L+G I+  E ++     T
Sbjct: 184 NSRLVDMINSSAVAEVEYLMSLNLPADAPIMKAIGVREVIEYLRGNISLPEAVEAAQRNT 243

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +YAKRQ TWL  Q   D
Sbjct: 244 RQYAKRQYTWLRRQLPQD 261


>gi|121634738|ref|YP_974983.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis FAM18]
 gi|166215158|sp|A1KTK4|MIAA_NEIMF RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120866444|emb|CAM10190.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Neisseria meningitidis FAM18]
 gi|325132182|gb|EGC54878.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M6190]
 gi|325138114|gb|EGC60687.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis ES14902]
 gi|325142207|gb|EGC64628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis 961-5945]
 gi|325198168|gb|ADY93624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis G2136]
          Length = 313

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 107/187 (57%), Gaps = 4/187 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRFTQ 134
           +D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF  
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSTHLGSPTSHTLPFD-LHTAALIPENRARLHENIALRFHL 215

Query: 135 MLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           MLE G I E+ +L ++  +L+ D P ++ +G R     L G+ ++   +++GI AT + A
Sbjct: 216 MLEQGFIGEVENLRRLYPSLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAATRQLA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQLTWL 282


>gi|222475246|ref|YP_002563662.1| tRNA isopentenylpyrophosphate transferase (miaA) [Anaplasma
           marginale str. Florida]
 gi|255004358|ref|ZP_05279159.1| tRNA isopentenylpyrophosphate transferase (miaA) [Anaplasma
           marginale str. Virginia]
 gi|239977166|sp|B9KIU4|MIAA_ANAMF RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|222419383|gb|ACM49406.1| tRNA isopentenylpyrophosphate transferase (miaA) [Anaplasma
           marginale str. Florida]
          Length = 305

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++K+   I+VGG+GLY  +L   LS +P     IR+K R  L + G+    + L   D+ 
Sbjct: 87  WEKKSPAIVVGGSGLYISSLIYGLSEIPPADAHIRQKARALLSEVGNDTFFELLLRRDAN 146

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           V + I   +  ++ RA E+   +G SI  + ++ P    P E+    ++ P +  L  +I
Sbjct: 147 VCK-IDRRNSNQLLRAFEVFESTGVSIFSWRERCPKKR-PFENCEVCVLFPPKEELHPKI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R   M+ S A+ E+  LM +NL  D PIMKAIGVR++I  L+G I+  E ++     T
Sbjct: 205 NSRLVDMINSSAVAEVEYLMSLNLPADAPIMKAIGVREVIEYLRGNISLPEAVEAAQRNT 264

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +YAKRQ TWL  Q   D
Sbjct: 265 RQYAKRQYTWLRRQLPQD 282


>gi|254995067|ref|ZP_05277257.1| tRNA isopentenylpyrophosphate transferase [Anaplasma marginale str.
           Mississippi]
          Length = 304

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++K+   I+VGG+GLY  +L   LS +P     IR+K R  L + G+    + L   D+ 
Sbjct: 86  WEKKSPTIVVGGSGLYISSLIYGLSEIPPADAHIRQKARALLSEVGNDTFFELLLRRDAN 145

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           V + I   +  ++ RA E+   +G SI  + ++ P    P E+    ++ P +  L  +I
Sbjct: 146 VCK-IDRRNSNQLLRAFEVFESTGVSIFSWRERCPKKR-PFENCEVCVLFPPKEELHPKI 203

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R   M+ S A+ E+  LM +NL  D PIMKAIGVR++I  L+G I+  E ++     T
Sbjct: 204 NSRLVDMINSSAVAEVEYLMSLNLPADAPIMKAIGVREVIEYLRGNISLPEAVEAAQRNT 263

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +YAKRQ TWL  Q   D
Sbjct: 264 RQYAKRQYTWLRRQLPQD 281


>gi|269958704|ref|YP_003328491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaplasma
           centrale str. Israel]
 gi|269848533|gb|ACZ49177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaplasma
           centrale str. Israel]
          Length = 305

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++K+   I+VGG+GLY  +L   LS +P     IR+K R  L + G+    + L   D+ 
Sbjct: 87  WEKKSPTIVVGGSGLYISSLIYGLSEIPPADAHIRQKARALLSEVGNDTFFELLLRRDAN 146

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           V + I   +  ++ RA E+   +G SI  + ++ P    P E+    ++ P +  L  +I
Sbjct: 147 VCK-IDRRNSNQLLRAFEVFESTGVSIFSWRERCPKKR-PFENCEVCVLFPPKEELHPKI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R   M+ S A+ E+  LM +NL  D PIMKAIGVR++I  L+G I+  E ++     T
Sbjct: 205 NSRLVDMINSSAVAEVEYLMSLNLPADAPIMKAIGVREVIEYLRGNISLPEAVEAAQRNT 264

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +YAKRQ TWL  Q   D
Sbjct: 265 RQYAKRQYTWLRRQLPQD 282


>gi|261377688|ref|ZP_05982261.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           cinerea ATCC 14685]
 gi|269145956|gb|EEZ72374.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           cinerea ATCC 14685]
          Length = 313

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 107/187 (57%), Gaps = 4/187 (2%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE-RSALKERIRRRFTQ 134
           +D QRI RALE+  ++G+ +        +  +P +  H   ++PE R+ L E I  RF  
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSTHLGSPTSHTLPFD-LHTAALIPENRAHLHENIALRFHL 215

Query: 135 MLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           MLE G I E+ +L ++  +L+ D P ++ +G R     L G+ ++   +++GI AT + A
Sbjct: 216 MLEQGFIGEVENLRRLYPSLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKGIAATRQLA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQLTWL 282


>gi|56416881|ref|YP_153955.1| tRNA isopentenylpyrophosphate transferase [Anaplasma marginale str.
           St. Maries]
 gi|81677640|sp|Q5PAI0|MIAA_ANAMM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56388113|gb|AAV86700.1| tRNA isopentenylpyrophosphate transferase [Anaplasma marginale str.
           St. Maries]
          Length = 305

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 106/198 (53%), Gaps = 2/198 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++K+   I+VGG+GLY  +L   LS +P     IR+K R  L + G+    + L   D+ 
Sbjct: 87  WEKKSPTIVVGGSGLYISSLIYGLSEIPPADAHIRQKARALLSEVGNDTFFELLLRRDAN 146

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
           V + I   +  ++ RA E+   +G SI  + ++ P    P E+    ++ P +  L  +I
Sbjct: 147 VCK-IDRRNSNQLLRAFEVFESTGVSIFSWRERCPKKR-PFENCEVCVLFPPKEELHPKI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R   M+ S A+ E+  LM +NL  D PIMKAIGVR++I  L+G I+  E ++     T
Sbjct: 205 NSRLVDMINSSAVAEVEYLMSLNLPADAPIMKAIGVREVIEYLRGNISLPEAVEAAQRNT 264

Query: 189 NKYAKRQKTWLCHQFQAD 206
            +YAKRQ TWL  Q   D
Sbjct: 265 RQYAKRQYTWLRRQLPQD 282


>gi|254672228|emb|CBA05181.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis alpha275]
 gi|325134097|gb|EGC56750.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M13399]
 gi|325144273|gb|EGC66578.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M01-240013]
 gi|325204007|gb|ADY99460.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M01-240355]
 gi|325206233|gb|ADZ01686.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis M04-240196]
          Length = 313

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 109/190 (57%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIERALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G I E+ +L +    L+ D P ++ +G R     L G+ ++   +++GI AT 
Sbjct: 213 FHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWKYLDGKTDFPAFVEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|311104118|ref|YP_003976971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Achromobacter
           xylosoxidans A8]
 gi|310758807|gb|ADP14256.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Achromobacter
           xylosoxidans A8]
          Length = 322

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 110/192 (57%), Gaps = 3/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT +Y++AL   L  +P+   A+R ++  +    G   LH EL+ LD   A ++
Sbjct: 102 IPLLAGGTMMYYKALRDGLDDLPQADPALRAELEARATTQGWPALHAELALLDPPTAARL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL--PERSALKERIRRR 131
            P+D QRI RALEI ++SGQ +     +   P     + +  I L   +R+AL  RI +R
Sbjct: 162 APNDSQRIQRALEICMLSGQPMSALLLRGQRPRADQGNQYLTISLEPSDRAALHARIEQR 221

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  ML+ G +DE+R+L  + +L   LP ++ +G R + + L GE++     ++GI AT +
Sbjct: 222 FDAMLDRGLLDEVRALRARGDLHTGLPSVRCVGYRQMWSHLDGEVDLATAREQGIAATRQ 281

Query: 191 YAKRQKTWLCHQ 202
            AKRQ TWL  Q
Sbjct: 282 LAKRQITWLRAQ 293


>gi|84500819|ref|ZP_00999054.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Oceanicola batsensis HTCC2597]
 gi|84390886|gb|EAQ03304.1| Probable tRNA delta(2)-isopentenylpyrophosphate transferase
           [Oceanicola batsensis HTCC2597]
          Length = 314

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 102/185 (55%), Gaps = 4/185 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGTGLYF ALT  L+ +P  P AIR +      + G   L   L +LD     +I 
Sbjct: 120 PVIVGGTGLYFSALTEGLAEIPATPPAIRAQGDRLRAEAG---LAPLLEALDPETLSRID 176

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +G+ + ++    P P +P   A  ++I   RS L  RI RRF  
Sbjct: 177 RANPMRVQRAWEVLKATGRPLADWQDDTPAPLLPAGRAECLLIDAPRSWLTPRIERRFDH 236

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML  GA++E+R  +       LP  +AIG  +++A L+GE+  D    + +IAT ++AKR
Sbjct: 237 MLAEGALEEVRENLA-GWDPALPSSRAIGAPELVASLRGELPLDAARDQAVIATRQFAKR 295

Query: 195 QKTWL 199
           Q+TW 
Sbjct: 296 QRTWF 300


>gi|241668328|ref|ZP_04755906.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254876861|ref|ZP_05249571.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254842882|gb|EET21296.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 308

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 111/185 (60%), Gaps = 1/185 (0%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           ++VGGT LYF+ L   LS +PE    IR+ +  + K  G   LH +L+ +D   A++I+P
Sbjct: 96  LLVGGTMLYFKGLIEGLSSLPESQLEIRQTLELERKAKGLQYLHQQLNKMDQESAQKINP 155

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
           +D QRI RALE+ +++G+   E  K +    +  +     ++  +RS L   I  RF QM
Sbjct: 156 NDQQRIFRALEVIMLTGKKYSELVKTSKVGGLEEQLKLCALVPNDRSILHNNIELRFKQM 215

Query: 136 LESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           L+ G +DE++SL K   L+ +   ++++G R     L G+I+Y+E +++GI+AT + AKR
Sbjct: 216 LDQGFLDEVQSLRKNPKLTKETTAIRSVGYRQAWEYLDGDISYEEFVKKGIVATRQLAKR 275

Query: 195 QKTWL 199
           Q TW+
Sbjct: 276 QLTWI 280


>gi|240115502|ref|ZP_04729564.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
 gi|268601176|ref|ZP_06135343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
 gi|268585307|gb|EEZ49983.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
          Length = 313

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 101/188 (53%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
            P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++
Sbjct: 95  CPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRL 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALE+  ++G+ +       P   +P +     +I   R+ L E I  RF 
Sbjct: 155 KPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFQLYTAALIPENRARLHENIALRFH 214

Query: 134 QMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
            MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT + 
Sbjct: 215 LMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKGIAATRQL 274

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 275 AKRQLTWL 282


>gi|78223259|ref|YP_385006.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           metallireducens GS-15]
 gi|123571654|sp|Q39TZ3|MIAA_GEOMG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78194514|gb|ABB32281.1| tRNA isopentenyltransferase [Geobacter metallireducens GS-15]
          Length = 309

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 9/206 (4%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
           ++R  KR   I+VGGTGLY R LT  L   P     IR ++ ++    G   LH  L+++
Sbjct: 92  IERRGKRV--ILVGGTGLYIRILTQGLVASPGGDDNIRRELEDQAHGEGLESLHRRLAAV 149

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPERS 122
           D + A ++HP+DG RI RALE+ L++G+ +  F +    A  P+  L    K+ I  ER 
Sbjct: 150 DPVAAARLHPNDGVRIVRALEVFLLTGRPLSAFQEAHRFADEPYRCL----KLGITVERE 205

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L  R+  R  +M+  G ++E+R L+       L  M +IG R+I A L GE + DE ++
Sbjct: 206 LLYRRVEERVDRMIAEGLVEEVRGLLSAGYPATLKAMGSIGYREICAHLAGEFSLDEAMR 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWI 208
                T +YAKRQ TW     +  W+
Sbjct: 266 LIKQNTRQYAKRQMTWFRRDSEIIWV 291


>gi|242279876|ref|YP_002992005.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           salexigens DSM 2638]
 gi|259495764|sp|C6BXG0|MIAA_DESAD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|242122770|gb|ACS80466.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           salexigens DSM 2638]
          Length = 306

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%), Gaps = 8/204 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGTG+Y ++L   L+ +P+IP  IRE+IR++ ++ G   L+ EL  +D    ++ 
Sbjct: 96  LPVLVGGTGMYLQSLISGLAPIPDIPDEIRERIRKRSEEEGGPALYAELEKVDPEYCKRT 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPERSALKERIRR 130
           HP++ QR ARALE+   +G+    +W      P+P+  L    KI I  +   L   ++ 
Sbjct: 156 HPNNRQRNARALEVYEATGKP-FSWWHNREVPPSPYNFL----KIGIKVDLDELTPLLKL 210

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           R  +MLE+GA++E R   +     + P    IG  +++  +KGEI+ DET++     T  
Sbjct: 211 RIEKMLEAGAVEEARKAWENCPDENAPGWTGIGCIELMRYIKGEIDLDETIRLWAKNTRA 270

Query: 191 YAKRQKTWLCHQFQADWIRISSID 214
           YAKRQ TW   +    W      D
Sbjct: 271 YAKRQLTWFKREKDIHWFAPHEYD 294


>gi|293603561|ref|ZP_06685982.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Achromobacter
           piechaudii ATCC 43553]
 gi|292817997|gb|EFF77057.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Achromobacter
           piechaudii ATCC 43553]
          Length = 321

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 113/193 (58%), Gaps = 11/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT +Y++AL   L  +P+   A+R +I  +    G   LH EL+ LD + A ++
Sbjct: 101 VPLLAGGTMMYYKALREGLDDLPQADPALRAEIEARAAIQGWPALHAELALLDPVTAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQ---SIIEFWKQAPNPFIPLESAHKIIILPE---RSALKER 127
            P+D QRI RALEI  ++GQ   +++   +Q P      ++ H + I  E   R+AL  R
Sbjct: 161 APNDSQRIQRALEICQLTGQPMSALLSCGQQKPAD----DANHYLTISLEPSDRAALHAR 216

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML +G +DE+R+L  + +L   LP ++ +G R + A L GE++     ++GI 
Sbjct: 217 IEQRFDAMLANGLLDEVRALRTRPDLHPGLPSVRCVGYRQMWAHLDGEVDLATAREQGIA 276

Query: 187 ATNKYAKRQKTWL 199
           AT + AKRQ TWL
Sbjct: 277 ATRQLAKRQITWL 289


>gi|99081256|ref|YP_613410.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruegeria sp.
           TM1040]
 gi|123252376|sp|Q1GGR8|MIAA_SILST RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|99037536|gb|ABF64148.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruegeria sp.
           TM1040]
          Length = 288

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 108/197 (54%), Gaps = 9/197 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLYF  LT  ++ +P  P  +R        +  +  L    + LD     +I 
Sbjct: 98  PIIVGGTGLYFLTLTEGMADIPATPPEVR-------AEADTLSLETLAADLDPETRARID 150

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ + E+    P P +P +    +++  ER  L+ RIRRRF+ 
Sbjct: 151 MQNRARVQRAWEVLRATGRPLAEWQDDTPPPLLPAKDCTALVVEAERDWLETRIRRRFSM 210

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M+  GA++E R+ M+      LP  KAIGV +++A L G +  ++  +R  +AT +YAKR
Sbjct: 211 MIAQGALEEARA-MQDRYDPALPSCKAIGVPELMAHLSGALTLEQAEERASVATRQYAKR 269

Query: 195 QKTWLCHQFQADWIRIS 211
           Q+TW   + ++ W R+S
Sbjct: 270 QRTWFRARMKS-WQRVS 285


>gi|164688072|ref|ZP_02212100.1| hypothetical protein CLOBAR_01717 [Clostridium bartlettii DSM
           16795]
 gi|164602485|gb|EDQ95950.1| hypothetical protein CLOBAR_01717 [Clostridium bartlettii DSM
           16795]
          Length = 313

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 113/205 (55%), Gaps = 10/205 (4%)

Query: 16  IIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           +I GGTGLY  +L   +          IREK+ ++L + G   +H++L  LD   A +IH
Sbjct: 97  LITGGTGLYLNSLIYNMDFAKSNANNEIREKLEQELAENGIDYMHEKLRGLDEEAANRIH 156

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIILP-ERSALKERIRRR 131
            ++ +R+ RA+E+  +SGQ + +F K  +    + P+     II+L  +R  L +RI +R
Sbjct: 157 KNNTKRVIRAIEV-CMSGQKMNDFSKDLRYNEKYKPI-----IIVLNRDREVLYQRINKR 210

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
              MLE+G +DE++ L+KM  + D+  M+ IG +++I  L GE  YDE ++     + +Y
Sbjct: 211 VDIMLENGLLDEVKELLKMGYTKDMISMQGIGYKEMIKYLDGEYTYDEAIEIIKRDSRRY 270

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TW      A W  +    D+
Sbjct: 271 AKRQLTWFKRYQDAKWFDLDKYQDI 295


>gi|146297050|ref|YP_001180821.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|239977186|sp|A4XL45|MIAA_CALS8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145410626|gb|ABP67630.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 312

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 123/210 (58%), Gaps = 15/210 (7%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA--IREKIREKLKQYGSHILHDELSSLD 66
           Y+K  +P++VGGTG Y +++   +   PE+  +  +R+ + ++L++ G+  L++ L ++D
Sbjct: 90  YQKGKIPLLVGGTGFYIKSIVDDIE-FPEMGDSKQVRQNLYKELEEKGNMYLYEMLKNVD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-----ER 121
           S  A+ +HP++ +R+ R LEI  ++G+   +F ++        + + K  ILP     ER
Sbjct: 149 SKAAQSVHPNNVKRVIRYLEIYFLTGKKPTDFLEKVRK-----KGSKKYNILPLCFVMER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           S LKERI  R  +M + G +DE++ L++M  S DL  M+ +G + +I  ++G I  +E  
Sbjct: 204 SLLKERIDARVEKMFKIGLVDEVKMLLEMGYSKDLKSMQGLGYKQVIPYIEGNITLEEAK 263

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           +   + T ++AKRQ  W   ++Q D+I + 
Sbjct: 264 EELKLRTKQFAKRQSIWF--KYQGDFIYLD 291


>gi|309781393|ref|ZP_07676129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia sp.
           5_7_47FAA]
 gi|308919806|gb|EFP65467.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia sp.
           5_7_47FAA]
          Length = 325

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR +I  +  + G   LH +L+ +D + A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAEIDAEAARDGWPALHAKLAQVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ--APNPFIPLESAHKIIILP----ERSALKER 127
           H +D QRI RALE+  ++GQ +     +    N F   ++A   + +     +R  L  R
Sbjct: 160 HATDAQRIQRALELYRLTGQPMSALLAREVGANAFQQHDAAAPYLTIALEPSDRLVLHAR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+  L +  +LS  LP ++ +G R   A L+GEI+     ++GI 
Sbjct: 220 IAQRFDAMLAGGLLDEVEGLRRRGDLSPTLPSIRCVGYRQAWAYLEGEIDMAALREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|73542455|ref|YP_296975.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           eutropha JMP134]
 gi|123624177|sp|Q46XK2|MIAA_RALEJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|72119868|gb|AAZ62131.1| tRNA isopentenyltransferase [Ralstonia eutropha JMP134]
          Length = 318

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 109/191 (57%), Gaps = 6/191 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT LY++ALT  L+ +P+   A+R K+ E   + G   LH  L+ +D + A ++ 
Sbjct: 102 PLIVGGTMLYYKALTQGLNDLPQADPAVRAKLDELAAERGWPALHAMLAEVDPVTAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA---HKIIIL--PERSALKERIR 129
           P+D QRI RALEI  +SGQ + E   +  +      +A   +++I L   +R+ L  RI 
Sbjct: 162 PNDAQRIQRALEIHRLSGQPMSELLARQADGRTFTGAADQRYRVIALEPSDRAVLHARIA 221

Query: 130 RRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            R+  ML  G I+E+  L +  +L   LP ++ +G R +   L G+ +Y    +RGI+AT
Sbjct: 222 ARYDAMLAGGFIEEVERLRRRGDLHPGLPSIRCVGYRQVWEYLDGDTDYATMRERGIVAT 281

Query: 189 NKYAKRQKTWL 199
            +  KRQ TWL
Sbjct: 282 RQLCKRQITWL 292


>gi|312795201|ref|YP_004028123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           rhizoxinica HKI 454]
 gi|312166976|emb|CBW73979.1| tRNA delta(2)-isopentenylpyrophosphate transferase (EC 2.5.1.8)
           [Burkholderia rhizoxinica HKI 454]
          Length = 368

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 108/217 (49%), Gaps = 31/217 (14%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++AL   L+ +P    +IR  + +   + G   LH +L+ +D + A +I
Sbjct: 121 LPLLVGGTMLYYKALVDGLNALPSADASIRAALEQDAAREGWPALHAKLAQIDPVSAARI 180

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-----------------I 116
            P+D QRI RALE+  ++GQ +    +   NP       H+                   
Sbjct: 181 APNDSQRIQRALEVWRLTGQPMSTLLRPTLNPAAGASVGHQAAGDVDACAKDVDVCAMRA 240

Query: 117 ILP-------------ERSALKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAI 162
            LP             +RS L  RI +RF  ML++G IDE++ L  + +L   LP M+ +
Sbjct: 241 DLPPSPRFAAVSLEPSDRSVLHARIAQRFDAMLDAGLIDEVQQLRARGDLHPGLPSMRCV 300

Query: 163 GVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWL 199
           G R + A L GE +Y     +GI AT +  KRQ TWL
Sbjct: 301 GYRQVWAYLDGEYDYATMRDKGIFATRQLCKRQLTWL 337


>gi|159044041|ref|YP_001532835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dinoroseobacter
           shibae DFL 12]
 gi|226704723|sp|A8LK35|MIAA_DINSH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157911801|gb|ABV93234.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dinoroseobacter
           shibae DFL 12]
          Length = 296

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 109/196 (55%), Gaps = 3/196 (1%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGL+F ALT  LS +PE+P  +R +  + L++     +  +L + D   + +I 
Sbjct: 99  PIIVGGTGLFFTALTQGLSEIPEVPAEVRARA-DALREGDFARMQADLGARDPETSARID 157

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +G+ +  +    P P +P   A + ++   +  L  RI RRF Q
Sbjct: 158 MANPMRVQRAWEVLETTGRPLARWQADTPPPLLPRSRAARFVLEAPKDWLAPRIARRFRQ 217

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           ML+ GA+DE R+ +  +     P  +AIG  ++IA L+GEI  D   +    AT +YAKR
Sbjct: 218 MLDQGALDEARAALP-HWDAAAPWARAIGAPELIAHLRGEITLDAAEEAATRATRQYAKR 276

Query: 195 QKTWLCHQFQADWIRI 210
           Q+TW   + + DW  +
Sbjct: 277 QRTWFRARMR-DWTPV 291


>gi|170691338|ref|ZP_02882503.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           graminis C4D1M]
 gi|170143543|gb|EDT11706.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           graminis C4D1M]
          Length = 315

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 109/200 (54%), Gaps = 24/200 (12%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R ++     + G   LH  L+++D   A ++
Sbjct: 98  LPLLVGGTMLYYKALTQGLNDLPAADPNVRAQLDADAARDGWPALHARLAAIDPATAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEF-------------WKQAPNPFIPLESAHKIIILPE 120
            P+D QRI RALE+ +++G+++                W+  P   I LE +       +
Sbjct: 158 APNDSQRIQRALEVFMLTGEAMSTLLAAPARTDDAAADWRFVP---IALEPS-------D 207

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           RS L  RI RRF  MLE+G +DE+  L  + +LS ++P M+ +G R +   L G ++Y  
Sbjct: 208 RSVLHARIERRFDAMLENGFVDEVVKLRERGDLSPEMPSMRCVGYRQVWEYLDGAVDYPT 267

Query: 180 TLQRGIIATNKYAKRQKTWL 199
              +G+ AT +  KRQ TWL
Sbjct: 268 MRDKGVFATRQLCKRQLTWL 287


>gi|163855131|ref|YP_001629429.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           petrii DSM 12804]
 gi|239977178|sp|A9I7X7|MIAA_BORPD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|163258859|emb|CAP41158.1| miaA [Bordetella petrii]
          Length = 314

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 109/193 (56%), Gaps = 11/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LY++AL   L  +P+   A+R ++  +  + G   LH EL+ LD   A ++
Sbjct: 96  MPLLAGGTMLYYKALRDGLDDLPQADPALRAELEARAARLGWPALHAELARLDPATAARL 155

Query: 74  HPSDGQRIARALEIKLVSGQ--SIIEFWKQAPNPFIPLESAHKIIIL----PERSALKER 127
            P+D QRI RALEI  +SGQ  S +   +Q      P    H+ + L     +R+AL  R
Sbjct: 156 APNDSQRIQRALEICTLSGQPMSALLHGRQRAADATP----HRYVTLSLEPSDRAALHAR 211

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+R+L  + +L   LP ++ +G R + A L G ++ +   ++ I 
Sbjct: 212 IAQRFDAMLAGGLLDEVRALRARGDLHPGLPSVRCVGYRQMWAHLDGAVDLETAREQAIA 271

Query: 187 ATNKYAKRQKTWL 199
           AT + AKRQ TWL
Sbjct: 272 ATRQLAKRQLTWL 284


>gi|300113237|ref|YP_003759812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           watsonii C-113]
 gi|299539174|gb|ADJ27491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           watsonii C-113]
          Length = 314

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 108/191 (56%), Gaps = 1/191 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  +P++VGGT LYF ALT  +S +P     +R  I  + +  G   LH  L+ LD + 
Sbjct: 92  KRERIPLLVGGTMLYFHALTYGISPLPPADPEVRAAIDREAEMRGWKALHRRLAKLDPMA 151

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A++IH  D QRI RALE+  ++G+ + E    +    +P      I+   ER+ L  RI 
Sbjct: 152 AQRIHHHDPQRIQRALEVFQLTGRPLSELIANSREMVLPYRVIRLILAPAERTVLHSRIE 211

Query: 130 RRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RF  ML++G ++E++ L M+ +LSL+   ++A+G R     L+G  +     ++ I AT
Sbjct: 212 QRFRAMLKAGFLEEVKGLFMRPDLSLECASIRAVGYRQAWLYLQGRFSLPTMAEQAISAT 271

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 272 RQMAKRQLTWL 282


>gi|94264315|ref|ZP_01288108.1| tRNA isopentenyltransferase [delta proteobacterium MLMS-1]
 gi|93455281|gb|EAT05491.1| tRNA isopentenyltransferase [delta proteobacterium MLMS-1]
          Length = 316

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 105/200 (52%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +++  + +  GGTGLY + L   +       + IRE+++++LK  G+  LH EL+ +D  
Sbjct: 101 HRRGRVALFTGGTGLYLKGLFDGVFEFNCENSEIREQLKQRLKGEGNLALHAELARVDPA 160

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A +IHP DGQR+ RALEI   SG    E  +++    +       I +   R  L ERI
Sbjct: 161 SAARIHPRDGQRLLRALEIFQASGIPWSEHLRKSRQQALLGGQVPIIGLARPRDILYERI 220

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            RR  QML +G +DE+R L+      DLP +K IG R +I  L+G  + ++  Q     T
Sbjct: 221 NRRVEQMLAAGLLDEVRGLLARGYPADLPALKGIGYRQLIDHLQGRCSLEQARQLLARDT 280

Query: 189 NKYAKRQKTWLCHQFQADWI 208
            +YAKRQ TW       +W 
Sbjct: 281 RRYAKRQLTWFNAMANINWF 300


>gi|238650259|ref|YP_002916110.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           peacockii str. Rustic]
 gi|238624357|gb|ACR47063.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           peacockii str. Rustic]
          Length = 354

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 107/192 (55%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++ ++R    + G+  L  +L   D + A +I
Sbjct: 140 LPILIGGTGLYINSLVFGYNNIPDISEDLQAQVRNLHVKIGNIELWGKLEKFDPLAASKI 199

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ + +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 200 NQNDTQRLIRAYEVFMQTGKSIFSF-QTLPKEQILSDFNFKIIFLNPERKFLYKTCDERL 258

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K     D   +KA+G+++I+A L G +  DE L    I T +YA
Sbjct: 259 DKIFKEGAIDEIALIKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYA 318

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q Q
Sbjct: 319 KRQVTWFKNQIQ 330


>gi|307267459|ref|ZP_07548946.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917516|gb|EFN47803.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 315

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 123/210 (58%), Gaps = 7/210 (3%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLDS 67
           YK+  LPIIVGGTGLY  ++   +     E     REK++E    YGS  L++ L S+D 
Sbjct: 89  YKRGKLPIIVGGTGLYINSIIYIMHFSDFEGSKEFREKMKELANTYGSQYLYERLKSVDP 148

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP--ERSALK 125
             A++IH +D +RI RALE+   +G+ I  ++++     + LE    +I L   +R  L 
Sbjct: 149 EAAKKIHSNDIRRIIRALEVYEFTGKPI-SYYQKMSGMRLNLEYQPIMIGLNFRDRQILY 207

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI +R  +M+++  ++E+ +L+K+  + D   M+A+G ++I+  LKGEI+ +E +++  
Sbjct: 208 DRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTAMQALGYKEIVEYLKGEISLEEAVEKIK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             T +YAKRQ TW       ++I+   +DD
Sbjct: 268 KGTRRYAKRQITWFKG---YNFIKWFFVDD 294


>gi|317153497|ref|YP_004121545.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943748|gb|ADU62799.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 323

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 102/199 (51%), Gaps = 9/199 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R+L   ++ +PEIP  IR  + E+++  G   LH EL   D   A +I
Sbjct: 105 LPILVGGTGLYLRSLLSGMAPIPEIPADIRRAVLERIRAEGPQRLHAELEQADPDYAARI 164

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW----KQAPNPFIPLESAHKIIILPERSALKERIR 129
           HP+D QR ARA E+ L +G+++  +W    +  P PF  L+   ++ +      L+  + 
Sbjct: 165 HPNDTQRNARAAEVLLATGRTMT-WWHTSSEHTPAPFAALKIGMRLSL----DELEPHLA 219

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   ML +GA+DE           + P    IG  +++A L+GE   ++     +  T 
Sbjct: 220 GRVDAMLAAGAVDEATRAHAKCPDPEAPGWTGIGCAEMLAYLRGETTLEQARSLWVRNTR 279

Query: 190 KYAKRQKTWLCHQFQADWI 208
            YAKRQ TW   +    W 
Sbjct: 280 AYAKRQLTWFAKEPGIRWF 298


>gi|298528102|ref|ZP_07015506.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511754|gb|EFI35656.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 313

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 107/203 (52%), Gaps = 3/203 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGTGLY R+L   L+ +P +   +R  ++ +    G  ILH EL  +D   A +I
Sbjct: 101 IPVLVGGTGLYLRSLIHGLAEIPPVGDDVRRALQLRCMHEGPEILHRELQEIDPEYAARI 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
              D QRI RALE+   +G ++  + +  P+   P     K+ +  +   L++ + RR  
Sbjct: 161 SCRDRQRITRALEVYQDTGFNMTAWHRSQPSG--PFFRVLKLGVYTQWEYLEQGLHRRIQ 218

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ML +GA++E++ + ++   + DLP M  IG R+++  L G+ +    +QR    T  YA
Sbjct: 219 DMLRAGAVEEVQEVCRVYGFNRDLPAMTGIGCREVMDFLAGDTDMKSCIQRWFKNTRDYA 278

Query: 193 KRQKTWLCHQFQADWIRISSIDD 215
           KRQ TW   +    WI+     +
Sbjct: 279 KRQMTWFRKESDVHWIQAGDFSE 301


>gi|239977341|sp|Q5NXR4|MIAA_AZOSE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 320

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYF+AL   LS +P     +R  I     + G   LH +L+ +D   A ++
Sbjct: 94  IPLLAGGTMLYFKALRDGLSDLPAADADLRADIDAAAARLGWPALHAQLAQIDPDAAARL 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             +D QRI RALEI  ++G+ + E + +     +P       ++  +R+ L  RI +RF 
Sbjct: 154 DSADAQRIQRALEIVRLTGRPLAESYARREAAALPFRMLPIALVPSDRAVLHARIEQRFD 213

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML +G IDE+R+L  +  L   LP M+ +G R +   L G  +YD    +GI AT + A
Sbjct: 214 QMLAAGLIDELRALRARYTLDATLPSMRCVGYRQVWEYLDGGDDYDTMRFKGIAATRQLA 273

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW   QF+  W  +  +D L
Sbjct: 274 KRQLTWQ-RQFRDSWPGLVELDCL 296


>gi|258545151|ref|ZP_05705385.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cardiobacterium
           hominis ATCC 15826]
 gi|258519576|gb|EEV88435.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cardiobacterium
           hominis ATCC 15826]
          Length = 321

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 7/206 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LY+  L   +  +P    A R +I  +L   GS  LH EL+ LD   A  I
Sbjct: 98  IPVLVGGTMLYYHTLYTGIDDLPAADPANRARIEARLAAEGSAALHAELARLDPQTAASI 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFW--KQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            P+D QR+ RALE+ L +GQ+    +  +Q   P  P  +   I + P R+ L +RI  R
Sbjct: 158 KPNDRQRLVRALELILTTGQTPSALYAAQQTRRPPWPTLA---IGLNPARAVLHQRIAER 214

Query: 132 FTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  M+  G I+E+ +L  +  LSL  P M+++G R I   L G  + +  +++ IIA+ +
Sbjct: 215 FQMMIAQGFIEEVAALKARPQLSLAAPSMRSVGYRQIWQYLDGASDRESAIEQAIIASRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDL 216
            AKRQ TW+ ++   D + IS  D L
Sbjct: 275 LAKRQITWMNNRLGRD-LAISQYDPL 299


>gi|313668624|ref|YP_004048908.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           lactamica ST-640]
 gi|313006086|emb|CBN87547.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Neisseria lactamica 020-06]
          Length = 313

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           +IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D   A ++ P
Sbjct: 97  LIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVDPETACRLKP 156

Query: 76  SDGQRIARALEIKLVSGQSIIE-FWKQAPN--PFIPLESAHKIIILPE-RSALKERIRRR 131
           +D QRI RALE+  ++G+ + E   +Q+P+  PF      H   ++PE R+ L E I  R
Sbjct: 157 NDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPF----DLHTAALIPENRARLHENIALR 212

Query: 132 FTQMLESGAIDEIRSLMKM--NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           F  MLE G I E+ +L +    L+ D P ++ +G R     L G  +    +++GI AT 
Sbjct: 213 FHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGATDRQTFIEKGIAATR 272

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 273 QLAKRQLTWL 282


>gi|260574663|ref|ZP_05842666.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter sp.
           SW2]
 gi|259023080|gb|EEW26373.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter sp.
           SW2]
          Length = 292

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 110/192 (57%), Gaps = 6/192 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLY  ALT  L+ +P  P A+R +   + K   S  ++  L+ LD+    +I 
Sbjct: 99  PIIVGGTGLYLSALTEGLADIPATPAAVRAEADARRK---SGDINTMLAELDAETRARID 155

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNP-FIPLESAHKIIILPERSALKERIRRRFT 133
           P +  R+ RA E+   +GQ +   W+ A  P  +PL  A  +++ P+ + L  RI  RF 
Sbjct: 156 PLNPMRVQRAWEVLRATGQGLAA-WQNATGPALLPLAKAEALVLRPDAAWLGARIDARFD 214

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            ML++GA++E+R+ +    +  LP  +AIG  +++A L+GE +    +    IA+ +YAK
Sbjct: 215 AMLDAGALEEVRAELPC-WNPALPSARAIGAAELVACLRGETDLATAVAAAKIASRQYAK 273

Query: 194 RQKTWLCHQFQA 205
           RQ+TW   + QA
Sbjct: 274 RQRTWFRSRMQA 285


>gi|296161797|ref|ZP_06844599.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. Ch1-1]
 gi|295887961|gb|EFG67777.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. Ch1-1]
          Length = 315

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 107/191 (56%), Gaps = 6/191 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R  +     + G   +H  L+++D + A ++
Sbjct: 98  LPLLVGGTMLYYKALTQGLNDLPAADADLRATLDADAAREGWPAMHARLAAVDPVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIR 129
            P+D QRI RALE+ +++GQ++      AP       +A + + +     +R  L  RI 
Sbjct: 158 APNDSQRIQRALEVFMLTGQAMSALLA-APARVDDAAAAWRFVPIALEPSDRGVLHARIE 216

Query: 130 RRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RF  ML SG +DE+  L  + +LS ++P M+ +G R +   L G ++Y     +G+ AT
Sbjct: 217 KRFDAMLASGFVDEVVKLRERGDLSPEMPSMRCVGYRQVWEYLDGAVDYSTMRDKGVFAT 276

Query: 189 NKYAKRQKTWL 199
            +  KRQ TWL
Sbjct: 277 RQLCKRQLTWL 287


>gi|94429029|gb|ABF18945.1| delta(2)-isopentenylpyrophosphate adenosine transferase [uncultured
           bacterium pFosLip]
          Length = 303

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 107/188 (56%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYFRALT  ++ +P     IR KI     + G   LH +L  +D   A +I
Sbjct: 86  IPLLVGGTMLYFRALTEGIAELPAADPEIRAKIDANADKIGWEALHQQLLDVDPEAAARI 145

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERIRRRF 132
            P D QRI RALE+ L +G ++ E+ K++    +      K+ +LP  RS L ERI  R 
Sbjct: 146 KPGDRQRIQRALEVFLSTGTTLSEWQKRSGRGRMIDVEFCKLALLPATRSLLHERIETRL 205

Query: 133 TQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
             M  +G ++E+++L  +  L+ + P M+A+G R +   L G ++ +E   + + AT + 
Sbjct: 206 KTMFNNGLLEEVKALYDRPGLTSEHPSMRAVGYRQVWEYLDGRVSVEEARDKALFATRQL 265

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 266 AKRQITWL 273


>gi|56479462|ref|YP_161051.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aromatoleum
           aromaticum EbN1]
 gi|56315505|emb|CAI10150.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aromatoleum
           aromaticum EbN1]
          Length = 382

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++ GGT LYF+AL   LS +P     +R  I     + G   LH +L+ +D   A ++
Sbjct: 156 IPLLAGGTMLYFKALRDGLSDLPAADADLRADIDAAAARLGWPALHAQLAQIDPDAAARL 215

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
             +D QRI RALEI  ++G+ + E + +     +P       ++  +R+ L  RI +RF 
Sbjct: 216 DSADAQRIQRALEIVRLTGRPLAESYARREAAALPFRMLPIALVPSDRAVLHARIEQRFD 275

Query: 134 QMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML +G IDE+R+L  +  L   LP M+ +G R +   L G  +YD    +GI AT + A
Sbjct: 276 QMLAAGLIDELRALRARYTLDATLPSMRCVGYRQVWEYLDGGDDYDTMRFKGIAATRQLA 335

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW   QF+  W  +  +D L
Sbjct: 336 KRQLTWQ-RQFRDSWPGLVELDCL 358


>gi|237748582|ref|ZP_04579062.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes OXCC13]
 gi|229379944|gb|EEO30035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes OXCC13]
          Length = 312

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 2/188 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+ LT  L  +P     IR K+ E+  Q G   +H +LSSLD + A ++
Sbjct: 97  LPLLVGGTMLYFKGLTSGLDDLPGANPEIRAKLDEEAAQIGWPGMHAKLSSLDPVTADRL 156

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
            P+D QRI RALEI  ++G+ + E          P +     +   +RS L ERI  RF 
Sbjct: 157 KPNDAQRIQRALEIIELTGKPLSELHSGQQARSFPFDIIPIALEPSDRSKLHERIALRFD 216

Query: 134 QMLESG-AIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           QML+    I+E+R L  + +L   +P M+ +G R     L GE +     ++GI AT + 
Sbjct: 217 QMLKDDLLIEEVRKLRERGDLHPGMPSMRCVGYRQTWEYLDGEFDRKALREKGIAATRQL 276

Query: 192 AKRQKTWL 199
           AKRQ TWL
Sbjct: 277 AKRQLTWL 284


>gi|323524832|ref|YP_004226985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. CCGE1001]
 gi|323381834|gb|ADX53925.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           sp. CCGE1001]
          Length = 317

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 107/193 (55%), Gaps = 10/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY+RALT  L+ +P     +R ++     + G   LH  L+++D   A ++
Sbjct: 98  LPLLVGGTMLYYRALTQGLNDLPAADATVRAQLDADAARDGWPALHARLAAVDPATAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP------ERSALKER 127
            P+D QRI RALE+ +++G+++         P    E+A +   +P      +RS L  R
Sbjct: 158 APNDSQRIQRALEVFMLTGEAMSALLAA---PARTDEAAAQWHFVPIALEPSDRSVLHAR 214

Query: 128 IRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML +G +DE+  L  + +L+ D+P M+ +G R +   L   ++Y     +G+ 
Sbjct: 215 IEQRFDAMLANGFVDEVVKLRERGDLTPDMPSMRCVGYRQVWEYLDDAVDYSTMRDKGVF 274

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 275 ATRQLCKRQLTWL 287


>gi|241664015|ref|YP_002982375.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           pickettii 12D]
 gi|240866042|gb|ACS63703.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           pickettii 12D]
          Length = 325

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR +I  +  + G   LH +L+ +D + A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAEIDAEAARDGWPALHAKLALVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ--APNPFIPLESAHKIIILP----ERSALKER 127
           H +D QRI RALE+  ++GQ +     +    N F   ++A   + +     +R  L  R
Sbjct: 160 HATDAQRIQRALELYRLTGQPMSALLAREVGANAFQQHDAAAPYLTIALEPSDRLVLHAR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+  L +  +LS  LP ++ +G R   A L+GEI+     ++GI 
Sbjct: 220 IAQRFDAMLAGGLLDEVEGLRRRGDLSPTLPSIRCVGYRQAWAYLEGEIDMAALREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|194290630|ref|YP_002006537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cupriavidus
           taiwanensis LMG 19424]
 gi|239977357|sp|B3R6B8|MIAA_CUPTR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|193224465|emb|CAQ70476.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Cupriavidus taiwanensis LMG 19424]
          Length = 322

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 111/197 (56%), Gaps = 6/197 (3%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           + +  +P+IVGGT LY++ALT  L+ +P+   A+R ++ +   + G   LH  L+ +D +
Sbjct: 98  HARGHVPLIVGGTMLYYKALTQGLNDLPQADAALRAELDQLAAERGWPALHAMLAEVDPV 157

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFW-KQAPNPFI--PLESAHKIIIL--PERSA 123
            A ++ P+D QRI RALEI  +SGQ +     +QA         +  +++I L   +R A
Sbjct: 158 TAARLAPNDAQRIQRALEIHRLSGQPMSALLARQAEGRTFAGAADQRYRVIALEPSDRLA 217

Query: 124 LKERIRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L  RI RR+  ML  G IDE+  L  + +L   LP ++ +G R +   L GE ++    +
Sbjct: 218 LHHRIARRYDAMLAQGFIDEVERLRARGDLHPGLPSIRCVGYRQVWEYLDGEADFATMRE 277

Query: 183 RGIIATNKYAKRQKTWL 199
           RGI AT +  KRQ TWL
Sbjct: 278 RGIAATRQLCKRQLTWL 294


>gi|157828528|ref|YP_001494770.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933244|ref|YP_001650033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           rickettsii str. Iowa]
 gi|239977445|sp|B0BXQ1|MIAA_RICRO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977446|sp|A8GS87|MIAA_RICRS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157801009|gb|ABV76262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908331|gb|ABY72627.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           rickettsii str. Iowa]
          Length = 363

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 107/192 (55%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++ ++R    + G+  L  +L   D + A +I
Sbjct: 149 LPILIGGTGLYINSLVFGYNNIPDISEDLQAQVRNLHVKIGNIELWGKLEKFDPLAASKI 208

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+ + +G+SI  F +  P   I  +   KII L PER  L +    R 
Sbjct: 209 NQNDTQRLIRAYEVFMQTGKSIFSF-QTLPKEQILSDFNCKIIFLNPERKFLYKTCDERL 267

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + GAIDEI  + K     D   +KA+G+++I+A L G +  DE L    I T +YA
Sbjct: 268 DKIFKEGAIDEIALIKKQFAPKDYTNLKAVGIKEILAYLNGNLTLDEALNAAQIRTRQYA 327

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q Q
Sbjct: 328 KRQVTWFKNQIQ 339


>gi|332186895|ref|ZP_08388637.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           sp. S17]
 gi|332013228|gb|EGI55291.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           sp. S17]
          Length = 315

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI+VGGTGLY R L   ++ +P+I  AIR ++R           H  LS  D   A ++
Sbjct: 105 LPILVGGTGLYMRTLLDGIAPVPDIDPAIRAEVRALPVAEA----HAALSRKDPQAAARL 160

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           + +D  R+ARALE+   +G+ + ++            +   +I+LP+R  L  RI  RF 
Sbjct: 161 NAADTTRVARALEVVRSTGRPLHQWQAHKEGGIGERIALSAVILLPDRDWLNARIDTRFG 220

Query: 134 QMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           +ML+ G +DE  +L+ + +L  D PI +AIGV +  ALL+G +   E    G +AT +YA
Sbjct: 221 EMLDEG-LDEAATLLARPDLPADAPIRRAIGVPEAAALLEGRMTRAEAEAAGALATRRYA 279

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TW  HQ    W  IS ID
Sbjct: 280 KRQYTWFRHQPGPGWTAISDID 301


>gi|292493697|ref|YP_003529136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           halophilus Nc4]
 gi|291582292|gb|ADE16749.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           halophilus Nc4]
          Length = 311

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 104/187 (55%), Gaps = 1/187 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF AL   +S +P     +R  I  +    G   LH  L+ LD + A++I
Sbjct: 96  IPLLVGGTMLYFHALRHGISPLPPANPEVRAAIDREAMAMGWEALHRRLAELDPVAAQRI 155

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           H  D QRI RALE+  ++G+ + E          P      I+   ER++L  RI +RF 
Sbjct: 156 HRHDPQRIQRALEVFQLTGRPLSELIADTQEAEFPYRVIKLILAPRERASLHTRIEQRFY 215

Query: 134 QMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            MLE+G ++E+  L K  +LS++L  ++A+G R     L+G  ++   +++ I AT + A
Sbjct: 216 AMLEAGFLEEVNDLFKRPDLSVELSSIRAVGYRQAWLYLQGRFSFPAMVEQAITATRQMA 275

Query: 193 KRQKTWL 199
           KRQ TWL
Sbjct: 276 KRQLTWL 282


>gi|187929905|ref|YP_001900392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           pickettii 12J]
 gi|238691817|sp|B2UBL0|MIAA_RALPJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|187726795|gb|ACD27960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           pickettii 12J]
          Length = 325

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR +I  +  + G   LH +L+ +D + A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAEIDAEAARDGWPALHAKLALVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQ--APNPFIPLESAHKIIILP----ERSALKER 127
           H +D QRI RALE+  ++GQ +     +    N F   ++A   + +     +R  L  R
Sbjct: 160 HTTDAQRIQRALELYRLTGQPMSALLAREVGANAFQQHDAAAPYLTIALEPSDRLVLHAR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+  L +  +LS  LP ++ +G R   A L+GEI+     ++GI 
Sbjct: 220 IAQRFDAMLAGGLLDEVEGLRRRGDLSPTLPSIRCVGYRQAWAYLEGEIDMAALREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|207721714|ref|YP_002252153.1| trna delta(2)-isopentenylpyrophosphate transferase (ipptransferase)
           (isopentenyl-diphosphate:trna isopentenyltransferase)
           (iptase) (ippt) protein [Ralstonia solanacearum MolK2]
 gi|206586876|emb|CAQ17461.1| trna delta(2)-isopentenylpyrophosphate transferase (ipptransferase)
           (isopentenyl-diphosphate:trna isopentenyltransferase)
           (iptase) (ippt) protein [Ralstonia solanacearum MolK2]
          Length = 327

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 110/199 (55%), Gaps = 19/199 (9%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    A+R +I  +  + G   LH +L+ +D + A ++
Sbjct: 104 LPLIVGGTMLYYKALTQGLSDLPGADPALRAEIDAEAARDGWPALHAKLAQIDPVTAARL 163

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----------QAPNPFIPLESAHKIIILP-ER 121
           H +D QRI RALE+  ++GQ +                +A  P++       I + P +R
Sbjct: 164 HATDAQRIQRALELYRLTGQPMSALLARETGGSAFHRHEAAAPYL------SIALEPSDR 217

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L  RI +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+    
Sbjct: 218 TVLHARIAQRFDAMLAGGLLDEVEALRRRGDLSPTLPSIRCVGYRQAWAYLDGEIDMAAL 277

Query: 181 LQRGIIATNKYAKRQKTWL 199
            ++GI AT +  KRQ TWL
Sbjct: 278 REQGIAATRQLCKRQITWL 296


>gi|15604370|ref|NP_220886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           prowazekii str. Madrid E]
 gi|6225674|sp|Q9ZD37|MIAA_RICPR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|3861062|emb|CAA14962.1| TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE TRANSFERASE (miaA)
           [Rickettsia prowazekii]
 gi|292572123|gb|ADE30038.1| tRNAdelta(2)-isopentenylpyrophosphate transferase [Rickettsia
           prowazekii Rp22]
          Length = 311

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 105/192 (54%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY   L    + +P+I   +R ++R    + G+  L ++L  LD I + +I
Sbjct: 95  LPILIGGTGLYINLLVFGYNNIPDISEDLRVQVRNLHDKIGNIELWNQLKKLDPIASTKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           +  D QR+ RA E+ + +G+SI  F   AP   I  +   KII L PER  L +    R 
Sbjct: 155 NHCDTQRLIRAYEVFMHTGKSIFSF-HTAPKERILSDFNFKIIFLNPERKFLYKTCDERL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ +  AIDEI  L K     +   +KA+G+++I+A L G +  D  L    + T +YA
Sbjct: 214 DKIFKDKAIDEIALLKKQFTPEEYAHLKAVGIKEILAYLDGNLTLDAALNVAQMRTRQYA 273

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  HQ Q
Sbjct: 274 KRQVTWFTHQIQ 285


>gi|307945887|ref|ZP_07661223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseibium sp.
           TrichSKD4]
 gi|307771760|gb|EFO30985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseibium sp.
           TrichSKD4]
          Length = 322

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 116/197 (58%), Gaps = 4/197 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGTGLY++ALT   + +PEI  AIR + R+     G   +   L+ LD+  A ++ 
Sbjct: 108 PILVGGTGLYYKALTEGFAQIPEIDAAIRAECRDLADTGGIEAVRSALAPLDAAAAAEL- 166

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQA-PNPFIPLESAHKIIILPERSALKERIRRRFT 133
             D QR+ RALE+   +G+S+  +  ++   P +PL +   I++ P R  L +RI +R  
Sbjct: 167 -DDLQRLTRALEVIKATGKSLSHWQSESHAAPLLPLSNTLPIVLAPPRPWLHDRIAQRSA 225

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
            M  S   +E+ S ++  L   LP M+AIGV++I +LLK E +  E  +R + AT +YAK
Sbjct: 226 LMTGSAGQNEVASFLERRLDPTLPAMRAIGVKEISSLLKDECDEAEARERLVTATRQYAK 285

Query: 194 RQKTWLCHQFQADWIRI 210
           RQ+TW  +Q  + W RI
Sbjct: 286 RQETWFRNQM-SHWRRI 301


>gi|326333223|ref|ZP_08199470.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nocardioidaceae
           bacterium Broad-1]
 gi|325948867|gb|EGD40960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nocardioidaceae
           bacterium Broad-1]
          Length = 310

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 110/201 (54%), Gaps = 7/201 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGG+ LY RA+  +    P   T +RE++ ++L+  G   LHD L +LD + A +I 
Sbjct: 101 PVLVGGSALYTRAILDRFE-FPGTSTEVRERLEKELETAGEKALHDRLRALDPVAAERIE 159

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +G+R+ RALE+  ++G+    F  + P       ++ +I +   R AL  RIR+R  +
Sbjct: 160 VDNGRRVVRALEVIELTGEP---FSARLPEQVYEDPASIQIGVDISREALDVRIRQRVAE 216

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M E+G +DE+  L++  L       KAIG  ++ A L  E++ +E ++R  I T ++A+R
Sbjct: 217 MFEAGFVDEVARLLEAGLGGSRTAAKAIGYNEVAAYLAQELSLEEAMERTAIRTRQFARR 276

Query: 195 QKTWLCHQFQADWIRISSIDD 215
           Q  W     +  W+   S DD
Sbjct: 277 QDAWFRKDPRVVWV---SYDD 294


>gi|299065824|emb|CBJ37003.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Ralstonia solanacearum CMR15]
          Length = 323

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 111/193 (57%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR +I  +  + G   LH +L+ +D + A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAEIDAEAARDGWPALHAKLAQVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQ--SIIEFWKQAPNPFIPLESAH---KIIILP-ERSALKER 127
           H +D QRI RALE+  ++GQ  S +   +     F   E+A     I + P +R+ L  R
Sbjct: 160 HATDAQRIQRALELYRLTGQPMSALLAREAGAAAFHRHEAAAAYLSIALEPADRAVLHAR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+     ++GI 
Sbjct: 220 IAQRFDAMLADGLLDEVEALRRRGDLSPALPSIRCVGYRQAWAYLDGEIDMAALREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|126737620|ref|ZP_01753350.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           SK209-2-6]
 gi|126721013|gb|EBA17717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseobacter sp.
           SK209-2-6]
          Length = 286

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 10/190 (5%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHI-LHDELSSLDSIVARQIH 74
           IIVGGTGLYF ALT  L+ +P     +R K        G  + L   +  LD+  A QI 
Sbjct: 98  IIVGGTGLYFSALTEGLAEIPLTAPEVRAK--------GDLLSLESLIQDLDAATAAQID 149

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            ++  R+ RA E+   +G+ +IE+  + P P + L     +++   +  L+ RIRRRF Q
Sbjct: 150 LNNRARVQRAWEVLHQTGRPLIEWQAETPPPLLSLADCTPLVMQSPKEWLEPRIRRRFDQ 209

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           MLE GA++E+ + M+      LP  KAIGV +++    G+   DE  +R  I+T +YAKR
Sbjct: 210 MLEQGALEEVEA-MRDRYDPALPSCKAIGVPELMDYATGQATLDEARERAAISTRRYAKR 268

Query: 195 QKTWLCHQFQ 204
           Q++W   + Q
Sbjct: 269 QRSWFRSRMQ 278


>gi|83748956|ref|ZP_00945965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           solanacearum UW551]
 gi|207744183|ref|YP_002260575.1| trna delta(2)-isopentenylpyrophosphate transferase (ipptransferase)
           (isopentenyl-diphosphate:trna isopentenyltransferase)
           (iptase) (ippt) protein [Ralstonia solanacearum IPO1609]
 gi|83724379|gb|EAP71548.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           solanacearum UW551]
 gi|206595588|emb|CAQ62515.1| trna delta(2)-isopentenylpyrophosphate transferase (ipptransferase)
           (isopentenyl-diphosphate:trna isopentenyltransferase)
           (iptase) (ippt) protein [Ralstonia solanacearum IPO1609]
          Length = 327

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 110/199 (55%), Gaps = 19/199 (9%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    A+R +I  +  + G   LH +L+ +D + A ++
Sbjct: 104 LPLIVGGTMLYYKALTQGLSDLPGADPALRAEIDAEAARDGWPALHAKLAQVDPVTAARL 163

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWK-----------QAPNPFIPLESAHKIIILP-ER 121
           H +D QRI RALE+  ++GQ +                +A  P++       I + P +R
Sbjct: 164 HATDAQRIQRALELYRLTGQPMSALLAREAGGSAFHRHEAAAPYL------SIALEPSDR 217

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L  RI +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+    
Sbjct: 218 TVLHARIAQRFDAMLAGGLLDEVETLRRRGDLSPALPSIRCVGYRQAWAYLDGEIDMAAL 277

Query: 181 LQRGIIATNKYAKRQKTWL 199
            ++GI AT +  KRQ TWL
Sbjct: 278 REQGIAATRQLCKRQITWL 296


>gi|300690567|ref|YP_003751562.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Ralstonia solanacearum PSI07]
 gi|299077627|emb|CBJ50263.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Ralstonia solanacearum PSI07]
          Length = 323

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 109/193 (56%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR ++  +  + G   LH  L+ +D I A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAELDAEAARDGWPALHARLAQVDPITAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQ--SIIEFWKQAPNPFIPLESAHKIIILP----ERSALKER 127
           H +D QRI RALE+  ++GQ  S +   +     F   E+A   + +     +R+ L  R
Sbjct: 160 HATDAQRIQRALELYRLTGQPMSALLAREAGAGAFHRHEAAAPYLTIALEPSDRAVLHTR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+     ++GI 
Sbjct: 220 IAQRFDAMLAGGLLDEVDALRRRGDLSPTLPSIRCVGYRQAWAYLDGEIDMAALREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|17547283|ref|NP_520685.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ralstonia
           solanacearum GMI1000]
 gi|21263769|sp|Q8XWB0|MIAA_RALSO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|17429585|emb|CAD16271.1| probable trna delta(2)-isopentenylpyrophosphate transferase
           (ipptransferase) (isopentenyl-diphosphate:trna
           isopentenyltransferase) (iptase) (ippt) protein
           [Ralstonia solanacearum GMI1000]
          Length = 323

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 111/193 (57%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    AIR +I  +  + G   LH +L+ +D + A ++
Sbjct: 100 LPLIVGGTMLYYKALTQGLSDLPGADPAIRAEIDAEAARDGWPALHAKLAQVDPVTAARL 159

Query: 74  HPSDGQRIARALEIKLVSGQ--SIIEFWKQAPNPFIPLESAH---KIIILP-ERSALKER 127
           H +D QRI RALE+  ++GQ  S +   +     F   E+A     I + P +R+ L  R
Sbjct: 160 HATDAQRIQRALELYRLTGQPMSALLAREAGAAAFHRHEAAAAYLSIALEPADRAVLHAR 219

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+     ++GI 
Sbjct: 220 IAQRFDAMLAGGLLDEVEALRRRGDLSPVLPSIRCVGYRQAWAYLDGEIDMATLREQGIA 279

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 280 ATRQLCKRQITWL 292


>gi|117923592|ref|YP_864209.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Magnetococcus
           sp. MC-1]
 gi|239977408|sp|A0L4B0|MIAA_MAGSM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117607348|gb|ABK42803.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Magnetococcus
           sp. MC-1]
          Length = 306

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKI-REKLKQYGSHILHDELSSLDS 67
           +++  +P +VGGTG YFRA+   ++ +PE+   I  ++ R    + G    + +L  +D 
Sbjct: 81  HRRGVIPALVGGTGFYFRAVEQGIAEIPEVDAQIVAELNRRVCDEVGLACCYAQLQQVDP 140

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP---ERSAL 124
             A ++ P D QRI R L + L SGQ +  +W+Q      P   A +I  L     R  L
Sbjct: 141 PWAARVEPGDRQRIVRGLSVYLASGQPL-SYWQQLSCQQAPEGPALRICKLAIEWPREQL 199

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
             RI +RF QML+ G ++E++ L+      DLP M+A+G R +I  L+G  +    ++ G
Sbjct: 200 YARINQRFEQMLKEGFMEEVQGLLSRGYHGDLPAMRAVGYRALIGYLQGAYDLARAVELG 259

Query: 185 IIATNKYAKRQKTWLCHQFQADWI 208
              + +YAKRQ TWL  +    W+
Sbjct: 260 QRDSRRYAKRQITWLKAEPGLQWL 283


>gi|284032606|ref|YP_003382537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kribbella
           flavida DSM 17836]
 gi|283811899|gb|ADB33738.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kribbella
           flavida DSM 17836]
          Length = 323

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 110/205 (53%), Gaps = 4/205 (1%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           +++ +P++ GG+ LY RA+       P    A+RE++  +L ++GS  LH  L+ +D   
Sbjct: 91  RRQVVPVLAGGSALYVRAILDDFE-FPGTDPAVRERLEAELAEHGSGALHRRLAEVDPPA 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A QI PS+G+RI RALE+  ++G     +    P        A ++ +   R  L ERI 
Sbjct: 150 AAQILPSNGRRIVRALEVVEITGAP---YAATLPAHTYVYPGAVQLGLDVPRPELDERIG 206

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RR  +M E G +DE+R+L+   L       +A+G   +IALL+GE+   +  ++   AT 
Sbjct: 207 RRVDRMFEQGFVDEVRALLGQGLLDGRTANRALGYPQVIALLRGELTEQQAREQTAQATR 266

Query: 190 KYAKRQKTWLCHQFQADWIRISSID 214
           ++A+RQ +W     +  W+R  + D
Sbjct: 267 RFARRQDSWFRKDPRITWLRYDAPD 291


>gi|330427270|gb|AEC18604.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pusillimonas
           sp. T7-7]
          Length = 310

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 107/191 (56%), Gaps = 8/191 (4%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+I GGT LY++AL   L+ +P     +R  I  + +  G   LH +LS  D   A ++
Sbjct: 94  LPLICGGTMLYYKALREGLNNLPTADPVVRAAIDSEARACGWPELHRQLSEFDPDTAARL 153

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL----PERSALKERIR 129
            P+D QR+ RA+EI  VSG+ + + W     P    +S+H+ + L     +R AL  RI 
Sbjct: 154 APNDSQRLQRAIEIYRVSGRPMSD-WLADARP--EQDSSHQFVTLSLEPSDRLALHARIA 210

Query: 130 RRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            R+  M+  G +DE+R L  + +L  DLP ++ +G R +   L G I+ D+ +++ + AT
Sbjct: 211 ARYHAMIREGLLDEVRGLHARPDLHTDLPSVRCVGYRQLWDYLDGRISMDQAIEQAVAAT 270

Query: 189 NKYAKRQKTWL 199
            + AKRQ TWL
Sbjct: 271 RQLAKRQLTWL 281


>gi|17940762|gb|AAL49760.1|AF452713_1 isopentenyl tRNA transferase [Methylobacterium extorquens]
          Length = 297

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 108/214 (50%), Gaps = 46/214 (21%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+ VGGTGLYFR+L   +S +PE+P AIR++IR +     +  LH  +            
Sbjct: 103 PVFVGGTGLYFRSLDEGISDLPEVPDAIRQQIRAEADGQQTETLHAAM------------ 150

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFI--PLESAHKIIILPERSALKERIRRR 131
                   RAL+I   +G+SI  F + + P P    PL    K+ +  ER AL++RI  R
Sbjct: 151 --------RALQIHAATGRSIGSFHEARVPGPLAGKPL---LKLFLATEREALRQRIDAR 199

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT--- 188
           F  M+E GA+DE+ +L +  L   LP+M+A GV  +IA L G I+ +E +QRG   T   
Sbjct: 200 FVTMMEQGALDEVAALRERRLDPLLPVMRAHGVPGLIAYLDGTISREEAIQRGQGDTRWA 259

Query: 189 -----------------NKYAKRQKTWLCHQFQA 205
                             +YAKRQ TW  H+  A
Sbjct: 260 RIGTGPRRKQRGPWSRPRRYAKRQFTWFRHRLSA 293


>gi|172059744|ref|YP_001807396.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           ambifaria MC40-6]
 gi|238689183|sp|B1YTV7|MIAA_BURA4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|171992261|gb|ACB63180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           ambifaria MC40-6]
          Length = 324

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 105/190 (55%), Gaps = 6/190 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++ GGT LY++ALT  L+ +P    A+R ++     + G   LH  L+ +D   A ++ 
Sbjct: 102 PLLAGGTMLYYKALTQGLNDLPTADPAVRAELDADAARDGWPALHARLAQVDPATAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIRR 130
           P+D QRI RALE+ L+SGQ  +     AP       +A++ + +     +R+ L  RI +
Sbjct: 162 PNDSQRIQRALEVFLLSGQP-MSVLLAAPRRADDEAAAYRFVPVALEPSDRAVLHARIAQ 220

Query: 131 RFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF  ML++G IDE+  L +  +L  DLP M+ +G R     L G+ +Y     +GI AT 
Sbjct: 221 RFDAMLDAGFIDEVERLRRREDLHPDLPSMRCVGYRQAWEFLDGDTDYRTMRDKGIFATR 280

Query: 190 KYAKRQKTWL 199
           +  KRQ TWL
Sbjct: 281 QLCKRQITWL 290


>gi|92113402|ref|YP_573330.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Chromohalobacter salexigens DSM 3043]
 gi|123084128|sp|Q1QY27|MIAA_CHRSD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91796492|gb|ABE58631.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Chromohalobacter salexigens DSM 3043]
          Length = 312

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 104/201 (51%), Gaps = 1/201 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGGT +Y + L   ++ +P    A+RE +  + +  G   LH ELS +D + A  IH
Sbjct: 98  PILVGGTMMYIKRLIDGVASLPARDPALREALNARAESEGLVALHRELSRVDPVAAETIH 157

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P + QR+ RALE+  ++G+++ E W +      P       +    R  L  RI  RF  
Sbjct: 158 PHNRQRLLRALEVYQLTGRALGELWAEQARETFPWRLVSIALAPNARHVLHARIAERFDS 217

Query: 135 MLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML +G  DE+ +L  + +L   LP ++ +G R +   L+GE +     +RG+ AT + AK
Sbjct: 218 MLAAGFRDEVAALQARGDLHRGLPAIRCVGYRQMWEHLRGETDAATMRERGLAATRQLAK 277

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TWL       WI   + D
Sbjct: 278 RQLTWLRGWEGVHWIDSDASD 298


>gi|312135297|ref|YP_004002635.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Caldicellulosiruptor owensensis OL]
 gi|311775348|gb|ADQ04835.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Caldicellulosiruptor owensensis OL]
          Length = 312

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 121/215 (56%), Gaps = 13/215 (6%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA--IREKIREKLKQYGSHILHDELS 63
           L  YKK  +P++VGGTG Y +++   +   PE+  +  IR  + ++L + G+  L++ L 
Sbjct: 87  LDIYKKGKVPLLVGGTGFYIKSVVDDVEF-PEMGDSKQIRRMLYDELNRKGNMYLYNLLK 145

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP---- 119
            +D   A  +HP++ +R+ R LEI  ++G+   EF  +     +  + + K  +LP    
Sbjct: 146 GIDQDAANSVHPNNVKRVIRYLEIYFLTGKKPTEFLDK-----VRRKGSEKYNVLPLCFI 200

Query: 120 -ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            ER AL +RI +R  +M + G  DE++ L+ M  S DL  M+ +G + +I  ++G+I+  
Sbjct: 201 MEREALWQRIEKRVEKMFDMGLADEVKKLLDMGYSKDLKSMQGLGYKQVIPYVEGKISLQ 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E  +  II T ++AKRQ+ W  +Q +  ++ I+ +
Sbjct: 261 EAKEELIIKTRQFAKRQRIWFKYQGEFMFLDITGM 295


>gi|300703173|ref|YP_003744775.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Ralstonia solanacearum CFBP2957]
 gi|299070836|emb|CBJ42137.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Ralstonia solanacearum CFBP2957]
          Length = 327

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 112/193 (58%), Gaps = 7/193 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP+IVGGT LY++ALT  LS +P    A+R +I  +  + G   LH +L+ +D + A ++
Sbjct: 104 LPLIVGGTMLYYKALTQGLSDLPGADPALRAEIDAEAARDGWPALHAKLAQVDPVTAARL 163

Query: 74  HPSDGQRIARALEIKLVSGQ--SIIEFWKQAPNPFIPLESAH---KIIILP-ERSALKER 127
           H +D QRI RALE+  ++GQ  S +   +   + F   E+A     I + P +R+ L  R
Sbjct: 164 HDTDAQRIQRALELYRLTGQPMSALLAREAGASAFHRHEAAAPYLSIALEPSDRTVLHAR 223

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G +DE+ +L +  +LS  LP ++ +G R   A L GEI+     ++GI 
Sbjct: 224 IAQRFDAMLAGGLLDEVEALRRRGDLSPALPSIRCVGYRQAWAYLDGEIDMAALREQGIA 283

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 284 ATRQLCKRQITWL 296


>gi|85859790|ref|YP_461992.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophus
           aciditrophicus SB]
 gi|123516899|sp|Q2LUR0|MIAA2_SYNAS RecName: Full=tRNA dimethylallyltransferase 2; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 2; Short=DMAPP:tRNA
           dimethylallyltransferase 2; Short=DMATase 2; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           2; Short=IPP transferase 2; Short=IPPT 2; Short=IPTase 2
 gi|85722881|gb|ABC77824.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophus
           aciditrophicus SB]
          Length = 311

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I+VGGTGLY RA+ G L   P    A+R      L++ G   L+  L + D   A  IHP
Sbjct: 101 IVVGGTGLYIRAVLGGLFDGPAADEALRRHYFTILEREGKAGLYGMLKARDRRAAAIIHP 160

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQ---APNPFIPLESAHKIIILPERSALKERIRRRF 132
           +D  R+ RALE+  ++G SI+E  ++   A  P+  L    KI +   RS L ERI  R 
Sbjct: 161 NDTTRMIRALEVLDLTGVSIVEQQQEHRFAQRPYRVL----KIGLRCSRSVLYERIEART 216

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            +ML  G +DE+R L+ M     L  M+A+G R ++  LKGE++ DE + +    T +YA
Sbjct: 217 EEMLAQGFLDEVRQLLDMGFHEGLRPMQALGYRQMVGFLKGELDLDEAVDQLKRETRRYA 276

Query: 193 KRQKTWLCHQFQADWIRISSIDDLF 217
           KRQ TW     +  W    + +++ 
Sbjct: 277 KRQLTWFGADPEIRWFEPGNEEEIL 301


>gi|91781910|ref|YP_557116.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           xenovorans LB400]
 gi|123359142|sp|Q145C5|MIAA_BURXL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91685864|gb|ABE29064.1| tRNA isopentenyltransferase [Burkholderia xenovorans LB400]
          Length = 315

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 107/191 (56%), Gaps = 6/191 (3%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R  +     + G   +H  L+++D + A ++
Sbjct: 98  LPLLVGGTMLYYKALTQGLNDLPAADADLRATLDADAAREGWPAMHARLAAVDPVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIR 129
            P+D QRI RALE+ +++GQ++      AP       +A + + +     +R  L  RI 
Sbjct: 158 APNDSQRIQRALEVFMLTGQAMSALLA-APARVDDAAAAWRFVPVALEPSDRGVLHARIE 216

Query: 130 RRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +RF  ML +G +DE+  L  + +LS ++P M+ +G R +   L G ++Y     +G+ AT
Sbjct: 217 KRFDAMLANGFVDEVVKLRERGDLSPEMPSMRCVGYRQVWEYLDGAVDYSTMRDKGVFAT 276

Query: 189 NKYAKRQKTWL 199
            +  KRQ TWL
Sbjct: 277 RQLCKRQLTWL 287


>gi|296135716|ref|YP_003642958.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thiomonas
           intermedia K12]
 gi|295795838|gb|ADG30628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thiomonas
           intermedia K12]
          Length = 309

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 113/190 (59%), Gaps = 9/190 (4%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P+IVGGT LY +AL   LS +P+   A+R ++  +  + G   LH  L+ +D + A ++ 
Sbjct: 104 PLIVGGTLLYLKALQSGLSELPQADPAVRAELDAEAARLGWPALHARLAEVDPLTAARLA 163

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIIL--PERSALKERIRR 130
           P D QRI RALE+  +SG+ +       +A +  +PL    +I+ L   +RS L  RI +
Sbjct: 164 PGDAQRIQRALEVWQLSGRPLSAHLAVGRADDDPLPL----RILSLEPSDRSVLHARIAQ 219

Query: 131 RFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF QML +G +DE+R+L  + +LS  LP ++A+G R     L G+I+ ++  ++ I AT 
Sbjct: 220 RFEQMLAAGFLDEVRALRQRGDLSPALPSIRAVGYRQAWHYLDGDISAEQFREQAIAATR 279

Query: 190 KYAKRQKTWL 199
           + AKRQ TWL
Sbjct: 280 QLAKRQLTWL 289


>gi|182435522|ref|YP_001823241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|238688998|sp|B1VXU2|MIAA_STRGG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|178464038|dbj|BAG18558.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 312

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 106/194 (54%), Gaps = 5/194 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGG+GLY +     L   P     +R ++  +L + GS +LH+ L++ D   AR I 
Sbjct: 100 PILVGGSGLYVKGAIDALE-FPGTDPEVRARLEAELAERGSGVLHERLAAADPDAARSIL 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            S+G+RI RALE+  ++G+    F    P    P+  A +I +  ER  L ERI RR  +
Sbjct: 159 ASNGRRIVRALEVIEITGKP---FTANLPGDE-PVYDAVQIGVDVERPELDERIARRVDR 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M ++G +DE+R+L    L   L   +A+G + I+A+L GE   D+     + AT ++A+R
Sbjct: 215 MWDAGLVDEVRALEAAGLREGLTASRALGYQQILAVLAGECTEDDARAETVRATKRFARR 274

Query: 195 QKTWLCHQFQADWI 208
           Q +W     +  W+
Sbjct: 275 QDSWFRRDARVVWL 288


>gi|168186345|ref|ZP_02620980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum C str. Eklund]
 gi|169295785|gb|EDS77918.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum C str. Eklund]
          Length = 315

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQYGSHILHDELSSLDSIVARQ 72
           LP++VGGTG Y  +L               RE ++E   ++G   +H+ L ++D    ++
Sbjct: 94  LPMVVGGTGFYIDSLIFNYDFANTYKDEEYREYLKELAYEHGKEYVHELLKNIDEKSYKK 153

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           ++P+D +R+ RALE+  ++G++I EF K+     IP  + +  ++  +RS L ERI +R 
Sbjct: 154 LYPNDLKRVIRALEVFKLTGKTISEFNKEQDIFDIPY-NVYYFVLNMDRSKLYERINKRV 212

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
             M+E G I+E++SL  M  + D+  MK IG ++I+  L G ++ DE ++     +  YA
Sbjct: 213 DIMMEKGLIEEVKSLQNMGCTPDMQSMKGIGYKEILYYLDGNLSLDEAIELIKKGSRHYA 272

Query: 193 KRQKTWLCHQFQADWI 208
           KRQ TW     +  WI
Sbjct: 273 KRQLTWFRKDKRVIWI 288


>gi|260654146|ref|ZP_05859636.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Jonquetella
           anthropi E3_33 E1]
 gi|260631131|gb|EEX49325.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Jonquetella
           anthropi E3_33 E1]
          Length = 316

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 103/195 (52%), Gaps = 4/195 (2%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P+ VGGT  Y++AL G L I   +P    E +R +L       LH  L  +D + A+++
Sbjct: 102 VPLFVGGTPFYYQALMGGL-ISVNVPP--DEGVRSQLNGMTDVELHGRLGEVDPLTAKRL 158

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D  RI RALEI  V+G    E + QA     PL+  + + +  +R  L+E I +R  
Sbjct: 159 HPNDRFRILRALEIYSVTGTPPSELFAQAKKTGGPLDVLY-LGLNRDREELREIIAQRVK 217

Query: 134 QMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           +  ++G  DE+  L+    S DLP MK  G R++ A  +G + Y E L   + AT ++AK
Sbjct: 218 EQFDAGYADEVEWLLSHGFSADLPSMKGFGYRELAAYHQGRMTYQEALDGDVTATRQFAK 277

Query: 194 RQKTWLCHQFQADWI 208
           RQ TW      A W 
Sbjct: 278 RQMTWFRKFEPAVWF 292


>gi|115350713|ref|YP_772552.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           ambifaria AMMD]
 gi|123322714|sp|Q0BI05|MIAA_BURCM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115280701|gb|ABI86218.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           ambifaria AMMD]
          Length = 324

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 105/190 (55%), Gaps = 6/190 (3%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++ GGT LY++ALT  L+ +P    A+R ++     + G   LH  L+ +D   A ++ 
Sbjct: 102 PLLAGGTMLYYKALTQGLNDLPTADPAVRAELDADAARDGWPALHARLAQVDPATAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP----ERSALKERIRR 130
           P+D QRI RALE+ L+SGQ  +     AP       +A++ + +     +R+ L  RI +
Sbjct: 162 PNDSQRIQRALEVFLLSGQP-MSVLLAAPRRADDEAAAYRFVPVALEPSDRAVLHARIAQ 220

Query: 131 RFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RF  ML++G IDE+  L +  +L L LP M+ +G R     L G+ +Y     +GI AT 
Sbjct: 221 RFDAMLDAGFIDEVERLRRREDLHLGLPSMRCVGYRQAWEFLDGDTDYRTMRDKGIFATR 280

Query: 190 KYAKRQKTWL 199
           +  KRQ TWL
Sbjct: 281 QLCKRQITWL 290


>gi|187922755|ref|YP_001894397.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           phytofirmans PsJN]
 gi|187713949|gb|ACD15173.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           phytofirmans PsJN]
          Length = 319

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 105/193 (54%), Gaps = 10/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R  +     + G   LH  L++LD + A ++
Sbjct: 102 LPLLVGGTMLYYKALTQGLNDLPAADAEVRATLDADAAREGWPALHARLAALDPVTAARL 161

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP------ERSALKER 127
            P+D QRI RALE+ +++GQ++         P +  +SA     +P      ERS L  R
Sbjct: 162 APNDSQRIQRALEVFMLTGQTMSALLAA---PVMQDDSAALWRFVPIALEPSERSVLHAR 218

Query: 128 IRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G IDE+  L  + +L  ++  M+ +G R +   L G ++Y     +G+ 
Sbjct: 219 IEKRFDAMLAGGFIDEVVKLRERGDLLPEMASMRCVGYRQVWEYLDGAVDYSTMRDKGVF 278

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 279 ATRQLCKRQLTWL 291


>gi|283850639|ref|ZP_06367926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. FW1012B]
 gi|283573882|gb|EFC21855.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. FW1012B]
          Length = 308

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 99/199 (49%), Gaps = 2/199 (1%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++  LP++VGGTGLYFRA+ G L+ +P +P  +R  +  +    G  + H  L ++D   
Sbjct: 91  ERGLLPLLVGGTGLYFRAILGGLAPIPPVPPEVRTAVAREYDAAGPSVAHARLVAVDPDA 150

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +I+P+D QR+ RALE+   +G+++   W    +P  P     KI +   R+ L   + 
Sbjct: 151 AARINPADRQRVTRALEVWAATGRTLTS-WHAEGDPEAPDYDIFKIGLALPRNVLARHLA 209

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   M   GA+DE+R+ +      D P +  IG  ++ A L G           +  T 
Sbjct: 210 NRIEAMAAGGAVDEVRAALA-RYPADAPGLSGIGGPELAAFLSGARPLAAAKSAWLSNTR 268

Query: 190 KYAKRQKTWLCHQFQADWI 208
            YAKRQ+TW   +    W 
Sbjct: 269 AYAKRQETWFRKEPDVVWF 287


>gi|239977335|sp|B2T068|MIAA_BURPP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 315

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 105/193 (54%), Gaps = 10/193 (5%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LY++ALT  L+ +P     +R  +     + G   LH  L++LD + A ++
Sbjct: 98  LPLLVGGTMLYYKALTQGLNDLPAADAEVRATLDADAAREGWPALHARLAALDPVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP------ERSALKER 127
            P+D QRI RALE+ +++GQ++         P +  +SA     +P      ERS L  R
Sbjct: 158 APNDSQRIQRALEVFMLTGQTMSALLAA---PVMQDDSAALWRFVPIALEPSERSVLHAR 214

Query: 128 IRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G IDE+  L  + +L  ++  M+ +G R +   L G ++Y     +G+ 
Sbjct: 215 IEKRFDAMLAGGFIDEVVKLRERGDLLPEMASMRCVGYRQVWEYLDGAVDYSTMRDKGVF 274

Query: 187 ATNKYAKRQKTWL 199
           AT +  KRQ TWL
Sbjct: 275 ATRQLCKRQLTWL 287


>gi|302670848|ref|YP_003830808.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
           [Butyrivibrio proteoclasticus B316]
 gi|302395321|gb|ADL34226.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
           [Butyrivibrio proteoclasticus B316]
          Length = 312

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 108/202 (53%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
           +PIIVGGTG Y +A+   +     +   + R  + E++K  G H LH+EL ++D + A  
Sbjct: 93  VPIIVGGTGFYIQAVLYDIDFTETDEDDSYRHILEERVKTEGVHALHEELRAVDPVSADM 152

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           IH ++ +R+ RALE    +G+ I E  ++      P +  +  ++  ER  L  RI +R 
Sbjct: 153 IHENNSKRVIRALEYFHKTGRPISEHNEEQHQRLSPYDFRY-FVLTDERKTLYSRIDKRV 211

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QM+E G +DE++SL K N+      M+++G R+I+  L GE + +  +    + T  +A
Sbjct: 212 DQMIEDGLVDEVKSLEKYNIPRAATSMQSLGYREILGYLDGEYDLERAIYLIKLNTRHFA 271

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TW   +    WI  +  D
Sbjct: 272 KRQLTWFRREKDVIWIDKNEFD 293


>gi|326776159|ref|ZP_08235424.1| tRNA dimethylallyltransferase [Streptomyces cf. griseus XylebKG-1]
 gi|326656492|gb|EGE41338.1| tRNA dimethylallyltransferase [Streptomyces cf. griseus XylebKG-1]
          Length = 312

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 106/194 (54%), Gaps = 5/194 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PI+VGG+GLY +     L   P     +R ++  +L + GS +LH+ L++ D   AR I 
Sbjct: 100 PILVGGSGLYVKGAIDALE-FPGTDPEVRARLEAELAERGSGVLHERLAAADPDAARSIL 158

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
            S+G+RI RALE+  ++G+    F    P    P+  A +I +  ER  L ERI RR  +
Sbjct: 159 ASNGRRIVRALEVIEITGKP---FTANLPGDE-PVYDAVQIGVDVERPELDERIARRVDR 214

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           M ++G +DE+R+L    L   L   +A+G + I+A+L GE   D+     + AT ++A+R
Sbjct: 215 MWDAGLVDEVRALEASGLREGLTASRALGYQQILAVLAGECTEDDARAETVRATKRFARR 274

Query: 195 QKTWLCHQFQADWI 208
           Q +W     +  W+
Sbjct: 275 QDSWFRRDARVVWL 288


>gi|110835065|ref|YP_693924.1| tRNA isopentenyltransferase [Alcanivorax borkumensis SK2]
 gi|123050327|sp|Q0VME6|MIAA_ALCBS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110648176|emb|CAL17652.1| tRNA isopentenyltransferase [Alcanivorax borkumensis SK2]
          Length = 329

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 108/208 (51%), Gaps = 13/208 (6%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LP++VGGT LYF+AL   L+ +PE    +R +I       G   +H  L+ +D + A ++
Sbjct: 98  LPLLVGGTVLYFKALVEGLAPLPEADPVVRAEIAALADAQGWPAVHQALAEVDPVTAARL 157

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPF------------IPLESAHKIIILPER 121
            P+D QR+ RALE+  ++G+ +  F  +                 +P       +   +R
Sbjct: 158 KPTDKQRLQRALEVFRLTGRPLAAFHAEHDKTLTKSRDGLSQFSGLPYPVLSTALAPQDR 217

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L E+I  RF  ML SG  +E+ +L +   L+ DLP ++A+G R +   L G   YD  
Sbjct: 218 AWLHEQIALRFRAMLNSGLQEEVEALRQQPQLNADLPGIRAVGYRQMWEYLDGMYGYDSM 277

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWI 208
           ++RGIIAT + AKRQ TWL    +  W 
Sbjct: 278 VERGIIATRQLAKRQFTWLRKWPELQWF 305


>gi|157803767|ref|YP_001492316.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           canadensis str. McKiel]
 gi|166216984|sp|A8EYU8|MIAA_RICCK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157785030|gb|ABV73531.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           canadensis str. McKiel]
          Length = 325

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 2/192 (1%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           LPI++GGTGLY  +L    + +P+I   ++++ RE   + G+  L ++L  LD + A +I
Sbjct: 95  LPILIGGTGLYINSLVFGYNNIPDITEDLQKQARELHSKIGNIELWNKLEKLDPLAASKI 154

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL-PERSALKERIRRRF 132
           + +D QR+ RA E+   SG+SI  F    P   I  E   KII L PER  L +   +R 
Sbjct: 155 NQNDTQRLIRAYEVFKQSGKSIFCF-HTLPKEQILSEFNFKIIFLNPERKFLYKTCEQRL 213

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            ++ + G+IDEI  + K  +  D   +KA+GV++I+A L G +  D+ L    I T +YA
Sbjct: 214 QKIFKEGSIDEIALIKKQLIPQDYLNLKAVGVKEILAYLDGNLTLDDALSATQIRTRRYA 273

Query: 193 KRQKTWLCHQFQ 204
           KRQ TW  +Q +
Sbjct: 274 KRQVTWFKNQIK 285


>gi|221068582|ref|ZP_03544687.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Comamonas
           testosteroni KF-1]
 gi|220713605|gb|EED68973.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Comamonas
           testosteroni KF-1]
          Length = 352

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 111/200 (55%), Gaps = 11/200 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           ++ +P++VGGT LYF+AL   L  MP     +R  +  +  + G   +H  L+ +DS+ A
Sbjct: 117 RQAIPLLVGGTMLYFKALMDGLDDMPAANPDVRAMLDAQAAELGWPAMHARLAQVDSVTA 176

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEF--WKQAPNPFIPLESAHKIIILP-ERSALKER 127
            ++ P D QRI RALE+  VSGQ +  F   ++   P   +  A    + P ER+ L +R
Sbjct: 177 ARLAPGDSQRIQRALEVWHVSGQPLSSFHTTRKKTGPAEQMGLATLFSLEPAERAWLHQR 236

Query: 128 IRRRFTQMLESGAIDEIRSL-MKMNLSLDLPIMKAIGVRDIIALLKG-EINYDETL---- 181
           I  RF  MLE G +DE+RSL  + +L LDLP M+ +G R    +L   E +  + L    
Sbjct: 237 IALRFDLMLEQGFLDEVRSLRARGDLHLDLPSMRCVGYRQAWEVLDALEADPGKPLDMAG 296

Query: 182 --QRGIIATNKYAKRQKTWL 199
             +RGI +T + AKRQ TWL
Sbjct: 297 LRERGIASTRQLAKRQITWL 316


>gi|294677161|ref|YP_003577776.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           capsulatus SB 1003]
 gi|294475981|gb|ADE85369.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodobacter
           capsulatus SB 1003]
          Length = 314

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 102/185 (55%), Gaps = 4/185 (2%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           PIIVGGTGLY  ALT  L+ +P  P  IR +   +    G   +  EL   D   A ++ 
Sbjct: 121 PIIVGGTGLYLSALTEGLAEIPATPAEIRAEADRRRLTEGHAGMRAEL---DPATAARVD 177

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
             +  R+ RA E+   +G+ +  +    P P +PL++A  +++ P R  L  RI  RF  
Sbjct: 178 GLNPMRVQRAWEVMRATGRGLAAWQDDTPPPLLPLDAAVPLLLSPGRDLLAARIDARFET 237

Query: 135 MLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKR 194
           MLESGA+DE+R+L+    +  L   KAIG  +++A L+GEI+      R   A+ +YAKR
Sbjct: 238 MLESGALDEVRALLPQWDASAL-WAKAIGAPELVAHLRGEIDLATATARAKAASRQYAKR 296

Query: 195 QKTWL 199
           Q+TW 
Sbjct: 297 QRTWF 301


>gi|167920335|ref|ZP_02507426.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           pseudomallei BCC215]
          Length = 324

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 100/192 (52%), Gaps = 10/192 (5%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++ GGT LY+RALT  L+ +P     +R  +     + G   LH  L+ +D   A ++ 
Sbjct: 102 PLLAGGTMLYYRALTQGLNDLPAADPDVRATLDADAARDGWPALHARLAGIDPATAARLA 161

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP------ERSALKERI 128
           P+D QRI RALE+ L++GQ +       P      ++A  +  +P      ER+ L  RI
Sbjct: 162 PNDSQRIQRALEVYLLTGQPMSALLAAPPRDD---DAAAGLRFVPVALEPSERAVLHARI 218

Query: 129 RRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
             RF  MLE+G IDE+  L +  +L L LP M+ +G R     L G  +Y     +GI A
Sbjct: 219 AARFDAMLEAGFIDEVERLRRRDDLHLGLPSMRCVGYRQAWEYLDGCTDYRTMRHKGIFA 278

Query: 188 TNKYAKRQKTWL 199
           T +  KRQ TWL
Sbjct: 279 TRQLCKRQLTWL 290


>gi|53725785|ref|YP_103874.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei ATCC 23344]
 gi|67642140|ref|ZP_00440901.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei GB8 horse 4]
 gi|121599710|ref|YP_991862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei SAVP1]
 gi|124384595|ref|YP_001027071.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei NCTC 10229]
 gi|126448401|ref|YP_001081722.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei NCTC 10247]
 gi|166998836|ref|ZP_02264688.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei PRL-20]
 gi|167825660|ref|ZP_02457131.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           pseudomallei 9]
 gi|167847147|ref|ZP_02472655.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           pseudomallei B7210]
 gi|226194176|ref|ZP_03789775.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           pseudomallei Pakistan 9]
 gi|254178807|ref|ZP_04885461.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei ATCC 10399]
 gi|254202583|ref|ZP_04908946.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei FMH]
 gi|254207921|ref|ZP_04914271.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei JHU]
 gi|254355937|ref|ZP_04972215.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Burkholderia
           mallei 2002721280]
 gi|61213999|sp|Q62HE6|MIAA_BURMA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166201472|sp|A3MN86|MIAA_BURM7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166201473|sp|A2S552|MIAA_BURM9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 g