BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.888_1
         (217 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|317049757|ref|YP_004117405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp.
           At-9b]
 gi|316951374|gb|ADU70849.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp.
           At-9b]
          Length = 316

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LYF+AL   LS +P     +R++I +   + G   LH +
Sbjct: 89  LAEMAEITQRGKIPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQMAAEKGWDALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 149 LCEIDPVAGGRIHPNDPQRLSRALEVFFISGKTLTEL-TKTSGEALPYDVYQFAIAPANR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  R+ QML SG   E R+L        D+P ++ +G R + + L GEI+Y+E 
Sbjct: 208 EVLHQRIALRYNQMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLTGEIDYNEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWPDVHWLDSDEPD 301


>gi|167625541|ref|YP_001675835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           halifaxensis HAW-EB4]
 gi|189081960|sp|B0TU65|MIAA_SHEHH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167355563|gb|ABZ78176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           halifaxensis HAW-EB4]
          Length = 308

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++      +   P++VGGT +YF+AL   LS +P     +R +I  + +++G   LHD+
Sbjct: 86  LAQIEDILSRGKTPLLVGGTMMYFKALLEGLSPLPAADEVVRAQIACEAQEFGWQALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR+ARALE+  +SGQS+ E   +  +   P E+    I   +R
Sbjct: 146 LREIDPVSAERIHPNDPQRLARALEVYRISGQSLTEL-TKTKSEAFPYEAVQFAIAPSDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G   E+  L          P M+ +G R     L GEI+Y+  
Sbjct: 205 KVLHRAIETRFKTMLTLGFTAEVERLKARGDLDLDLPSMRCVGYRQCWQYLDGEIDYETM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +++ I+AT + AKRQ TWL       W+   + D+L
Sbjct: 265 VEKAIVATRQLAKRQLTWLRGWPDLIWLESGAEDNL 300


>gi|157963355|ref|YP_001503389.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           pealeana ATCC 700345]
 gi|239977454|sp|A8H8G7|MIAA_SHEPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157848355|gb|ABV88854.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           pealeana ATCC 700345]
          Length = 296

 Score =  181 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 79/216 (36%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++      +   P++VGGT +YF+AL   LS +P    AIRE+I  + +  G   LHD+
Sbjct: 74  LAQIEDILSRGKTPLLVGGTMMYFKALLEGLSPLPGADEAIREQIAAEAEAQGWQALHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR+ARALE+  VSGQ++ E   +  +   P +     I   +R
Sbjct: 134 LREIDPVSAERIHPNDPQRLARALEVYRVSGQTLTEL-TKTKSDVFPYDVVQFAIAPSDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G   E+  L  + +L+LDLP M+ +G R     L GEI+YD  
Sbjct: 193 KVLHRAIETRFKAMLAQGFTSEVERLKARTDLNLDLPSMRCVGYRQCWQYLDGEIDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +++ I+AT + AKRQ TWL       W+   + ++L
Sbjct: 253 VEKAIVATRQLAKRQLTWLRGWPDLIWLESGAENNL 288


>gi|239993398|ref|ZP_04713922.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alteromonas
           macleodii ATCC 27126]
          Length = 311

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +PI+ GGT +YF AL   +S +P+    IR++I ++ ++ G   LHDEL  +D
Sbjct: 93  DILARGKVPILAGGTMMYFNALINGISPLPKSDEKIRDEITQQAQRLGWSKLHDELRGVD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I   +IHP+D QRI RALE+   +G+++  +  Q      P   A   I   +R+ L E
Sbjct: 153 PISGERIHPNDPQRITRALEVYRSTGKTLTHWQ-QQEGEKCPYNIAQFAIAPADRAVLHE 211

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF  MLE G  +E+  L +  +L  DLP ++++G R +   L G+++Y E  +RGI
Sbjct: 212 RIATRFDLMLEQGFENEVVKLYERSDLHEDLPSIRSVGYRQMWQYLDGQLSYAEMRERGI 271

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           IAT + AKRQ TWL    Q  W+   + D+L
Sbjct: 272 IATRQLAKRQLTWLRGWEQVTWLDTFANDNL 302


>gi|329297958|ref|ZP_08255294.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Plautia stali
           symbiont]
          Length = 298

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  +K  +P++VGGT LYF+AL   LS +P     +R++I +   + G   LH +
Sbjct: 74  LAEMAEITQKGKIPLLVGGTMLYFKALQEGLSPLPSADPEVRQRIEQMAAEKGWEALHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG   +          +P +     I    R
Sbjct: 134 LCEIDPVAGSRIHPNDPQRLSRALEVFFISG-KTLTELTTTTGEALPYDVYQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L + I  R+ QML SG   E R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 193 ELLHQCIALRYDQMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   + +
Sbjct: 253 VYRGICATRQLAKRQMTWLRGWPDVHWLDSDAPE 286


>gi|310765332|gb|ADP10282.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia sp.
           Ejp617]
          Length = 316

 Score =  178 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 73/217 (33%), Positives = 121/217 (55%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P    A+R++I +  ++ G   LH +
Sbjct: 89  LAEMAEITRRGNIPLLVGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P   +   I    R
Sbjct: 149 LCDIDPVAAHRIHPNDPQRLSRALEVFFISGKTLTEL-IKTSGDALPYNVSQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GEI+YD+ 
Sbjct: 208 ELIHQRIEQRFHQMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     D  +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|312173799|emb|CBX82053.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora ATCC BAA-2158]
          Length = 316

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 121/217 (55%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P     +R++I +  ++ G   LH +
Sbjct: 89  LAEMAEITRRGNIPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAREAGWQALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P + +   I    R
Sbjct: 149 LCDIDPVAAHRIHPNDPQRLSRALEVFFISGKTLTEL-IKTSGQALPYDVSQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GEINYD+ 
Sbjct: 208 ELIHQRIEQRFHQMLASGFEAEARALFARGDLHTEMPSVRCVGYRQMWSYLSGEINYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RG+ AT + AKRQ TWL       W+     D  +
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|292489621|ref|YP_003532511.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora CFBP1430]
 gi|292898159|ref|YP_003537528.1| tRNA delta-2-isopentenylpyrophosphate transferase [Erwinia
           amylovora ATCC 49946]
 gi|291198007|emb|CBJ45109.1| tRNA delta-2-isopentenylpyrophosphate transferase [Erwinia
           amylovora ATCC 49946]
 gi|291555058|emb|CBA23143.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia amylovora CFBP1430]
          Length = 316

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 121/217 (55%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P     +R++I +  ++ G   LH +
Sbjct: 89  LAEMAEITRRGNIPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAREAGWQALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P + +   I    R
Sbjct: 149 LCDIDPVAAHRIHPNDPQRLSRALEVFFISGKTLTEL-IKTSGQALPYDVSQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GEINYD+ 
Sbjct: 208 ELIHQRIEQRFHQMLASGFEAEARALFARGDLHTEMPSVRCVGYRQMWSYLSGEINYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RG+ AT + AKRQ TWL       W+     D  +
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|239977163|sp|B4S1F8|MIAA_ALTMD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 301

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 117/211 (55%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +PI+ GGT +YF AL   +S +P+    IR++I ++ ++ G   LHDEL S+D
Sbjct: 83  DILARGKVPILAGGTMMYFNALINGISPLPKSDEKIRDEITQQAQRLGWSKLHDELRSVD 142

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            +   +IHP+D QRI RALE+   +G+++  +  Q      P   A   I   +R+ L  
Sbjct: 143 PVSGERIHPNDPQRITRALEVYRNTGKTLTYWQ-QQKGEKCPYNIAQFAIAPEDRAVLHN 201

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF  MLE G   E+  L +  +L  DLP ++++G R +   L G ++Y E  +RGI
Sbjct: 202 RIATRFDMMLEQGFEKEVVKLYERSDLHEDLPSIRSVGYRQMWQYLDGHLSYAEMRERGI 261

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           IAT + AKRQ TWL    Q  W+   + D+L
Sbjct: 262 IATRQLAKRQLTWLRGWEQVTWLDTFANDNL 292


>gi|291619091|ref|YP_003521833.1| MiaA [Pantoea ananatis LMG 20103]
 gi|291154121|gb|ADD78705.1| MiaA [Pantoea ananatis LMG 20103]
 gi|327395423|dbj|BAK12845.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA [Pantoea
           ananatis AJ13355]
          Length = 316

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 114/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++     +   +P++VGGT LYF+AL   LS +P     +R+KI +   + G   LH +
Sbjct: 89  LAEMADIVQHGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRQKIEQMANERGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 149 LCEIDPVAGSRIHPNDPQRLSRALEVFFISGKTLTEL-TKISGEALPYDVHQFAIAPANR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIALRFDQMLASGFEAESRALFARGDLHTDMPSIRCVGYRQMWSYLAGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWENIHWLDSDEP 300


>gi|212633662|ref|YP_002310187.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           piezotolerans WP3]
 gi|226704737|sp|B8CIX4|MIAA_SHEPW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|212555146|gb|ACJ27600.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           piezotolerans WP3]
          Length = 308

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/216 (33%), Positives = 114/216 (52%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L K      +   P++VGGT +YF+AL   LS +P     IR +I  + +  G   LHD+
Sbjct: 86  LLKIEDIISRGKTPLLVGGTMMYFKALIEGLSPLPGANDEIRAQIAVEAQANGWQALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR+ARALE+  +SG+S+ E   +  +   P E+    I   +R
Sbjct: 146 LKEVDPVAAARIHPNDPQRLARALEVFRISGKSLTEL-TKVKSEAFPYEAIQFAIAPNDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I  RF  ML  G ++E++ L   +      P M+ +G R     L GE +Y+  
Sbjct: 205 KVLHKAIETRFKAMLGLGFVEEVKKLKSRDDLHLELPSMRCVGYRQCWQHLDGEYDYETM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +++ I+AT + AKRQ TWL       W+   + ++L
Sbjct: 265 VEKAIVATRQLAKRQLTWLRGWPDLIWLESGAENNL 300


>gi|188535086|ref|YP_001908883.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           tasmaniensis Et1/99]
 gi|238689722|sp|B2VCX4|MIAA_ERWT9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|188030128|emb|CAO98014.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           tasmaniensis Et1/99]
          Length = 316

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/217 (32%), Positives = 118/217 (54%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +  ++  +P++VGGT LY++AL   LS +P     +R++I +   + G   LH +
Sbjct: 89  LVEMAEITRRGNIPLLVGGTMLYYKALLEGLSPLPSADPEVRQRIEQMAGEAGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P + +   I    R
Sbjct: 149 LCDIDPVAANRIHPNDPQRLSRALEVFFISGKTLTEL-TKISGEILPYDVSQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GE +YD+ 
Sbjct: 208 ELIHQRIEQRFHQMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLAGETDYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     D  +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWKDVHWLDSEQPDAAY 304


>gi|197287176|ref|YP_002153048.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis HI4320]
 gi|227357129|ref|ZP_03841498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis ATCC 29906]
 gi|238690095|sp|B4F265|MIAA_PROMH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194684663|emb|CAR46600.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis HI4320]
 gi|227162661|gb|EEI47628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Proteus
           mirabilis ATCC 29906]
          Length = 313

 Score =  176 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 80/214 (37%), Positives = 121/214 (56%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +      +P++VGGT LYF+AL   LS +P     IR +I +K  + G   +H E
Sbjct: 89  LKAMEEITAAGRIPLLVGGTMLYFKALLEGLSPLPSANPEIRAEIEKKAAEQGWEAIHQE 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+S+D + A++IHP+D QR++RALE+ L+SG+S+ E   Q     +P +     I   +R
Sbjct: 149 LASVDPVAAKRIHPNDPQRLSRALEVYLISGKSMTEL-TQISGEALPYDVYQFAIAPKDR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF QML  G  DE++SL +     +  P ++ +G R + + L GEI+YDE 
Sbjct: 208 NVLHQRIEARFKQMLTCGFEDEVKSLYQRGDLHEDLPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGICATRQLAKRQITWLRGWHDVHWLDSEDFE 301


>gi|331009763|gb|EGH89819.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 323

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMAEIIARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWRSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|168244862|ref|ZP_02669794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|194448990|ref|YP_002048403.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|204927276|ref|ZP_03218478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205355118|ref|YP_002228919.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207859506|ref|YP_002246157.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|226700803|sp|B5R0N8|MIAA_SALEP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700804|sp|B5R9B8|MIAA_SALG2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238690634|sp|B4TFA5|MIAA_SALHS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977573|sp|A9N4Y5|MIAA_SALPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194407294|gb|ACF67513.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|204323941|gb|EDZ09136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205274899|emb|CAR39966.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205336321|gb|EDZ23085.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|206711309|emb|CAR35687.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|326630275|gb|EGE36618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 316

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITSAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|161617630|ref|YP_001591595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161366994|gb|ABX70762.1| hypothetical protein SPAB_05493 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 301

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAQMAEITSAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 287


>gi|229506858|ref|ZP_04396366.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           BX 330286]
 gi|229508662|ref|ZP_04398156.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|229512376|ref|ZP_04401851.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           TMA 21]
 gi|229516044|ref|ZP_04405495.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC9]
 gi|229606372|ref|YP_002877020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MJ-1236]
 gi|229346947|gb|EEO11914.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC9]
 gi|229350591|gb|EEO15536.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           TMA 21]
 gi|229354297|gb|EEO19226.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|229355963|gb|EEO20882.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           BX 330286]
 gi|229369027|gb|ACQ59450.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MJ-1236]
          Length = 384

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+
Sbjct: 154 LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQ 213

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 214 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 272

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 273 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 332

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 333 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 366


>gi|229526910|ref|ZP_04416313.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           bv. albensis VL426]
 gi|229336079|gb|EEO01098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           bv. albensis VL426]
          Length = 384

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+
Sbjct: 154 LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQ 213

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 214 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 272

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 273 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 332

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 333 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 366


>gi|153803478|ref|ZP_01958064.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-3]
 gi|124120979|gb|EAY39722.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-3]
          Length = 315

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+
Sbjct: 85  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIEREAEKLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 297


>gi|260599481|ref|YP_003212052.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           turicensis z3032]
 gi|260218658|emb|CBA33987.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           turicensis z3032]
          Length = 316

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 117/217 (53%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R +I  +  + G   LH +
Sbjct: 89  LKEMADIVAAGRIPLLVGGTMLYFKALLEGLSPLPSADPTVRAEIERQAAEQGWDALHRK 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAQRIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLAGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     +  +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWEGVHWLDSEMPEQAY 304


>gi|229526990|ref|ZP_04416386.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           12129(1)]
 gi|229335513|gb|EEO00994.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           12129(1)]
          Length = 315

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+
Sbjct: 85  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 297


>gi|39997098|ref|NP_953049.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           sulfurreducens PCA]
 gi|61214210|sp|Q74BP1|MIAA_GEOSL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|39983988|gb|AAR35376.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           sulfurreducens PCA]
 gi|298506111|gb|ADI84834.1| tRNA (N6-dimethylallyl-A37)-dimethylallyltransferase [Geobacter
           sulfurreducens KN400]
          Length = 311

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 70/211 (33%), Positives = 108/211 (51%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +   PI+VGGTGLY + L G L+  P     IR ++ E  +  G+  LHD L+ +D
Sbjct: 93  EIHSRGKRPILVGGTGLYIKTLIGGLAPSPGADDTIRAELEEDARSEGAAALHDRLAQVD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++HP+D  RI RALE+ L++G+ + EF ++      P +     I   ER  L  
Sbjct: 153 PAAAARLHPNDRVRIVRALEVFLMTGKPLSEFQEEHRFADEPYDCLKLGIS-VERDDLYR 211

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R  +M   G ++E+  L+    S DL  M AIG +++ A L G  + DE  +    
Sbjct: 212 RINERVNRMFAEGFVEEVSGLLNAGYSPDLKAMGAIGYKEVCAYLAGTCSLDEARELVQR 271

Query: 187 ATNKYAKRQKTWLCHQFQADWIR-ISSIDDL 216
            T +YAKRQ TW        W+   ++ D +
Sbjct: 272 NTRRYAKRQLTWFRKDPAIKWVEYPANFDSI 302


>gi|330960090|gb|EGH60350.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 323

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAEVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LALVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGQQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|119468155|ref|ZP_01611281.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Alteromonadales bacterium TW-7]
 gi|119448148|gb|EAW29412.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Alteromonadales bacterium TW-7]
          Length = 296

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 120/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  + +++  +P++VGGT LYF+AL   LS +PE   AIR ++  +  ++G   L+ E
Sbjct: 74  IKKIDEFHQQGKVPVLVGGTMLYFKALIDGLSPLPEADPAIRAQLEAEASEFGWPHLYQE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D   A+++  +D QRI RALE+  ++G+++ E   +   P +P       I   ER
Sbjct: 134 LVKIDPQAAQKMSENDSQRINRALEVYRLTGKTMTELQ-KQKQPPLPYTFHQFAIAPQER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L +RI  RF  M++ G  +E+ +L        ++P ++ +G R +   L GE+++DE 
Sbjct: 193 SELHQRIEERFKIMIDQGFENEVSALYLRKDLHHNMPSIRCVGYRQMWDYLAGEVSHDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+     ++L
Sbjct: 253 VFRGIAATRQLAKRQLTWLRSWPDVTWLTTGDEENL 288


>gi|91794554|ref|YP_564205.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           denitrificans OS217]
 gi|123356467|sp|Q12J94|MIAA_SHEDO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91716556|gb|ABE56482.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           denitrificans OS217]
          Length = 299

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 112/210 (53%), Gaps = 2/210 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             K+   P++VGGT +YF+AL   LS +P     IR++I+ +    G   LH  L  +D 
Sbjct: 83  IIKRGKTPLLVGGTMMYFKALLEGLSPLPSADETIRQQIQTRADIEGWEALHQSLCEIDP 142

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           +   +IHP+D QR++RALE+  +SG+++ E   Q  +  +P E     I   +R  L E 
Sbjct: 143 VAGARIHPNDPQRLSRALEVYYISGKTMTEL-TQTKSAALPYEVVQFAIAPLDRKVLHEL 201

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RFT MLE G ++E+ SLM         P M+ +G R     L+GE +YD  +++   
Sbjct: 202 IAKRFTIMLEQGFVEEVNSLMARGDLHLDLPSMRCVGYRQCWQYLEGEFDYDTMVEKATA 261

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           AT + AKRQ TWL       W+   +  +L
Sbjct: 262 ATRQLAKRQLTWLRGWPDVHWLESGAESNL 291


>gi|153827306|ref|ZP_01979973.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-2]
 gi|149738772|gb|EDM53114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MZO-2]
          Length = 315

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+
Sbjct: 85  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 297


>gi|238910518|ref|ZP_04654355.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|321222674|gb|EFX47746.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
          Length = 301

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 287


>gi|197248461|ref|YP_002149274.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|226700801|sp|B5F386|MIAA_SALA4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|197212164|gb|ACH49561.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 316

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQKIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|62182806|ref|YP_219223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|224586200|ref|YP_002639999.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|75505390|sp|Q57GM0|MIAA_SALCH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811019|sp|C0Q6C8|MIAA_SALPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|62130439|gb|AAX68142.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224470728|gb|ACN48558.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322717308|gb|EFZ08879.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 316

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|16767606|ref|NP_463221.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167995168|ref|ZP_02576258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168231395|ref|ZP_02656453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168239734|ref|ZP_02664792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168263288|ref|ZP_02685261.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464756|ref|ZP_02698659.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194470981|ref|ZP_03076965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737154|ref|YP_002117301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197265179|ref|ZP_03165253.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198242420|ref|YP_002218244.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|17865738|sp|P37724|MIAA_SALTY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700802|sp|B5FRM7|MIAA_SALDC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238693675|sp|B4TSF1|MIAA_SALSV RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|16422920|gb|AAL23180.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|194457345|gb|EDX46184.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712656|gb|ACF91877.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195632695|gb|EDX51149.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197243434|gb|EDY26054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197287603|gb|EDY26995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|197936936|gb|ACH74269.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205327103|gb|EDZ13867.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205334313|gb|EDZ21077.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205347915|gb|EDZ34546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|261249451|emb|CBG27316.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267996691|gb|ACY91576.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301160849|emb|CBW20380.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312915458|dbj|BAJ39432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|322615522|gb|EFY12442.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322618582|gb|EFY15471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322622005|gb|EFY18855.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627729|gb|EFY24520.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322631036|gb|EFY27800.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322637745|gb|EFY34446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322642409|gb|EFY39013.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322644022|gb|EFY40570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650490|gb|EFY46898.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322653545|gb|EFY49873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659731|gb|EFY55974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322662058|gb|EFY58274.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666193|gb|EFY62371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672613|gb|EFY68724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676043|gb|EFY72114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322680527|gb|EFY76565.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322684579|gb|EFY80583.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323132698|gb|ADX20128.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192894|gb|EFZ78120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323197230|gb|EFZ82370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323201653|gb|EFZ86717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323206167|gb|EFZ91129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323213176|gb|EFZ97978.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215549|gb|EGA00293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219534|gb|EGA04019.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323227837|gb|EGA11991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323229007|gb|EGA13136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236381|gb|EGA20457.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323238714|gb|EGA22766.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323241835|gb|EGA25864.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323248016|gb|EGA31953.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323254653|gb|EGA38464.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323258288|gb|EGA41965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323263566|gb|EGA47087.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265838|gb|EGA49334.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323270282|gb|EGA53730.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|326626049|gb|EGE32394.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 316

 Score =  174 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|15640373|ref|NP_230000.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121729705|ref|ZP_01682147.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           V52]
 gi|147673758|ref|YP_001218615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|153217191|ref|ZP_01950955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           1587]
 gi|153820448|ref|ZP_01973115.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           NCTC 8457]
 gi|153823680|ref|ZP_01976347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|153830896|ref|ZP_01983563.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           623-39]
 gi|227080558|ref|YP_002809109.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           M66-2]
 gi|254851657|ref|ZP_05241007.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MO10]
 gi|297582274|ref|ZP_06944188.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC385]
 gi|298501246|ref|ZP_07011044.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MAK 757]
 gi|11386938|sp|Q9KV12|MIAA_VIBCH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|172047713|sp|A5F3L6|MIAA_VIBC3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811023|sp|C3LR78|MIAA_VIBCM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|9654762|gb|AAF93519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121628556|gb|EAX61038.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           V52]
 gi|124113774|gb|EAY32594.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           1587]
 gi|126509007|gb|EAZ71601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           NCTC 8457]
 gi|126518797|gb|EAZ76020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           B33]
 gi|146315641|gb|ABQ20180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|148873630|gb|EDL71765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           623-39]
 gi|227008446|gb|ACP04658.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           M66-2]
 gi|227012202|gb|ACP08412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           O395]
 gi|254847362|gb|EET25776.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MO10]
 gi|297533493|gb|EFH72340.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC385]
 gi|297540000|gb|EFH76063.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           MAK 757]
 gi|327483208|gb|AEA77615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           LMA3894-4]
          Length = 315

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+
Sbjct: 85  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 297


>gi|161505137|ref|YP_001572249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|189081959|sp|A9MFP1|MIAA_SALAR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160866484|gb|ABX23107.1| hypothetical protein SARI_03271 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 316

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 118/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G  +LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWELLHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|261209767|ref|ZP_05924073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC341]
 gi|262401562|ref|ZP_06078129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC586]
 gi|260841183|gb|EEX67693.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC341]
 gi|262352277|gb|EEZ01406.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           RC586]
          Length = 304

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+
Sbjct: 74  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 134 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 193 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 253 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 286


>gi|255747146|ref|ZP_05421089.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholera
           CIRS 101]
 gi|262147190|ref|ZP_06027995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           INDRE 91/1]
 gi|262166928|ref|ZP_06034648.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC27]
 gi|255735195|gb|EET90597.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholera
           CIRS 101]
 gi|262024633|gb|EEY43314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           RC27]
 gi|262031371|gb|EEY49980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           INDRE 91/1]
          Length = 304

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+
Sbjct: 74  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 134 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 193 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 253 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 286


>gi|194443718|ref|YP_002043615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|200388466|ref|ZP_03215078.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|226700805|sp|B4T2R6|MIAA_SALNS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194402381|gb|ACF62603.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|199605564|gb|EDZ04109.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
          Length = 316

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 116/215 (53%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LEQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|254292138|ref|ZP_04962910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           AM-19226]
 gi|150421937|gb|EDN13912.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           AM-19226]
          Length = 315

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + +  G   LHD+
Sbjct: 85  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAETLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 297


>gi|330978951|gb|EGH78010.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 323

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330899892|gb|EGH31311.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 323

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAGVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330872249|gb|EGH06398.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 243

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 4   LAAMAEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQ 63

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 64  LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 123

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 124 ANLAIAPADRKVLHQRIALRFKQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 183

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 184 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 229


>gi|320321885|gb|EFW77981.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320331010|gb|EFW86984.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 323

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFKQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|71737536|ref|YP_272866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|123638417|sp|Q48P03|MIAA_PSE14 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71558089|gb|AAZ37300.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 323

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330873786|gb|EGH07935.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330965980|gb|EGH66240.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 323

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 120/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP    A+R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAAVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTREEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330886599|gb|EGH20260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 323

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMEEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|262163595|ref|ZP_06031338.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM223]
 gi|262027962|gb|EEY46624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM223]
          Length = 315

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LYF+AL   LS +P     IR++I ++    G   LHD+
Sbjct: 85  LKEMAEIVAQGKIPLLVGGTMLYFKALIEGLSPLPAADPEIRQQIEQEALTLGWQTLHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  R+ +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRYEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|330971553|gb|EGH71619.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 323

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|66043838|ref|YP_233679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|81308574|sp|Q4ZYY1|MIAA_PSEU2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|63254545|gb|AAY35641.1| tRNA isopentenyltransferase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 323

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|283786850|ref|YP_003366715.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Citrobacter rodentium ICC168]
 gi|282950304|emb|CBG89951.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Citrobacter rodentium ICC168]
          Length = 316

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 119/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++ ++ G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAEEQGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+++D + AR+IHP+D QR++RALE+  +SG+++ E   Q     +P       I    R
Sbjct: 149 LATIDPVAARRIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYHVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+G+I+YDE 
Sbjct: 208 EVLHQRIAQRFHQMLASGFEVEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGDISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGVCATRQLAKRQVTWLRGWEGVHWLDSEQPD 301


>gi|121591758|ref|ZP_01678967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           2740-80]
 gi|121546382|gb|EAX56635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio cholerae
           2740-80]
          Length = 284

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IR++I  + ++ G   LHD+
Sbjct: 54  LKEMADIVAQGKIPLLVGGTMLYFKALLEGLSPLPAADPVIRQQIELEAEKLGWQALHDQ 113

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 114 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 172

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 173 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGHGTLDEA 232

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   ++D
Sbjct: 233 IYRGICATRQLAKRQITWLRSWDDLTWLDSENVD 266


>gi|302189790|ref|ZP_07266463.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae 642]
          Length = 323

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQTFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGVSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|330951473|gb|EGH51733.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae Cit 7]
          Length = 323

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|289623755|ref|ZP_06456709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648628|ref|ZP_06479971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|330865893|gb|EGH00602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. aesculi str. 0893_23]
          Length = 323

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLANDNL 309


>gi|300715039|ref|YP_003739842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           billingiae Eb661]
 gi|299060875|emb|CAX57982.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           billingiae Eb661]
          Length = 316

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 120/214 (56%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  +   +P++VGGT LY++AL   LS +P     +R++I ++  + G   LH +
Sbjct: 89  LAEMAEITESGRIPLLVGGTMLYYKALLEGLSPLPPADPEVRQRIEQQASEQGWDALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 149 LCEIDPVAGNRIHPNDPQRLSRALEVFFISGKTLTEL-TKTSGEALPYDVTQFAIAPQHR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             + +RI  RF QML SG   E R+L  + +L  DLP ++ +G R + + L GEI+YD+ 
Sbjct: 208 EVIHQRIELRFQQMLASGFEAEARALYAREDLHTDLPSIRCVGYRQMWSYLAGEIDYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGICATRQLAKRQITWLRGWKDVHWLDSEQPD 301


>gi|330984561|gb|EGH82664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 323

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + YG   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLHGLADMPAADAQVRAQLEADAQAYGWRSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEDLHWLDSLASDNL 309


>gi|161936198|ref|YP_153226.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|239977572|sp|Q5PL48|MIAA_SALPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977574|sp|B5BKI0|MIAA_SALPK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 316

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITSAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGGRWLDSENPDR 302


>gi|197365077|ref|YP_002144714.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|56130408|gb|AAV79914.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197096554|emb|CAR62164.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 301

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAQMAEITSAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWEGGRWLDSENPDR 287


>gi|156932402|ref|YP_001436318.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cronobacter
           sakazakii ATCC BAA-894]
 gi|166198907|sp|A7MM88|MIAA_ENTS8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|156530656|gb|ABU75482.1| hypothetical protein ESA_00181 [Cronobacter sakazakii ATCC BAA-894]
          Length = 316

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/217 (35%), Positives = 117/217 (53%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +      +P++VGGT LYF+AL   LS +P     IR +I  +  + G   LH +
Sbjct: 89  LQAMAEIVAAGRIPLLVGGTMLYFKALLEGLSPLPSADPTIRAEIERQAAEQGWDALHRK 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQDIDPVAAQRIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLAGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     +  +
Sbjct: 268 VYRGICATRQLAKRQITWLRGWEGVHWLDSEKPEQAY 304


>gi|168822513|ref|ZP_02834513.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205341059|gb|EDZ27823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|320088787|emb|CBY98545.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 316

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 116/215 (53%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEIPYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|332038824|gb|EGI75266.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 305

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 118/216 (54%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  + +++  +P++VGGT LYF++L   LS +PE  T IR ++  + K++G   L+ E
Sbjct: 83  VQKIDEFHRQGKVPVLVGGTMLYFKSLIDGLSPLPEADTEIRAELEAQAKEFGWPHLYKE 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D   A +I  +D QRI RALE+  ++G+++ E   Q   P +P       I   ER
Sbjct: 143 LVKVDPKAAEKISENDSQRINRALEVYRLTGKTMTELQMQ-KQPALPYTFHQFAIAPQER 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L  RI  RF  M++ G  +E+ +L        ++P ++ +G R +   L GE N+DE 
Sbjct: 202 SELHRRIEERFKIMIDQGFENEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGETNHDEM 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+     ++L
Sbjct: 262 VFRGIAATRQLAKRQLTWLRSWPDVTWLTTGDEENL 297


>gi|256821742|ref|YP_003145705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kangiella
           koreensis DSM 16069]
 gi|256795281|gb|ACV25937.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kangiella
           koreensis DSM 16069]
          Length = 317

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/208 (31%), Positives = 114/208 (54%), Gaps = 1/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LY++ L   +  +P+    +R  ++E+L   G   LH EL+ +D
Sbjct: 95  DISSQGKMPLLVGGTMLYYKTLLEGMHNLPDSDPTVRAGLQERLNNEGLAKLHQELAEVD 154

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A++IH +D QR  RALE+  ++G+ + +   +  N   P  +    +   +R+ L +
Sbjct: 155 PVSAKRIHENDPQRTLRALEVFAITGKPLSQLHAEQDNNDFPYRTLQIALAPQDRAYLHQ 214

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF QM+E G + E++SL +        P +K++G R +   L GE++ +E ++RGI
Sbjct: 215 RIEKRFHQMMEQGFLQEVQSLYERGDLNPDLPSIKSVGYRQMWQYLAGELSLEEAIERGI 274

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
           IAT + AKRQ TWL       W+     
Sbjct: 275 IATRQLAKRQFTWLRSWKDLHWLDSKQP 302


>gi|258623498|ref|ZP_05718500.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM573]
 gi|258625636|ref|ZP_05720517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM603]
 gi|258582091|gb|EEW06959.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM603]
 gi|258584210|gb|EEW08957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           VM573]
          Length = 315

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     IR++I ++    G   LHD+
Sbjct: 85  LKEMAEIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEQEALTLGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|308188270|ref|YP_003932401.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pantoea vagans C9-1]
 gi|308058780|gb|ADO10952.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pantoea vagans C9-1]
          Length = 316

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/213 (34%), Positives = 114/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++     +   +P++VGGT LYF+AL   LS +P     +R++I +  ++ G   LH +
Sbjct: 89  LAEMADIVEAGRIPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQTAREKGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 149 LCEIDPVAGSRIHPNDPQRLSRALEVFFISGKTLTEL-TKTSGEALPYDVQQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E R+L        D+P ++ +G R + + L GEI+Y E 
Sbjct: 208 ELLHQRIALRFEQMLASGFEAESRALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDYSEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWENVHWLDSDEP 300


>gi|262172556|ref|ZP_06040234.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           MB-451]
 gi|261893632|gb|EEY39618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio mimicus
           MB-451]
          Length = 315

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 118/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+
Sbjct: 85  LKEMAEIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEQEALTLGWQVLHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  +SG+++ E   Q     IP       I   ER
Sbjct: 145 LQQIDPVSAQRIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEAIPYRVLQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG  +E+++L   +      P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFEKMVESGFEEEVKALYARDDLHPDLPSIRCVGYRQMWDYLDGNGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|148549973|ref|YP_001270075.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida F1]
 gi|166230732|sp|A5W9T1|MIAA_PSEP1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148514031|gb|ABQ80891.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida F1]
          Length = 323

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R ++  + +  G   LH +
Sbjct: 84  LEAMAEITARGKIPLLVGGTMLYYKALIDGLADMPAADATVRAELEAQAEALGLAELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 144 LAEVDPESAARIHPNDPQRLIRALEVYRVSGESMTAHRRRQFAESRGADAGAGGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTENEMRERGIIATRQLAKRQFTWLRGWPDVHWLDSLACDNL 309


>gi|289672583|ref|ZP_06493473.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. syringae FF5]
          Length = 323

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   L+ MP     +R ++    + +G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYFKALLDGLADMPAADAQVRAQLEADAQAFGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGRQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHSGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  DE  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTRDEMQERGIIATRQLAKRQFTWLRSWEGLHWLDSLASDNL 309


>gi|213967923|ref|ZP_03396069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato T1]
 gi|301384443|ref|ZP_07232861.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato Max13]
 gi|302064110|ref|ZP_07255651.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato K40]
 gi|302132269|ref|ZP_07258259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213927266|gb|EEB60815.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato T1]
          Length = 323

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   Q   +  +P++VGGT LYF+AL   L+ MP   TA+R ++    + +G   LHD+
Sbjct: 84  LAAMAQITARGNIPLLVGGTMLYFKALLDGLADMPAANTAVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTREEMQERGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|213052282|ref|ZP_03345160.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213428673|ref|ZP_03361423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213648968|ref|ZP_03379021.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
          Length = 301

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ +T + AKRQ TWL       W+   + D 
Sbjct: 253 VYRGVCSTRQLAKRQMTWLRGWEGVRWLDSENPDR 287


>gi|183600312|ref|ZP_02961805.1| hypothetical protein PROSTU_03874 [Providencia stuartii ATCC 25827]
 gi|188020102|gb|EDU58142.1| hypothetical protein PROSTU_03874 [Providencia stuartii ATCC 25827]
          Length = 313

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/208 (36%), Positives = 117/208 (56%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   LS +P    A R +I +  +Q G   +H  L+ +D
Sbjct: 94  EITSQGKIPLLVGGTMLYFKALLEGLSPLPSADPATRAEIEKIAQQQGWGEIHRRLAEVD 153

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IHP+D QR++RALE+ L+SGQ++ E   Q     +P       I   +R  L +
Sbjct: 154 PVAAARIHPNDPQRLSRALEVYLISGQTLTEM-TQTAGEELPYNVFQFAIAPQDRKILHQ 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF QML++G  +E+R+L +        P ++ +G R + + L+GE +YDE + RGI
Sbjct: 213 RIEQRFHQMLDAGFEEEVRALYERGDLHVDLPSIRCVGYRQMWSYLEGETDYDEMVYRGI 272

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
            AT + AKRQ TWL       W+     
Sbjct: 273 CATRQLAKRQITWLRSWENVHWLDSEQP 300


>gi|16763179|ref|NP_458796.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|213852838|ref|ZP_03382370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|21263773|sp|Q8Z186|MIAA_SALTI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|25324133|pir||AH1048 tRNA isopentenyltransferase (EC 2.5.1.8) - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16505487|emb|CAD06837.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Salmonella
           enterica subsp. enterica serovar Typhi]
          Length = 316

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ +T + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCSTRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|283476985|emb|CAY72877.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Erwinia pyrifoliae DSM 12163]
          Length = 301

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 122/217 (56%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P+++GGT LY++AL   LS +P    A+R++I +  ++ G   LH +
Sbjct: 74  LAEMAEITRRGNIPLLIGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P + +   I    R
Sbjct: 134 LCDIDPVAAHRIHPNDPQRLSRALEVFFISGKTLTEL-IKTSGKALPYDVSQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GEI+YD+ 
Sbjct: 193 ELIHKRIEQRFHQMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     D  +
Sbjct: 253 VYRGICATRQLAKRQMTWLRGWKDVQWLDSEQPDAAY 289


>gi|259907177|ref|YP_002647533.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           pyrifoliae Ep1/96]
 gi|224962799|emb|CAX54256.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erwinia
           pyrifoliae Ep1/96]
          Length = 316

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 122/217 (56%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P+++GGT LY++AL   LS +P    A+R++I +  ++ G   LH +
Sbjct: 89  LAEMAEITRRGNIPLLIGGTMLYYKALLEGLSPLPSADAAVRQRIEQMAREAGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P + +   I    R
Sbjct: 149 LCDIDPVAAHRIHPNDPQRLSRALEVFFISGKTLTEL-IKTSGKALPYDVSQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
             + +RI +RF QML SG   E R+L         +P ++ +G R + + L GEI+YD+ 
Sbjct: 208 ELIHKRIEQRFHQMLASGFEAEARALFARGDLHTEMPSIRCVGYRQMWSYLSGEIDYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     D  +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWKDVQWLDSEQPDAAY 304


>gi|110644528|ref|YP_672258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 536]
 gi|123048576|sp|Q0T9M2|MIAA_ECOL5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110346120|gb|ABG72357.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 536]
          Length = 316

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLPEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|319427723|gb|ADV55797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens 200]
          Length = 308

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 112/209 (53%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  Q  +    P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+
Sbjct: 86  LAEIAQIIRMGKTPLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADAKGWETLHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 146 LRDIDPVSAERIHPNDPQRLSRALEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G I E+  L          P M+ +G R     L GE +YD  
Sbjct: 205 KVLHDLIAQRFRIMLQQGFIGEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 265 VEKAVAATRQLAKRQLTWLRSWPELNWLE 293


>gi|307309628|ref|ZP_07589281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti BL225C]
 gi|307321767|ref|ZP_07601155.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti AK83]
 gi|306892589|gb|EFN23387.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti AK83]
 gi|306899963|gb|EFN30585.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti BL225C]
          Length = 302

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 98/207 (47%), Positives = 133/207 (64%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  LP+ VGGTGLYF+ALTG LS MPEIP   R+++R +L + G+  LH ELS+ D   
Sbjct: 95  KEGRLPVFVGGTGLYFKALTGGLSDMPEIPLETRKRLRTRLTEEGAEALHGELSARDPET 154

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A ++ PSDGQRI RALEI   +G+ I  + +      I    A KI++LPER  L  RI 
Sbjct: 155 AGRVRPSDGQRIVRALEIIEATGRPIGSYQQSRGPVIIDPARAQKIVVLPERPVLHGRID 214

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RRF  ML  GA++E+R+L+ + L  ++P+MKAIGV  I A+LKGE++  + ++ G  AT 
Sbjct: 215 RRFETMLARGAVEEVRALLALRLPPEMPVMKAIGVPQIAAMLKGEMSEKQVIEAGAAATR 274

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDL 216
           +YAKRQ TW  +Q    W RI   D L
Sbjct: 275 QYAKRQMTWFRNQLDETWQRIEDPDAL 301


>gi|15965871|ref|NP_386224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           meliloti 1021]
 gi|21263777|sp|Q92NR2|MIAA_RHIME RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|15075140|emb|CAC46697.1| Probable tRNA delta2-isopentenylpyrophosphate transferase
           [Sinorhizobium meliloti 1021]
          Length = 303

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 98/207 (47%), Positives = 133/207 (64%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K+  LP+ VGGTGLYF+ALTG LS MPEIP   R+++R +L + G+  LH ELS+ D   
Sbjct: 96  KEGRLPVFVGGTGLYFKALTGGLSDMPEIPLETRKRLRTRLTEEGAEALHGELSARDPET 155

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A ++ PSDGQRI RALEI   +G+ I  + +      I    A KI++LPER  L  RI 
Sbjct: 156 AGRVRPSDGQRIVRALEIIEATGRPIGSYQQSRGPVIIDPARAQKIVVLPERPVLHGRID 215

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           RRF  ML  GA++E+R+L+ + L  ++P+MKAIGV  I A+LKGE++  + ++ G  AT 
Sbjct: 216 RRFETMLARGAVEEVRALLALRLPPEMPVMKAIGVPQIAAMLKGEMSEKQVIEAGAAATR 275

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDDL 216
           +YAKRQ TW  +Q    W RI   D L
Sbjct: 276 QYAKRQMTWFRNQLDETWQRIEDPDAL 302


>gi|311281277|ref|YP_003943508.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae SCF1]
 gi|308750472|gb|ADO50224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae SCF1]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I  +  + G + LH +
Sbjct: 89  LAEMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPDVRARIEREAAERGWNALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L        D+P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       W+     +  F
Sbjct: 268 VYRGICATRQLAKRQVTWLRGWEGVHWLDSEKPEQAF 304


>gi|113968941|ref|YP_732734.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-4]
 gi|123325388|sp|Q0HMP0|MIAA_SHESM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|113883625|gb|ABI37677.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-4]
          Length = 296

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 113/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q       P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LH++
Sbjct: 74  LREIEQIISMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRADIQAEADANGWEALHEQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RA+E+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 134 LREIDPVSAERIHPNDPQRLSRAIEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L E I +RF  MLE G IDE+  L        DLP M+ +G R     L GE +YD  
Sbjct: 193 KVLHELIGQRFRIMLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 253 VEKAVAATRQLAKRQLTWLRSWPELNWLE 281


>gi|320655012|gb|EFX22973.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. 3256-97 TW 07815]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|301023431|ref|ZP_07187214.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 69-1]
 gi|331665835|ref|ZP_08366729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA143]
 gi|300397018|gb|EFJ80556.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 69-1]
 gi|331056886|gb|EGI28880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA143]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|222035941|emb|CAP78686.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli LF82]
 gi|312948820|gb|ADR29647.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O83:H1 str. NRG 857C]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|170766722|ref|ZP_02901175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           albertii TW07627]
 gi|170124160|gb|EDS93091.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           albertii TW07627]
 gi|315617584|gb|EFU98190.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 3431]
          Length = 301

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 193 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 253 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 286


>gi|170681902|ref|YP_001746566.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SMS-3-5]
 gi|218551441|ref|YP_002385233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           fergusonii ATCC 35469]
 gi|218702868|ref|YP_002410497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IAI39]
 gi|218707782|ref|YP_002415301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UMN026]
 gi|291285583|ref|YP_003502401.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. CB9615]
 gi|293402798|ref|ZP_06646895.1| miaA [Escherichia coli FVEC1412]
 gi|293407898|ref|ZP_06651738.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B354]
 gi|293417674|ref|ZP_06660296.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B185]
 gi|298378328|ref|ZP_06988212.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli FVEC1302]
 gi|300899709|ref|ZP_07117935.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 198-1]
 gi|300940658|ref|ZP_07155219.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 21-1]
 gi|331655999|ref|ZP_08356987.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M718]
 gi|331671321|ref|ZP_08372119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA280]
 gi|331681190|ref|ZP_08381827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H299]
 gi|226704725|sp|B7NTM7|MIAA_ECO7I RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704727|sp|B7NGA5|MIAA_ECOLU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704728|sp|B1LQJ1|MIAA_ECOSM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704729|sp|B7LLV3|MIAA_ESCF3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|170519620|gb|ACB17798.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SMS-3-5]
 gi|209750294|gb|ACI73454.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|218358983|emb|CAQ91643.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia fergusonii ATCC 35469]
 gi|218372854|emb|CAR20734.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli IAI39]
 gi|218434879|emb|CAR15817.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli UMN026]
 gi|284924353|emb|CBG37469.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli 042]
 gi|290765456|gb|ADD59417.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. CB9615]
 gi|291429713|gb|EFF02727.1| miaA [Escherichia coli FVEC1412]
 gi|291430392|gb|EFF03390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B185]
 gi|291472149|gb|EFF14631.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B354]
 gi|298280662|gb|EFI22163.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli FVEC1302]
 gi|300356720|gb|EFJ72590.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 198-1]
 gi|300454546|gb|EFK18039.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 21-1]
 gi|320660519|gb|EFX27980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O55:H7 str. USDA 5905]
 gi|323189950|gb|EFZ75228.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli RN587/1]
 gi|323975488|gb|EGB70589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TW10509]
 gi|325499707|gb|EGC97566.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia fergusonii ECD227]
 gi|331046353|gb|EGI18443.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M718]
 gi|331071166|gb|EGI42523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA280]
 gi|331081411|gb|EGI52572.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H299]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|26251063|ref|NP_757103.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli CFT073]
 gi|191174522|ref|ZP_03036020.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli F11]
 gi|218692505|ref|YP_002400717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ED1a]
 gi|227886786|ref|ZP_04004591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 83972]
 gi|300987264|ref|ZP_07178093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 45-1]
 gi|300988652|ref|ZP_07178792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 200-1]
 gi|301045957|ref|ZP_07193141.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 185-1]
 gi|331660746|ref|ZP_08361678.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA206]
 gi|33301389|sp|Q8CXV3|MIAA_ECOL6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977374|sp|B7MSY4|MIAA_ECO81 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|26111495|gb|AAN83677.1|AE016771_188 tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli CFT073]
 gi|190905202|gb|EDV64843.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli F11]
 gi|218430069|emb|CAR11059.2| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli ED1a]
 gi|227836359|gb|EEJ46825.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 83972]
 gi|300302040|gb|EFJ58425.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 185-1]
 gi|300305885|gb|EFJ60405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 200-1]
 gi|300407741|gb|EFJ91279.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 45-1]
 gi|307556338|gb|ADN49113.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli ABU 83972]
 gi|315293547|gb|EFU52899.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 153-1]
 gi|315299052|gb|EFU58306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 16-3]
 gi|324013813|gb|EGB83032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 60-1]
 gi|331051788|gb|EGI23827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA206]
          Length = 316

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|222149076|ref|YP_002550033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           vitis S4]
 gi|239977161|sp|B9JXP7|MIAA_AGRVS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|221736061|gb|ACM37024.1| tRNA delta(2)-isopentenylpyrophosphate [Agrobacterium vitis S4]
          Length = 304

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 95/206 (46%), Positives = 136/206 (66%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  LP+IVGGTGLYF+ALTG LS MP IP A+R  +R++ +  G+  LH +L+  D
Sbjct: 93  DLQAQNRLPVIVGGTGLYFKALTGGLSDMPAIPEAVRVMLRQRERVEGAESLHRDLTLRD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
             VA ++ P DGQRI RALE+  V+GQSI  F  ++    I  + A K+++LP+R  L +
Sbjct: 153 PTVAARLDPRDGQRIIRALEVLEVTGQSISVFQTRSGPMIIDPQRARKLVVLPDRKLLHD 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RRF  M++ GA++E+ +L+  NLSLD+P MKAIGV  I A+LKGEI+ ++ +++   
Sbjct: 213 RINRRFAMMMDEGAVEEVEALLAQNLSLDMPAMKAIGVSQIAAMLKGEISREDVIEKSSA 272

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISS 212
           AT +YAKRQ TW  +Q    W R+  
Sbjct: 273 ATRQYAKRQMTWFRNQMNETWERVDP 298


>gi|313500874|gb|ADR62240.1| MiaA [Pseudomonas putida BIRD-1]
          Length = 323

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/221 (35%), Positives = 122/221 (55%), Gaps = 11/221 (4%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +L+ +D
Sbjct: 89  EITARGKIPLLVGGTMLYYKALIDGLADMPAADAAVRAELEAQAEALGLAELHRQLAEVD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLESAHKII 116
              A +IHP+D QR+ RALE+  VSG+S+    ++               +P   A   I
Sbjct: 149 PESAARIHPNDPQRLIRALEVYRVSGESMTVHRRRQFAESRGADAGAGGHLPYTVASLAI 208

Query: 117 ILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEI 175
              +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   L G++
Sbjct: 209 APTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDYLDGKL 268

Query: 176 NYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +E  +RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 269 TENEMRERGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|117919049|ref|YP_868241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           ANA-3]
 gi|239977456|sp|A0KSR6|MIAA_SHESA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117611381|gb|ABK46835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           ANA-3]
          Length = 296

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +    G   LH++
Sbjct: 74  LREIEQIISMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADANGWEALHEQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RA+E+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 134 LREIDPVSAERIHPNDPQRLSRAIEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L E I +RF  MLE G IDE+  L        DLP M+ +G R     L GE +YD  
Sbjct: 193 KVLHELIGQRFRIMLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 253 VEKAVAATRQLAKRQLTWLRSWPELNWLE 281


>gi|28872057|ref|NP_794676.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|38257953|sp|Q87VJ3|MIAA_PSESM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28855310|gb|AAO58371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
          Length = 323

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 120/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   Q   +  +P++VGGT LYF+AL   L+ MP    A+R ++    + +G   LHD+
Sbjct: 84  LAAMAQITARGNIPLLVGGTMLYFKALLDGLADMPAANAAVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGFLDEVLALRSRGDLHAGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTREEMQERGIIATRQLAKRQFTWLRSWDDLHWLDSLASDNL 309


>gi|191165623|ref|ZP_03027463.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B7A]
 gi|190904318|gb|EDV64027.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B7A]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVYQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|114048921|ref|YP_739471.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-7]
 gi|122944369|sp|Q0HR41|MIAA_SHESR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|113890363|gb|ABI44414.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           MR-7]
          Length = 296

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/209 (36%), Positives = 113/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +    G   LH +
Sbjct: 74  LREIEQIISMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADANGWEALHAQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RA+E+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 134 LREIDPVSAERIHPNDPQRLSRAIEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L E I +RF  MLE G IDE+  L        DLP M+ +G R     L GE +YD  
Sbjct: 193 KVLHELIGQRFRIMLEQGFIDEVAQLKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 253 VEKAVAATRQLAKRQLTWLRSWPELNWLE 281


>gi|330908513|gb|EGH37032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli AA86]
          Length = 301

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 193 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 253 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 286


>gi|320187049|gb|EFW61760.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri CDC 796-83]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|237729104|ref|ZP_04559585.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter sp.
           30_2]
 gi|226908833|gb|EEH94751.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter sp.
           30_2]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWDALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQDIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGVCATRQLAKRQVTWLRGWEGVHWLDSEKPD 301


>gi|215489515|ref|YP_002331946.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O127:H6 str. E2348/69]
 gi|239977372|sp|B7UQI0|MIAA_ECO27 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|215267587|emb|CAS12042.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|110808089|ref|YP_691609.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 5 str. 8401]
 gi|110617637|gb|ABF06304.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 5 str. 8401]
 gi|320200699|gb|EFW75285.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli EC4100B]
 gi|332083722|gb|EGI88940.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 155-74]
          Length = 301

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 193 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 253 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 286


>gi|91213720|ref|YP_543706.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UTI89]
 gi|117626518|ref|YP_859841.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli APEC O1]
 gi|218561330|ref|YP_002394243.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli S88]
 gi|237703838|ref|ZP_04534319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           3_2_53FAA]
 gi|331650296|ref|ZP_08351368.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M605]
 gi|122421472|sp|Q1R389|MIAA_ECOUT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166198906|sp|A1AJ77|MIAA_ECOK1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704724|sp|B7MKX5|MIAA_ECO45 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91075294|gb|ABE10175.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli UTI89]
 gi|115515642|gb|ABJ03717.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli APEC O1]
 gi|218368099|emb|CAR05906.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli S88]
 gi|226901750|gb|EEH88009.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           3_2_53FAA]
 gi|281181267|dbj|BAI57597.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli SE15]
 gi|294492868|gb|ADE91624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IHE3034]
 gi|307629242|gb|ADN73546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli UM146]
 gi|315288452|gb|EFU47850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 110-3]
 gi|323950760|gb|EGB46638.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H252]
 gi|323955458|gb|EGB51222.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H263]
 gi|331040690|gb|EGI12848.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M605]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|24115526|ref|NP_710036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 301]
 gi|30065543|ref|NP_839714.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 2457T]
 gi|27734420|sp|P59197|MIAA_SHIFL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24054853|gb|AAN45743.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 2a str. 301]
 gi|30043807|gb|AAP19526.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella flexneri 2a str. 2457T]
 gi|281603633|gb|ADA76617.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2002017]
 gi|313646354|gb|EFS10816.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           flexneri 2a str. 2457T]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|194426673|ref|ZP_03059227.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B171]
 gi|194415412|gb|EDX31680.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B171]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|187734140|ref|YP_001882862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           CDC 3083-94]
 gi|238691727|sp|B2TY46|MIAA_SHIB3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|187431132|gb|ACD10406.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           CDC 3083-94]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|16131993|ref|NP_418592.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|74314656|ref|YP_313075.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sonnei
           Ss046]
 gi|82546588|ref|YP_410535.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           Sb227]
 gi|89110891|ref|AP_004671.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|157157755|ref|YP_001465669.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E24377A]
 gi|157163634|ref|YP_001460952.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli HS]
 gi|170021819|ref|YP_001726773.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ATCC 8739]
 gi|170083617|ref|YP_001732937.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188495253|ref|ZP_03002523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 53638]
 gi|193066035|ref|ZP_03047093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E22]
 gi|193070867|ref|ZP_03051799.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E110019]
 gi|194434582|ref|ZP_03066839.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1012]
 gi|194439532|ref|ZP_03071606.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 101-1]
 gi|209921659|ref|YP_002295743.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli SE11]
 gi|218556723|ref|YP_002389637.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli IAI1]
 gi|218697920|ref|YP_002405587.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 55989]
 gi|238903278|ref|YP_002929074.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli BW2952]
 gi|253775204|ref|YP_003038035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037185|ref|ZP_04871262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           1_1_43]
 gi|254164100|ref|YP_003047208.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B str. REL606]
 gi|256019816|ref|ZP_05433681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sp.
           D9]
 gi|256025106|ref|ZP_05438971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           4_1_40B]
 gi|260847001|ref|YP_003224779.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|293476482|ref|ZP_06664890.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B088]
 gi|297517573|ref|ZP_06935959.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli OP50]
 gi|300816529|ref|ZP_07096750.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 107-1]
 gi|300821262|ref|ZP_07101410.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 119-7]
 gi|300906000|ref|ZP_07123724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 84-1]
 gi|300920805|ref|ZP_07137206.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 115-1]
 gi|300922423|ref|ZP_07138543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 182-1]
 gi|300929278|ref|ZP_07144754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 187-1]
 gi|300949130|ref|ZP_07163172.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 116-1]
 gi|300957830|ref|ZP_07170008.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 175-1]
 gi|301027993|ref|ZP_07191277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 196-1]
 gi|301302587|ref|ZP_07208717.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 124-1]
 gi|301325934|ref|ZP_07219355.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 78-1]
 gi|301646616|ref|ZP_07246482.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 146-1]
 gi|307140865|ref|ZP_07500221.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|307314881|ref|ZP_07594473.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli W]
 gi|309796982|ref|ZP_07691382.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 145-7]
 gi|312965844|ref|ZP_07780070.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 2362-75]
 gi|331644918|ref|ZP_08346035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|331671076|ref|ZP_08371909.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA271]
 gi|331680301|ref|ZP_08380960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H591]
 gi|127087|sp|P16384|MIAA_ECOLI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123557917|sp|Q31TA1|MIAA_SHIBS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123615505|sp|Q3YUH2|MIAA_SHISS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011774|sp|A7ZV40|MIAA_ECO24 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011775|sp|A8A7R5|MIAA_ECOHS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081952|sp|B1IT35|MIAA_ECOLC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700798|sp|B6I275|MIAA_ECOSE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704726|sp|B7M8T1|MIAA_ECO8A RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229621758|sp|B1XDS2|MIAA_ECODH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977373|sp|B7LC30|MIAA_ECO55 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977571|sp|Q0SXB1|MIAA_SHIF8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|259495765|sp|C4ZR48|MIAA_ECOBW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|221046906|pdb|3FOZ|A Chain A, Structure Of E. Coli Isopentenyl-Trna Transferase In
           Complex With E. Coli Trna(Phe)
 gi|221046907|pdb|3FOZ|B Chain B, Structure Of E. Coli Isopentenyl-Trna Transferase In
           Complex With E. Coli Trna(Phe)
 gi|238537730|pdb|2ZXU|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe) And Dmaspp
 gi|238537731|pdb|2ZXU|B Chain B, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe) And Dmaspp
 gi|146860|gb|AAA24174.1| delta-2-isopentenyl pyrophosphate transferase [Escherichia coli]
 gi|537012|gb|AAA97067.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|1790613|gb|AAC77128.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|2506034|dbj|BAA22627.1| tRNA delta 2-isopentenylpyrophosphate transferase [Shigella
           flexneri]
 gi|73858133|gb|AAZ90840.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella sonnei Ss046]
 gi|81247999|gb|ABB68707.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella boydii Sb227]
 gi|85676922|dbj|BAE78172.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K12 substr. W3110]
 gi|157069314|gb|ABV08569.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli HS]
 gi|157079785|gb|ABV19493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E24377A]
 gi|169756747|gb|ACA79446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli ATCC 8739]
 gi|169891452|gb|ACB05159.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188490452|gb|EDU65555.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 53638]
 gi|192926358|gb|EDV80994.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E22]
 gi|192955813|gb|EDV86284.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E110019]
 gi|194417167|gb|EDX33279.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1012]
 gi|194421531|gb|EDX37544.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 101-1]
 gi|209914918|dbj|BAG79992.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli SE11]
 gi|218354652|emb|CAV01642.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli 55989]
 gi|218363492|emb|CAR01146.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli IAI1]
 gi|226840291|gb|EEH72293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia sp.
           1_1_43]
 gi|238860744|gb|ACR62742.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli BW2952]
 gi|242379693|emb|CAQ34517.1| tRNA(i[6]A37) synthase [Escherichia coli BL21(DE3)]
 gi|253326248|gb|ACT30850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253976001|gb|ACT41672.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B str. REL606]
 gi|253980157|gb|ACT45827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli BL21(DE3)]
 gi|257762148|dbj|BAI33645.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|260451002|gb|ACX41424.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli DH1]
 gi|291320935|gb|EFE60377.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli B088]
 gi|299878903|gb|EFI87114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 196-1]
 gi|300315461|gb|EFJ65245.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 175-1]
 gi|300402167|gb|EFJ85705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 84-1]
 gi|300412228|gb|EFJ95538.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 115-1]
 gi|300421242|gb|EFK04553.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 182-1]
 gi|300451378|gb|EFK14998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 116-1]
 gi|300462771|gb|EFK26264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 187-1]
 gi|300526151|gb|EFK47220.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 119-7]
 gi|300530759|gb|EFK51821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 107-1]
 gi|300842112|gb|EFK69872.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 124-1]
 gi|300847287|gb|EFK75047.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 78-1]
 gi|301075163|gb|EFK89969.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 146-1]
 gi|306905684|gb|EFN36213.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli W]
 gi|308119395|gb|EFO56657.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 145-7]
 gi|309704676|emb|CBJ04026.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli ETEC H10407]
 gi|312289087|gb|EFR16981.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 2362-75]
 gi|315063485|gb|ADT77812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli W]
 gi|315138725|dbj|BAJ45884.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli DH1]
 gi|315255515|gb|EFU35483.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 85-1]
 gi|320173675|gb|EFW48865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae CDC 74-1112]
 gi|320180684|gb|EFW55611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           ATCC 9905]
 gi|320193551|gb|EFW68188.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli WV_060327]
 gi|323161960|gb|EFZ47832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E128010]
 gi|323166653|gb|EFZ52411.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella sonnei
           53G]
 gi|323182277|gb|EFZ67687.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 1357]
 gi|323380436|gb|ADX52704.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli KO11]
 gi|323935401|gb|EGB31745.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E1520]
 gi|323940090|gb|EGB36284.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E482]
 gi|323946019|gb|EGB42056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H120]
 gi|323960320|gb|EGB55960.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H489]
 gi|323965557|gb|EGB61011.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli M863]
 gi|323970574|gb|EGB65833.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA007]
 gi|324019349|gb|EGB88568.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 117-3]
 gi|324118736|gb|EGC12628.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli E1167]
 gi|327250111|gb|EGE61830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli STEC_7v]
 gi|331035893|gb|EGI08131.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H736]
 gi|331061665|gb|EGI33591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli TA271]
 gi|331071764|gb|EGI43100.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli H591]
 gi|332087193|gb|EGI92327.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           3594-74]
 gi|332103307|gb|EGJ06653.1| tRNA delta-2-isopentenylpyrophosphate transferase [Shigella sp. D9]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|296100938|ref|YP_003611084.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055397|gb|ADF60135.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 316

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 119/213 (55%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     IR KI +K  + G  +LH +
Sbjct: 89  LAEMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEIRAKIEQKAAEQGWDVLHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LAEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML S    E+R+L        D+P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASDFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKP 300


>gi|153002274|ref|YP_001367955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS185]
 gi|166216987|sp|A6WSV3|MIAA_SHEB8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151366892|gb|ABS09892.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS185]
          Length = 308

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+
Sbjct: 86  ITEIEQIISMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 146 LREIDPVSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYDVVQFAIAPRER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  
Sbjct: 205 KVLHDLIAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 265 VEKAVAATRQLAKRQLTWLRSWPELNWLE 293


>gi|308048237|ref|YP_003911803.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ferrimonas
           balearica DSM 9799]
 gi|307630427|gb|ADN74729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ferrimonas
           balearica DSM 9799]
          Length = 315

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 74/210 (35%), Positives = 118/210 (56%), Gaps = 2/210 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            +    +P++VGGT LYF+AL   LS +P     IR +I ++  + G   LHDEL+ +D 
Sbjct: 91  IHASGRIPLLVGGTMLYFKALLEGLSPLPSADPKIRAEIEQQAAERGWQALHDELAQIDP 150

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A +IHP+D QR++RALE+  +SG+++     Q   P +P  +A   I+  +R  L +R
Sbjct: 151 ESAARIHPNDPQRLSRALEVYRISGETLTTL-TQQKRPPLPFRTAQFAIVPDQRDRLHQR 209

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML+ G   E+R+L +        P ++ +G R + A L GEI++ E + +G+ 
Sbjct: 210 IEKRFLSMLDQGFEAEVRALYERGDLHPGLPSIRCVGYRQMWAYLDGEISHQEMVAKGVA 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           AT + AKRQ TWL       W+     D++
Sbjct: 270 ATRQLAKRQITWLRGWEGLHWLSSEHDDNV 299


>gi|26991573|ref|NP_746998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida KT2440]
 gi|38257991|sp|Q88DD2|MIAA_PSEPK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24986661|gb|AAN70462.1|AE016688_1 tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida KT2440]
          Length = 323

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 122/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R ++  + +  G   LH +
Sbjct: 84  LEAMAEITARGKIPLLVGGTMLYYKALIDGLADMPAADATVRAELEAQAEALGLAELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 144 LAEVDPESAARIHPNDPQRLIRALEVYRVSGESMTAHRRRQFAESRGADAGAGGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 264 LDGKLTENEMRERGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|120597491|ref|YP_962065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           W3-18-1]
 gi|239977457|sp|A1RFR6|MIAA_SHESW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120557584|gb|ABM23511.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella sp.
           W3-18-1]
          Length = 304

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 112/209 (53%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  Q  +    P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+
Sbjct: 82  LAEIEQIIRMGKTPLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADAKGWETLHDQ 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 142 LRDIDPVSAERIHPNDPQRLSRALEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G I E+  L          P M+ +G R     L GE +YD  
Sbjct: 201 KVLHDLIAQRFRIMLQQGFIGEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 261 VEKAVAATRQLAKRQLTWLRSWPELNWLE 289


>gi|126172806|ref|YP_001048955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS155]
 gi|239977452|sp|A3D023|MIAA_SHEB5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|125996011|gb|ABN60086.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS155]
          Length = 296

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+
Sbjct: 74  IAEIEQIVSMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 134 LRDIDPVSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYDVVQFAIAPRER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  
Sbjct: 193 KVLHDLIAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 253 VEKAVAATRQLAKRQLTWLRSWPELNWLE 281


>gi|315269201|gb|ADT96054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS678]
          Length = 308

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+
Sbjct: 86  IAEIEQIVSMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 146 LREIDPVSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYDVVQFAIAPRER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  
Sbjct: 205 KVLHDLIAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 265 VEKAVAATRQLAKRQLTWLRSWPELNWLE 293


>gi|146310019|ref|YP_001175093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           sp. 638]
 gi|167011776|sp|A4W5R2|MIAA_ENT38 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145316895|gb|ABP59042.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           sp. 638]
          Length = 316

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/214 (35%), Positives = 119/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R KI ++  + G   LH +
Sbjct: 89  LAEMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRAKIEQQAAEQGWSALHKQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LEEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L        D+P ++ +G R I + ++GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQIWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGIHWLDSEKPE 301


>gi|160876998|ref|YP_001556314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS195]
 gi|239977453|sp|A9L3W0|MIAA_SHEB9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160862520|gb|ABX51054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS195]
          Length = 296

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+
Sbjct: 74  IAEIEQIVSMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 134 LREIDPVSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYDVVQFAIAPRER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  
Sbjct: 193 KVLHDLIAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 253 VEKAVAATRQLAKRQLTWLRSWPELNWLE 281


>gi|167554134|ref|ZP_02347875.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205321593|gb|EDZ09432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 316

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 117/215 (54%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LEQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQKTWL       W+   + D 
Sbjct: 268 VYRGVCATRQLAKRQKTWLRGWEGVRWLDSENPDR 302


>gi|77456750|ref|YP_346255.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf0-1]
 gi|123606177|sp|Q3KIZ0|MIAA_PSEPF RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|77380753|gb|ABA72266.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf0-1]
          Length = 323

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 123/226 (54%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LHD+
Sbjct: 84  LEAMAEITARGKIPLLVGGTMLYYKALIEGLADMPAADPEVRAQIEEEAARLGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPN----------PFIPLES 111
           L+++D   A +IHP+D QR++RALE+  VSGQS+ E   +               +P   
Sbjct: 144 LAAIDPESAARIHPNDPQRLSRALEVYRVSGQSMTELRLKQSVQSTEAAASGLQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIAL 170
           A+  I    R  L ERI++RFT MLE G IDE+ +   + +L   LP ++A+G R +   
Sbjct: 204 ANLAIAPTNRQVLHERIKQRFTNMLEQGFIDEVVALRNRSDLHAGLPSIRAVGYRQVWDF 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWKDLHWLDSLDCDNL 309


>gi|145300255|ref|YP_001143096.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|239977182|sp|A4SR26|MIAA_AERS4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|142853027|gb|ABO91348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 310

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 77/216 (35%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P    AIR ++ E+  + G   LHDE
Sbjct: 86  LREMNDIVARGRIPLLVGGTMLYFKALLEGLSPLPSADPAIRAELEEEAARLGWQALHDE 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 146 LVRIDPVAGARIHPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYRVHQFAIAPSDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +ML+SG   E+R+L +        P ++ +G R +   L GE+ YDE 
Sbjct: 205 ALLHKRIEQRFDKMLQSGFEQEVRALYERGDLTPHLPAIRCVGYRQMWDYLAGEVEYDEM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             RGI+AT + AKRQ TWL    +  W+      +L
Sbjct: 265 RYRGIVATRQLAKRQMTWLRGWPEVTWLESGESGNL 300


>gi|167035936|ref|YP_001671167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida GB-1]
 gi|189081957|sp|B0KKZ6|MIAA_PSEPG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166862424|gb|ABZ00832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida GB-1]
          Length = 323

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 124/226 (54%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +
Sbjct: 84  LEAMAEITARGKIPLLVGGTMLYYKALIDGLADMPAADAAVRAELEAQAEALGLAELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 144 LAEVDPVSAARIHPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G ++E+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFVEEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 264 LDGKLTENEMRERGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 309


>gi|306815614|ref|ZP_07449763.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli NC101]
 gi|305851276|gb|EFM51731.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli NC101]
          Length = 316

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSVRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|304410914|ref|ZP_07392531.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS183]
 gi|307304915|ref|ZP_07584665.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica BA175]
 gi|304350811|gb|EFM15212.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS183]
 gi|306912317|gb|EFN42741.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica BA175]
          Length = 308

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  Q       P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+
Sbjct: 86  IAEIEQIVSMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 146 LRVIDPVSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYDVVQFAIAPRER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  
Sbjct: 205 KVLHDLIAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 265 VEKAVAATRQLAKRQLTWLRSWPELNWLE 293


>gi|90581378|ref|ZP_01237174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio angustum
           S14]
 gi|90437488|gb|EAS62683.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio angustum
           S14]
          Length = 312

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 114/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R  I     ++G   LHDE
Sbjct: 86  LKEMADIVAAGRIPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDAAEHGWQALHDE 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L S+D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I   +R
Sbjct: 146 LVSIDPVAGARIHPNDPQRLSRALEVFRISGKTLTEL-TKTQGESLPYKVHQFAITPMDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +M+E+G   E+R+L +        P ++ +G R +   L G  + DE 
Sbjct: 205 AVLHQRIELRFNKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEA 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+  S +D
Sbjct: 265 VFRGICATRQLAKRQITWLRGWKDLTWLDSSDVD 298


>gi|253991554|ref|YP_003042910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638432|emb|CAR67054.1| trna delta(2)-isopentenylpyrophosphate transferase (ec 2.5.1.8) (ip
           transferase) (isopentenyl-diphosphate:trna
           isopentenyltransferase (iptase) (ippt) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253783004|emb|CAQ86169.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           asymbiotica]
          Length = 313

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 80/214 (37%), Positives = 120/214 (56%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     IR KI ++  + G  +LH +
Sbjct: 89  LKEMAEITASGRIPLLVGGTMLYFKALLEGLSPLPSADPIIRAKIEQQAAEQGWDVLHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+ L+SG+++ E   +     +P       I   +R
Sbjct: 149 LQKIDPVAALRIHPNDPQRLSRALEVFLISGKTLTEL-TKLSGEDLPYRVYQFAIAPAKR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QMLESG  +E ++L   N      P ++ +G R + + L GEI+YDE 
Sbjct: 208 EILHQRIEARFHQMLESGFEEEAKALYARNDLHVDLPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL    Q  W+  S  +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWKQVHWLDSSQPE 301


>gi|146294368|ref|YP_001184792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens CN-32]
 gi|239977455|sp|A4YAL0|MIAA_SHEPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145566058|gb|ABP76993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           putrefaciens CN-32]
          Length = 304

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 74/209 (35%), Positives = 113/209 (54%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  Q  +    P++VGGT +YF+AL   LS +P    AIR  I+ +    G   LHD+
Sbjct: 82  LAEIAQIIRMGKTPLLVGGTMMYFKALLEGLSPLPSADDAIRADIQAEADVKGWETLHDQ 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P +     I   ER
Sbjct: 142 LRDIDPVSAERIHPNDPQRLSRALEVYRISGKSLTEL-TQTKSAPLPYDVVQFAIAPRER 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L + I +RF  ML+ G IDE+  L          P M+ +G R     L GE +YD  
Sbjct: 201 KVLHDLIAQRFRIMLQQGFIDEVTQLKARGDLHLDLPSMRCVGYRQCWQHLDGEFDYDTM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ + AT + AKRQ TWL    + +W+ 
Sbjct: 261 VEKAVAATRQLAKRQLTWLRSWPELNWLE 289


>gi|261342832|ref|ZP_05970690.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cancerogenus ATCC 35316]
 gi|288314874|gb|EFC53812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Enterobacter
           cancerogenus ATCC 35316]
          Length = 316

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 75/213 (35%), Positives = 118/213 (55%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R KI ++  + G  +LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRAKIEQQAAEQGWDVLHKQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LAQVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGEALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML S    E+R+L        D+P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASDFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKP 300


>gi|309787675|ref|ZP_07682286.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1617]
 gi|308924425|gb|EFP69921.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae 1617]
          Length = 316

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           +  G+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYLGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|82779447|ref|YP_405796.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella
           dysenteriae Sd197]
 gi|123560946|sp|Q328F0|MIAA_SHIDS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|81243595|gb|ABB64305.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Shigella dysenteriae Sd197]
          Length = 316

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           +  G+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYLGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|315127882|ref|YP_004069885.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas sp. SM9913]
 gi|315016396|gb|ADT69734.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas sp. SM9913]
          Length = 306

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/216 (32%), Positives = 121/216 (56%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  + +++  +P++VGGT +YF+AL   LS +PE    +R ++  + K++G   L+ E
Sbjct: 84  IEKIDKFHQQGKVPVLVGGTMMYFKALIDGLSPLPEADADVRAELETQAKEHGWPYLYKE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D   A+++  +D QRI RALE+  ++G+++ E   +   P +P       I   +R
Sbjct: 144 LVKVDPQAAQKMSENDSQRINRALEVYRITGKTMTELQ-KQKQPALPYTFHQFAIAPDDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L  RI  RF  M+E G   E+ +L  + +L  ++P ++ +G R +   L GEI++DE 
Sbjct: 203 SELHHRIEERFKIMIEQGFEKEVSTLYLREDLHPNMPSIRCVGYRQMWDYLAGEIDHDEM 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+     ++L
Sbjct: 263 IFRGIAATRQLAKRQLTWLRSWPDVTWLTTGDEENL 298


>gi|330831014|ref|YP_004393966.1| tRNA dimethylallyltransferase [Aeromonas veronii B565]
 gi|328806150|gb|AEB51349.1| tRNA dimethylallyltransferase [Aeromonas veronii B565]
          Length = 309

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 78/216 (36%), Positives = 117/216 (54%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LYF+AL   LS +P    AIR  I E+  + G   LHDE
Sbjct: 85  LREMKEIADRGRIPLLVGGTMLYFKALLEGLSPLPSADPAIRAGIEEEAARCGWQALHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LVRIDPVAGARIHPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYRVLQFAIAPSDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +ML+ G   E+R+LM         P ++ +G R +   L GE+ YDE 
Sbjct: 204 AVLHQRIEQRFDKMLQGGFEQEVRALMARGDLHPDLPSIRCVGYRQMWDYLCGEVGYDEM 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             RGI+AT + AKRQ TWL       W+      +L
Sbjct: 264 RYRGIVATRQLAKRQMTWLRGWPDVTWLESGESGNL 299


>gi|262275156|ref|ZP_06052967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Grimontia
           hollisae CIP 101886]
 gi|262221719|gb|EEY73033.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Grimontia
           hollisae CIP 101886]
          Length = 297

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/212 (34%), Positives = 114/212 (53%), Gaps = 2/212 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q   K  +P++VGGT LYF+AL   LS +P     IR KI ++ K+ G   LH+ 
Sbjct: 74  LREMEQIVAKGRIPLLVGGTMLYFKALLEGLSPLPPADPVIRAKIEQEAKERGWQALHEA 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P E     I   ER
Sbjct: 134 LCKVDPVAGARIHPNDPQRLSRALEVFRISGKTLTEL-TETKGEPLPYEVHQFAIAPKER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF +M+E+G   E+R+L      + D+P ++ +G R +   L G  + D+ 
Sbjct: 193 GDLHRRIELRFHKMMEAGFEKEVRALFDRGDLNPDMPSIRCVGYRQMWDYLAGSCSLDDA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
           + RG+ AT + AKRQ TWL       W+    
Sbjct: 253 VYRGVCATRQLAKRQITWLRSWDNLTWLDSDD 284


>gi|29144658|ref|NP_808000.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|29140297|gb|AAO71860.1| tRNA delta-2-isopentenylpyrophosphate transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 316

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/215 (35%), Positives = 122/215 (56%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAQMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRSRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E+R+L  + +L  DLP ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLASGFEAEVRALFAREDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ +T + AKRQ TWL       W+   + D 
Sbjct: 268 VYRGVCSTRQLAKRQMTWLRGWEGVRWLDSENPDR 302


>gi|320190697|gb|EFW65347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC1212]
 gi|326345497|gb|EGD69240.1| tRNA delta-2-isopentenylpyrophosphate transferase [Escherichia coli
           O157:H7 str. 1125]
 gi|326346646|gb|EGD70380.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. 1044]
          Length = 301

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L GEI+YDE 
Sbjct: 193 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLGGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 253 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 286


>gi|15804760|ref|NP_290801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 EDL933]
 gi|15834401|ref|NP_313174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. Sakai]
 gi|168751479|ref|ZP_02776501.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4113]
 gi|168754740|ref|ZP_02779747.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4401]
 gi|168760410|ref|ZP_02785417.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4501]
 gi|168766448|ref|ZP_02791455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4486]
 gi|168774118|ref|ZP_02799125.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4196]
 gi|168780601|ref|ZP_02805608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4076]
 gi|168784806|ref|ZP_02809813.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC869]
 gi|168801824|ref|ZP_02826831.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC508]
 gi|195935961|ref|ZP_03081343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4024]
 gi|208806573|ref|ZP_03248910.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208812724|ref|ZP_03254053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208819068|ref|ZP_03259388.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209400590|ref|YP_002273713.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4115]
 gi|217326156|ref|ZP_03442240.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14588]
 gi|254796190|ref|YP_003081027.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14359]
 gi|261225291|ref|ZP_05939572.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255457|ref|ZP_05947990.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|21263767|sp|Q8XDN3|MIAA_ECO57 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700797|sp|B5Z2H7|MIAA_ECO5E RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|12519156|gb|AAG59367.1|AE005650_6 delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364624|dbj|BAB38570.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|187770326|gb|EDU34170.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4196]
 gi|188014483|gb|EDU52605.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4113]
 gi|189001749|gb|EDU70735.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4076]
 gi|189357893|gb|EDU76312.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4401]
 gi|189364314|gb|EDU82733.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4486]
 gi|189368991|gb|EDU87407.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4501]
 gi|189374757|gb|EDU93173.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC869]
 gi|189376077|gb|EDU94493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC508]
 gi|208726374|gb|EDZ75975.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4206]
 gi|208734001|gb|EDZ82688.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4045]
 gi|208739191|gb|EDZ86873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4042]
 gi|209161990|gb|ACI39423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. EC4115]
 gi|209750288|gb|ACI73451.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750290|gb|ACI73452.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750292|gb|ACI73453.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|209750296|gb|ACI73455.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli]
 gi|217322377|gb|EEC30801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. TW14588]
 gi|254595590|gb|ACT74951.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|320638929|gb|EFX08575.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. G5101]
 gi|320644298|gb|EFX13363.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H- str. 493-89]
 gi|320649616|gb|EFX18140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H- str. H 2687]
 gi|320665788|gb|EFX32825.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli O157:H7 str. LSU-61]
          Length = 316

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLGGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|56459443|ref|YP_154724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           loihiensis L2TR]
 gi|61213954|sp|Q5QWA0|MIAA_IDILO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56178453|gb|AAV81175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           loihiensis L2TR]
          Length = 316

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 75/209 (35%), Positives = 118/209 (56%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++  +P++VGGT LYF+AL   LS +PE  T++REK+  +L + G   LH  L  +D
Sbjct: 89  DIQQRGKVPLLVGGTMLYFKALLEGLSHLPESDTSVREKLTAELHEKGLAELHSRLQKVD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A++IHP+D QRI RALE+  ++G+ + E  ++              +   ER  L +
Sbjct: 149 PTSAKRIHPNDPQRILRALEVYEIAGKPLTELTRERHGQLTKPIY-QFAVAPVERKVLHQ 207

Query: 127 RIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML     +E+ +L  + +L  DLP ++++G R +   L GE++YDE  +RGI
Sbjct: 208 RIEQRFDHMLAQPFKEEVATLFARPDLHPDLPSIRSVGYRQMWQHLAGELSYDEMRERGI 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
           IAT + AKRQ TWL       W+    ++
Sbjct: 268 IATRQLAKRQMTWLRGWPGVHWLETGDLN 296


>gi|324112232|gb|EGC06210.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           fergusonii B253]
          Length = 316

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P   + +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADSEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|197334540|ref|YP_002157120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           MJ11]
 gi|226700807|sp|B5FBR5|MIAA_VIBFM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|197316030|gb|ACH65477.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           MJ11]
          Length = 310

 Score =  171 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR +I ++ +Q+G   +HD+
Sbjct: 85  LKEMDDIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAEQFGWEAMHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L S+D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P E     I   ER
Sbjct: 145 LKSIDPVSAERIHPNDPQRLSRALEVFRISGKTLTEL-TQIKGDALPYEVHQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + +  RI  RF  M+E G   E R+L + +      P ++ +G R +     GE   DE 
Sbjct: 204 AEIHRRIELRFANMMEEGFEAEARALYERDDLHADLPSIRCVGYRQMWDYFDGEGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL    +  W+    ID
Sbjct: 264 VFRGICATRQLAKRQITWLRSWKELTWLDSDDID 297


>gi|283834789|ref|ZP_06354530.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           youngae ATCC 29220]
 gi|291069035|gb|EFE07144.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           youngae ATCC 29220]
          Length = 316

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPDVRARIEQQAAERGWDALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P E     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYEVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGVCATRQLAKRQVTWLRGWEGVHWLDSEKPD 301


>gi|209696184|ref|YP_002264114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aliivibrio
           salmonicida LFI1238]
 gi|226700793|sp|B6EMQ8|MIAA_ALISL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|208010137|emb|CAQ80462.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase [Aliivibrio
           salmonicida LFI1238]
          Length = 313

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR +I ++ +  G   +HD+
Sbjct: 85  LKEMEDIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAETLGWEAMHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I   ER
Sbjct: 145 LKEIDPVSAERIHPNDPQRLSRALEVFRISGKTLTEL-TQVKGDALPYQVHQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + +  RI  RF  M++ G  +E+RSL + +      P ++ +G R +     GE   D+ 
Sbjct: 204 AEIHRRIELRFDNMMKGGFEEEVRSLYERDDLHADLPSIRCVGYRQMWEYFDGEGTLDDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +ID
Sbjct: 264 IFRGICATRQLAKRQITWLRSWKDLTWLDSDNID 297


>gi|330445001|ref|ZP_08308655.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328493119|dbj|GAA03152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 311

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R  I     ++G   LHDE
Sbjct: 85  LKEMADIVAAGRIPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDAAEFGWQALHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I   +R
Sbjct: 145 LVRIDPVAGARIHPNDPQRLSRALEVFRISGKTLTEL-TKTQGESLPYKVHQFAIAPMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +M+E+G   E+R+L +        P ++ +G R +   L G  + DE 
Sbjct: 204 AVLHQRIELRFNKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+  S +D
Sbjct: 264 VFRGICATRQLAKRQITWLRGWKDLTWLDSSDVD 297


>gi|152973041|ref|YP_001338187.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206577864|ref|YP_002240874.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae 342]
 gi|238892655|ref|YP_002917389.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262045397|ref|ZP_06018421.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288937530|ref|YP_003441589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           variicola At-22]
 gi|290512269|ref|ZP_06551636.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella sp.
           1_1_55]
 gi|330003343|ref|ZP_08304586.1| tRNA dimethylallyltransferase [Klebsiella sp. MS 92-3]
 gi|166198914|sp|A6TH86|MIAA_KLEP7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226700799|sp|B5Y333|MIAA_KLEP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150957890|gb|ABR79920.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|206566922|gb|ACI08698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae 342]
 gi|238544971|dbj|BAH61322.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037315|gb|EEW38562.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|288892239|gb|ADC60557.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella
           variicola At-22]
 gi|289775264|gb|EFD83265.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Klebsiella sp.
           1_1_55]
 gi|328537005|gb|EGF63295.1| tRNA dimethylallyltransferase [Klebsiella sp. MS 92-3]
          Length = 316

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+          +P++VGGT LYF+AL   LS +P     +R +I ++  + G + LH +
Sbjct: 89  LAAMADIVAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWNALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L        D+P ++ +G R + + L GEI YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDMPSIRCVGYRQMWSYLNGEIPYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQVTWLRGWEGVHWLDSEQPE 301


>gi|324005234|gb|EGB74453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli MS 57-2]
          Length = 316

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAVEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|260858324|ref|YP_003232215.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260870921|ref|YP_003237323.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O111:H- str. 11128]
 gi|257756973|dbj|BAI28475.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257767277|dbj|BAI38772.1| delta(2)-isopentenylpyrophosphate tRNA-adenosinetransferase
           [Escherichia coli O111:H- str. 11128]
 gi|323156012|gb|EFZ42174.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli EPECa14]
 gi|323176071|gb|EFZ61663.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Escherichia
           coli 1180]
          Length = 316

 Score =  171 bits (432), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAVEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|153009131|ref|YP_001370346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           anthropi ATCC 49188]
 gi|166215160|sp|A6WZW3|MIAA_OCHA4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151561019|gb|ABS14517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 308

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 93/207 (44%), Positives = 132/207 (63%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           K   PI VGGTGLYFRAL G LS MPE+P  +R   R +++  G   LH  LS  D  +A
Sbjct: 95  KHRTPIFVGGTGLYFRALLGGLSQMPEVPGDVRAYWRGRMEMDGPENLHRLLSERDPEMA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + P D QRI RALE+   +G+S++ + +      +   SA KI++LP+R+ L ERI R
Sbjct: 155 ATLQPFDSQRIVRALEVFEGTGKSLLVWQQTKGQALVDDHSARKIVLLPDRTWLSERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M ++GAIDE+++L+ ++L   LP MKAIGVR+I A L+G ++ +E ++R +IAT +
Sbjct: 215 RFALMWDNGAIDEVKALLVLDLDPALPAMKAIGVREITAFLQGSMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q    W   ++ DD F
Sbjct: 275 YAKRQSTWFRNQLDDSWCTHANSDDAF 301


>gi|59712931|ref|YP_205707.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio fischeri
           ES114]
 gi|75506908|sp|Q5E2C7|MIAA_VIBF1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|59481032|gb|AAW86819.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Vibrio fischeri ES114]
          Length = 310

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR +I ++ +Q+G   +HD+
Sbjct: 85  LKEMDDIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADADIRAQIEQEAEQFGWEAMHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P E     I   ER
Sbjct: 145 LKTIDPVSAERIHPNDPQRLSRALEVFRISGKTLTEL-TQIKGDALPYEVHQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + +  RI  RF  M+E G   E R+L + +      P ++ +G R +     GE   DE 
Sbjct: 204 AEIHRRIELRFANMMEEGFEAEARALYERDDLHADLPSIRCVGYRQMWDYFDGEGTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL    +  W+    ID
Sbjct: 264 VFRGICATRQLAKRQITWLRSWKELTWLDSDDID 297


>gi|77359237|ref|YP_338812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123587197|sp|Q3IDT9|MIAA_PSEHT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|76874148|emb|CAI85369.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 306

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 120/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  + +++  +P++VGGT LYF+AL   LS +PE    IR ++  +  QYG   L+ E
Sbjct: 84  IIKIDEFHQQGKVPVLVGGTMLYFKALIDGLSPLPEANVEIRAELEAQAAQYGWPHLYQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D   A+++  +D QRI RALE+  ++G+++ E   +   P +P       I   +R
Sbjct: 144 LVKIDPQAAQKMSENDSQRINRALEVYKLTGKTMTELQ-KQKQPVLPYTFHQFAIAPTQR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L +RI +RF  MLE G  +E+ +L        ++P ++ +G R +   L GEI++DE 
Sbjct: 203 SELHQRIEKRFKIMLEQGFENEVSTLYLRKDLHPNMPSIRCVGYRQMWDYLAGEIDHDEM 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+     ++L
Sbjct: 263 VFRGIAATRQLAKRQLTWLRSWPDVTWLTTGDEENL 298


>gi|226942901|ref|YP_002797974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azotobacter
           vinelandii DJ]
 gi|259495761|sp|C1DLQ1|MIAA_AZOVD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226717828|gb|ACO76999.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Azotobacter
           vinelandii DJ]
          Length = 323

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 116/226 (51%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LY++AL   L+ MP    A+R ++  +    G   LH E
Sbjct: 84  LAAMAEISARGRIPLLVGGTMLYYKALLEGLADMPSADPALRAELEARGAAEGWAALHRE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+++D   A +IHP+D QR+ RALE+  VSG S+     +               +P   
Sbjct: 144 LATVDPESAARIHPNDPQRLVRALEVYRVSGLSMTAHRLRQVAQNPLSDRSAGEHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
            H  I   +R  L ERI RRF  MLE G +DE+  L +        P M+A+G R +   
Sbjct: 204 VHLAIAPTQRQILHERIARRFRLMLEQGFVDEVELLWRRGDLHASLPSMRAVGYRQVWEY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G +  ++ ++RGIIAT + AKRQ TWL +     W+     D+L
Sbjct: 264 LDGLLTREQMVERGIIATRQLAKRQFTWLRNWTDLHWLDSLGDDNL 309


>gi|85058314|ref|YP_454016.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sodalis
           glossinidius str. 'morsitans']
 gi|123520158|sp|Q2NW64|MIAA_SODGM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84778834|dbj|BAE73611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sodalis
           glossinidius str. 'morsitans']
          Length = 312

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/213 (32%), Positives = 111/213 (52%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +  +   +P++VGGT LYF+AL   LS +P     +R +I  + +  G   LH +
Sbjct: 89  LKEMAEITEAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEREAETVGWQALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A +IHP+D QR+ RALE+  VSG ++ E   +     +        I+  +R
Sbjct: 149 LQQIDPIAANRIHPNDPQRLLRALEVFFVSGNTLTEL-TKISGEALAYRVHQFAIVPLDR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF QML +G   E+ +L         +P ++ +G R + + L  E +YD+ 
Sbjct: 208 ALLHQRIAQRFHQMLAAGFEHEVSTLFARGDLHREMPSIRCVGYRQMWSYLADETDYDDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VFRGICATRQLAKRQMTWLRGWHDVHWLDSDEP 300


>gi|170728496|ref|YP_001762522.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           woodyi ATCC 51908]
 gi|239977458|sp|B1KHU9|MIAA_SHEWM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169813843|gb|ACA88427.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           woodyi ATCC 51908]
          Length = 296

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   K   P++VGGT +YF+AL   LS +P     IR++I+ +   YG + LHDE
Sbjct: 74  LQAIEEILAKGKTPLLVGGTMMYFKALLEGLSPLPAADDEIRKQIQIEADTYGWNHLHDE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RA+E+  +SG+S+ E   +  +  +P +     I   +R
Sbjct: 134 LKQIDPVSAERIHPNDPQRLSRAIEVYRISGKSLTEL-TKIKSEPLPYDVVQFAISPKDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G ++E+RSL + +      P M+ +G R     L G+ +YD  
Sbjct: 193 KQLHLSIEERFKLMLNQGFVEEVRSLRERSELHIDLPSMRCVGYRQCWQYLNGDYDYDTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +++ ++AT + AKRQ TWL    + +W+   S  +L
Sbjct: 253 VEKAVVATRQLAKRQLTWLRGWPELNWLESGSDSNL 288


>gi|322831155|ref|YP_004211182.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rahnella sp.
           Y9602]
 gi|321166356|gb|ADW72055.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rahnella sp.
           Y9602]
          Length = 313

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 119/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LYF+AL   LS +P     +RE+I ++  + G   LHD+
Sbjct: 89  LREMAEITSRNKIPLLVGGTMLYFKALLEGLSPLPPADPVVRERIEKQAAEQGWEALHDQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 149 LRKIDPVAAMRIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYRVHQFAIAPTRR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF+QML +G  DE+R+L+         P ++ +G R + + L GE +YDE 
Sbjct: 208 ELLHARIEERFSQMLSNGFEDEVRTLIARGDLHTDLPSIRCVGYRQMWSYLSGEFDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL      +W+     ++
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWESVEWLDSEKPEE 302


>gi|227115181|ref|ZP_03828837.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 313

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 79/215 (36%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +
Sbjct: 89  LREMADITAAGRIPLLVGGTMLYFKALLEGLSPLPPADPAVRQRIEEQAKEIGWEAMHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P +     I    R
Sbjct: 149 LGEIDPVAAIRIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGDALPYQVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHERIEQRFHQMLAAGFETEARTLFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+      +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWDDVCWLDSEKPTE 302


>gi|251825690|gb|ACT20912.1| tRNA isopentenyltransferase [Pseudomonas fluorescens]
          Length = 323

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 80/226 (35%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LH++
Sbjct: 84  LQAMAEITARGKIPLLVGGTMLYYKALVEGLADMPAADPEVRAQIEEEAARLGWQALHEQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPN----------PFIPLES 111
           L+ +D   A +IHP+D QR++RALE+  VSGQS+    ++               +P   
Sbjct: 144 LAVIDPESAARIHPNDPQRLSRALEVYRVSGQSMTALRQRQSAQSTEAAASGLQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A+  I    R  L  RI +RFT MLE G IDE+ +L +  +L   LP ++A+G R +   
Sbjct: 204 ANLAIAPANRQVLHRRIEQRFTLMLEQGFIDEVVALRERSDLHPGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWTDLHWLDSLDCDNL 309


>gi|304396956|ref|ZP_07378836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp. aB]
 gi|304355752|gb|EFM20119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pantoea sp. aB]
          Length = 301

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/213 (33%), Positives = 114/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     +R++I +  ++ G   LH +
Sbjct: 74  LAEMAEIVAAGRIPLLVGGTMLYFKALLEGLSPLPSADPDVRQRIEQTAREKGWDALHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 134 LCEIDPVAGSRIHPNDPQRLSRALEVFFISGKTLTEL-TKTSGEALPYDVQQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML SG   E R+L        D+P ++ +G R + + L GEI++ E 
Sbjct: 193 ELLHQRIALRFEQMLASGFEAEARALFARGDLHTDMPSIRCVGYRQMWSYLSGEIDHSEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 253 VYRGICATRQLAKRQITWLRGWENVHWLDSDEP 285


>gi|323496871|ref|ZP_08101903.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           sinaloensis DSM 21326]
 gi|323318057|gb|EGA71036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           sinaloensis DSM 21326]
          Length = 315

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q  ++  +P++VGGT LY++AL   LS +P     IR++I ++    G ++LHD+
Sbjct: 85  LKEMHQIVEQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWNVLHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LKEIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGDALPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +MLE+G  +E+R+L   +      P ++ +G R +   L G    D+ 
Sbjct: 204 AELHRRIELRFDKMLEAGFEEEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + +G+ AT + AKRQ TWL       W+   +ID+
Sbjct: 264 IFKGVCATRQLAKRQITWLRSWDNLTWLDSENIDE 298


>gi|123440759|ref|YP_001004751.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|166217001|sp|A1JIR4|MIAA_YERE8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|122087720|emb|CAL10505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 313

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +
Sbjct: 89  LKEMADITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAAELGWEALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P +     I    R
Sbjct: 149 LAEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYQVHQFAIAPVSR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWGSVQWLDSDKP 300


>gi|114564473|ref|YP_751987.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           frigidimarina NCIMB 400]
 gi|122298758|sp|Q07XW6|MIAA_SHEFN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114335766|gb|ABI73148.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           frigidimarina NCIMB 400]
          Length = 296

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 106/204 (51%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +   P++VGGT +YF+AL   LS +P    AIR++I  + +  G   LH EL ++D
Sbjct: 79  DIISRGKTPLLVGGTMMYFKALLEGLSPLPSADEAIRQQILAQAQTEGWEALHQELCNID 138

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            +   +IHP+D QR++RALE+  +SG+++ E   Q  +  +P +     I   +R  L E
Sbjct: 139 PVAGERIHPNDPQRLSRALEVYRISGKTMTEL-TQTKSAALPYDVVQFAIAPNDRKVLHE 197

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
            I +RF  MLE G I+E+  L   +      P M+ +G R     L  E ++   +++  
Sbjct: 198 LIAKRFNIMLEQGFIEEVARLKARDDLHLELPSMRCVGYRQCWQYLDNEFDHATMVEKAT 257

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL       W+ 
Sbjct: 258 AATRQLAKRQLTWLRSWPDLQWLE 281


>gi|50122855|ref|YP_052022.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|61214081|sp|Q6D066|MIAA_ERWCT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49613381|emb|CAG76832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 313

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/215 (35%), Positives = 121/215 (56%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +
Sbjct: 89  LREMADITAAGRIPLLVGGTMLYFKALLEGLSPLPPADAAVRQRIEEQAKEIGWEAMHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D   A +IHP+D QR++RALE+  +SG ++ E   +     +P +     I    R
Sbjct: 149 LSEIDPTAAIRIHPNDPQRLSRALEVFFISGNTLTEL-TKTSGDALPYQVHQFAIAPAMR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLAAGFETEARALFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RG+ AT + AKRQ TWL       W+   +  +
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWDDVCWLDSENPTE 302


>gi|24372193|ref|NP_716235.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           oneidensis MR-1]
 gi|46577042|sp|Q8CX50|MIAA_SHEON RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|24346102|gb|AAN53680.1|AE015507_6 tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           oneidensis MR-1]
          Length = 308

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 112/209 (53%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           LS+  Q       P++VGGT +YF+AL   LS +P     IR  I+ +    G   LHD+
Sbjct: 86  LSEIEQIISMGKTPLLVGGTMMYFKALLEGLSPLPSADEVIRADIQAEADANGWEALHDQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E      +  +P       I   ER
Sbjct: 146 LREIDPVSAERIHPNDPQRLSRALEVYRISGKSLTELTM-TKSAPLPYNVVQFAIAPRER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L E I +RF  MLE G IDE+  L   +    DLP M+ +G R     L GE ++D  
Sbjct: 205 KVLHELIGQRFRIMLEQGFIDEVAQLKARDDLHLDLPSMRCVGYRQCWQYLDGEFDHDTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ I AT + AKRQ TWL    + +W+ 
Sbjct: 265 VEKAIAATRQLAKRQLTWLRSWPELNWLE 293


>gi|90414476|ref|ZP_01222452.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum 3TCK]
 gi|90324481|gb|EAS41040.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum 3TCK]
          Length = 311

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/214 (31%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     +R  I  + ++ G   LH+E
Sbjct: 85  LKEMADIVAEGRIPLLVGGTMLYYKALLEGLSPLPASDPDVRAGIEREAQEKGWQFLHEE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P       I   +R
Sbjct: 145 LVRIDPVSGARIHPNDPQRLSRALEVFRISGKTLTEL-TKTQGEPLPYRVHQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF  M+E+G  +E+R+L +        P ++ +G R +   L G  + DE 
Sbjct: 204 AVLHQRIEQRFENMIEAGFEEEVRALYQRGDLHPDLPSIRCVGYRQMWDYLGGNCDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+  ++ D
Sbjct: 264 VFRGVCATRQLAKRQITWLRGWKDLTWLDSNNGD 297


>gi|296133001|ref|YP_003640248.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermincola sp.
           JR]
 gi|296031579|gb|ADG82347.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermincola
           potens JR]
          Length = 316

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 114/219 (52%), Gaps = 6/219 (2%)

Query: 1   MLSKKLQ-----RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYG 54
           +  K ++      Y K  +PI+VGGTGLY R++       P  +  ++REK++E+ + +G
Sbjct: 77  LFQKMVENYIKRIYDKGKVPILVGGTGLYIRSVIDHYDFTPVAVDPSLREKLKEEAEMFG 136

Query: 55  SHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK 114
           S  LH +L  +D   A +IHP+D +RI RALE+ L SG+ I  F +       P      
Sbjct: 137 SASLHRKLQQVDPKAAEKIHPNDMRRIIRALEVYLSSGRQISSFHRLEDESLPPKYRLGY 196

Query: 115 IIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGE 174
             +  +R  L  RI  R  +M+E G I+E+R L+K      +  M+ IG ++II  L+GE
Sbjct: 197 YGLTMQRHNLYRRIEERVDKMIEKGLIEEVRCLLKKGYHEGMVSMQGIGYKEIIGYLRGE 256

Query: 175 INYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
              ++ +Q     T ++AKRQ TW     +  W  + + 
Sbjct: 257 YTLEDAVQLLKRNTRRFAKRQLTWFRRDARIKWFDVEAY 295


>gi|332160021|ref|YP_004296598.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664251|gb|ADZ40895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862096|emb|CBX72262.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Yersinia
           enterocolitica W22703]
          Length = 313

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G  +LH +
Sbjct: 89  LKEMADITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAAELGWEVLHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 149 LAEIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYRVHQFAIAPVSR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIELRFHQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWGSVQWLDSDKP 300


>gi|300721487|ref|YP_003710762.1| delta(2)-isopentenylpyrophosphate tRNA -adenosine transferase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297627979|emb|CBJ88528.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus nematophila ATCC 19061]
          Length = 313

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/213 (34%), Positives = 113/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     IR +I ++ ++ G   LH +
Sbjct: 89  LKEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSANPEIRAQIEQQAEERGWDALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR+ RALE+  +SG+++ E   +     +P       I    R
Sbjct: 149 LQEIDPVAAVRIHPNDPQRLTRALEVFRISGKTLTEL-TETAGEILPYHVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QM++SG  DE+++L          P ++ +G R + + L GEI++DE 
Sbjct: 208 EVLHQRIAARFEQMIKSGFEDEVKALYARRDLHTDLPSIRCVGYRQMWSYLAGEISHDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQITWLRSWDNVTWLDSDQP 300


>gi|331014609|gb|EGH94665.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 323

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   Q   +  +P++VGGT LYF+AL   L+ MP   TA+R ++    + +G   LHD+
Sbjct: 84  LAAMAQITARGNIPLLVGGTMLYFKALLDGLADMPAANTAVRAQLEADAQAFGWQSLHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG S+    +Q               +P   
Sbjct: 144 LAVVDPVSAARIHPNDPQRLIRALEVYRVSGMSMTAHREQQTAQSTEAAASGCQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I   +R  L +RI  RF QML+ G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPADRKVLHQRIALRFEQMLDQGLLDEVLALRSRGDLHAGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTREEMQERGIIATRQLAKRQFTWLRSWDDLYWLDSLASDNL 309


>gi|268592881|ref|ZP_06127102.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rettgeri DSM 1131]
 gi|291311671|gb|EFE52124.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rettgeri DSM 1131]
          Length = 313

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 117/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   LS +P    A+R +I    K+ G   +H  
Sbjct: 89  LNAMAEITSQGKIPLLVGGTMLYFKALLEGLSPLPSADQAVRTEIEHIAKEQGWGEIHRR 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+ L+SGQ++ E   Q     +P       I   +R
Sbjct: 149 LTEVDPVAAARIHPNDPQRLSRALEVYLISGQTLTEM-IQTAGEELPYNVFQFAIAPQDR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF  M+++G  +E+R L + N      P ++ +G R + + L GEI +DE 
Sbjct: 208 KILHERIEQRFHLMIDAGFEEEVRKLHQRNDLHVDLPSIRCVGYRQMWSYLDGEIGHDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 IYRGICATRQLAKRQITWLRSWENVHWLDSEQP 300


>gi|254509319|ref|ZP_05121409.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 16]
 gi|219547748|gb|EED24783.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 16]
          Length = 304

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/215 (32%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+
Sbjct: 74  LNEMNKIVEQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWDVLHDQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I   ER
Sbjct: 134 LKEVDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TKTKGDSLPFRVKQFAIAPKER 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+R+L   +      P ++ +G R +   L G    D+ 
Sbjct: 193 AELHRRIELRFEKMMEAGFENEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + +G+ AT + AKRQ TWL       W+   +ID+
Sbjct: 253 IFKGVCATRQLAKRQITWLRSWDNLTWLDSENIDE 287


>gi|90022313|ref|YP_528140.1| tRNA isopentenyltransferase [Saccharophagus degradans 2-40]
 gi|123395832|sp|Q21HA1|MIAA_SACD2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|89951913|gb|ABD81928.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Saccharophagus
           degradans 2-40]
          Length = 336

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 79/216 (36%), Positives = 122/216 (56%), Gaps = 3/216 (1%)

Query: 2   LSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
              +++  + +  +P++ GGT +YF+AL   LS MP    A+R +I ++  + G   LH 
Sbjct: 99  AKAEIESIHSQGKIPVLAGGTMMYFKALLEGLSDMPASDPAVRAQIDKRASEEGWPALHS 158

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILP 119
           EL+S+D   A  IHP+   RI+RALE+ ++SG+ +  +  QA N  I   +     +   
Sbjct: 159 ELASVDPETAANIHPNHSHRISRALEVYVISGKRMSAWRGQANNGLIDTYDWVQICVAPR 218

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYD 178
           ER+ L +RI +RF  MLE G IDE+R+L   N  ++D+P ++A+G R     L G  +YD
Sbjct: 219 ERTLLHQRIAQRFDMMLEQGFIDEVRALYSRNDLNVDMPSIRAVGYRQAWDYLAGVSSYD 278

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E  ++GI AT + AKRQ TWL      +WI     D
Sbjct: 279 EMREKGIAATRQLAKRQFTWLRSWQGLEWIYTQDED 314


>gi|269103608|ref|ZP_06156305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163506|gb|EEZ42002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 311

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 113/214 (52%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     IR  I ++ K+ G   LH+E
Sbjct: 85  LKEMADIVAAGRIPLLVGGTMLYYKALLEGLSPLPAADPEIRAGIEQEAKEKGWQALHEE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I   +R
Sbjct: 145 LVRIDPVSGARIHPNDPQRLSRALEVFRISGKTLTEL-TKTQGDALPYKVHQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +M+ +G   E+++L +        P ++ +G R +   L G  + DE 
Sbjct: 204 TVLHQRIELRFEKMMAAGFEQEVKALYERGDLHPDLPSIRCVGYRQMWDYLDGHCDQDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+    +D
Sbjct: 264 VFRGICATRQLAKRQITWLRSWKDLTWLDSGDVD 297


>gi|323491081|ref|ZP_08096272.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           brasiliensis LMG 20546]
 gi|323314661|gb|EGA67734.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           brasiliensis LMG 20546]
          Length = 316

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +     ++  +P++VGGT LY++AL   LS +P     IR++I ++   +G   LH +
Sbjct: 86  LKEMNDIVEQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTHGWDKLHSQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 146 LREIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPFRVKQFAIAPKER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  R+ +M+E+G  +E+R+L          P ++ +G R +   L G    DE 
Sbjct: 205 AELHRRIELRYEKMIEAGFEEEMRALYARKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEA 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + +G+ AT + AKRQ TWL       W+   +I+
Sbjct: 265 IFKGVCATRQLAKRQITWLRSWDNLTWLDSENIE 298


>gi|37528401|ref|NP_931746.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|46576900|sp|Q7MAX8|MIAA_PHOLL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|36787839|emb|CAE16954.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) (Isopentenyl-diphosphate:tRNA
           isopentenyltransferase) (IPTase) (IPPT) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 313

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 80/214 (37%), Positives = 122/214 (57%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     IR +I ++  + G   LH +
Sbjct: 89  LKEMAEITASGRIPLLVGGTMLYFKALLEGLSPLPSANPVIRAQIEQQAAEQGWDALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D   A +IHP+D QR++RALE+ L+SG+++ E         +P       I   +R
Sbjct: 149 LQKIDPAAALRIHPNDPQRLSRALEVFLISGKTLTEL-TTLSGESLPYRVHQFAIAPAKR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QMLESG  +E+++L  + +L +DLP ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEARFHQMLESGFEEEVKALYARHDLHVDLPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+  S  +
Sbjct: 268 IYRGICATRQLAKRQITWLRGWKSVHWLDSSQPE 301


>gi|157147860|ref|YP_001455179.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citrobacter
           koseri ATCC BAA-895]
 gi|166198899|sp|A8AMN0|MIAA_CITK8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157085065|gb|ABV14743.1| hypothetical protein CKO_03664 [Citrobacter koseri ATCC BAA-895]
          Length = 316

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/214 (35%), Positives = 118/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     IR +I ++  + G  +LH +
Sbjct: 89  LAEMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSAEPEIRARIEQQAAEQGWDVLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQDIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + ++GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYIEGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     D
Sbjct: 268 VYRGVCATRQLAKRQVTWLRGWEGVRWLDSEKPD 301


>gi|330807230|ref|YP_004351692.1| tRNA isopentenyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375338|gb|AEA66688.1| tRNA isopentenyltransferase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 323

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R +I E+  + G   LH++
Sbjct: 84  LQAMAEITARGRIPLLVGGTMLYYKALVDGLADMPAADPEVRAQIEEEAARLGWQALHEQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPN----------PFIPLES 111
           L+ +D   A +IHP+D QR++RALE+  VSGQS+    ++               +P   
Sbjct: 144 LAIIDPESAARIHPNDPQRLSRALEVYRVSGQSMTALRQRQSAQSTEAAASGLQQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A+  I    R  L  RI +RFT MLE G +DE+ +L +  +L   LP ++A+G R +   
Sbjct: 204 ANLAIAPANRQVLHRRIEQRFTLMLEQGFVDEVVALRERSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWTDLHWLDSLDCDNL 309


>gi|161501829|ref|NP_760221.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus CMCP6]
 gi|320155086|ref|YP_004187465.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus MO6-24/O]
 gi|31340222|sp|Q8CWK9|MIAA_VIBVU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|319930398|gb|ADV85262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus MO6-24/O]
 gi|319999186|gb|AAO09748.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus CMCP6]
          Length = 315

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LAAMNEIVAQGKIPLLVGGTMLYFKALLEGLSPLPAANAEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I   ER
Sbjct: 145 LQEIDPVSAARIHPNDPQRLSRALEVYRISGKTLTEL-TETKGESLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G   E+R+L          P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFDKMMEAGFEQEMRALYTRKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDNLTWLDSENIE 297


>gi|212709952|ref|ZP_03318080.1| hypothetical protein PROVALCAL_01003 [Providencia alcalifaciens DSM
           30120]
 gi|212687361|gb|EEB46889.1| hypothetical protein PROVALCAL_01003 [Providencia alcalifaciens DSM
           30120]
          Length = 313

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 75/208 (36%), Positives = 116/208 (55%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   LS +P     +RE I +  +++G   +H  L+ +D
Sbjct: 94  EITSQGKIPLLVGGTMLYFKALLEGLSPLPSASPEVRETIEQIAQEHGWAEVHRRLADVD 153

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IHP+D QR++RALE+ L+SGQS+ E   Q     +P       I   +R  L E
Sbjct: 154 PVSAARIHPNDPQRLSRALEVYLISGQSLTEM-TQTAGTELPYNVFQFAIEPQDRKILHE 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML++G  DE+++L +        P ++ +G R + + L GEI+YDE + RGI
Sbjct: 213 RIEQRFRLMLDAGFEDEVKALYQRGDLHVDLPSIRCVGYRQMWSYLDGEIDYDEMVYRGI 272

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
            AT + AKRQ TWL        +     
Sbjct: 273 CATRQLAKRQITWLRSWDNVHRLDSEQP 300


>gi|238795252|ref|ZP_04638835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           intermedia ATCC 29909]
 gi|238725420|gb|EEQ16991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           intermedia ATCC 29909]
          Length = 298

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/213 (33%), Positives = 113/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +
Sbjct: 74  LKEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPPADPQVRQRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 134 LTEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TKVSGETLPYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R+L          P ++ +G R + + L GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLDAGFETEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWSSVQWLDSDKP 285


>gi|90416480|ref|ZP_01224411.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2207]
 gi|90331679|gb|EAS46907.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2207]
          Length = 317

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/212 (30%), Positives = 111/212 (52%), Gaps = 3/212 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   LS MP     IR +I E  + +G   +H++L ++D
Sbjct: 79  EITSRGKIPLLVGGTMLYFKALLEGLSDMPSADADIRAEILEHAEAFGWASVHEQLRAVD 138

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPN--PFIPLESAHKIIILPERSAL 124
              A  +HP+  QRI RALE+  +SG  +     +                ++   R  +
Sbjct: 139 PESAASLHPNHSQRIQRALEVYRISGVPMSVLRSEPNVGGVAESYGIKQIALLPNNRKLI 198

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQR 183
             RI+ RF +M+  G   E+R+L +     +  P ++++G R +   ++G  + DE +++
Sbjct: 199 HNRIKVRFGKMMADGFEAEVRALFQRGDLHEDLPAIRSVGYRQLWQHMQGHCSLDEAVEK 258

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           GIIAT + AKRQ TWL +   +  I+I +  +
Sbjct: 259 GIIATRQLAKRQITWLRNWPSSSEIQIDNETE 290


>gi|261345216|ref|ZP_05972860.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rustigianii DSM 4541]
 gi|282566911|gb|EFB72446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Providencia
           rustigianii DSM 4541]
          Length = 313

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 78/213 (36%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   LS +P     IRE I +   + G   +H  
Sbjct: 89  LNAMDEITSQGKIPLLVGGTMLYFKALLEGLSPLPSASPEIRETIEQIAHEQGWGEIHRR 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+ L+SGQ++ E   Q     +P       I   +R
Sbjct: 149 LAEVDPVAAARIHPNDPQRLSRALEVYLISGQTLTEM-TQTAGTELPYNVFQFAIEPQDR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI RRF  MLE+G  +E+R+L +        P ++ +G R + + L GEI+YDE 
Sbjct: 208 KILHERIERRFHLMLEAGFENEVRALYQRGDLHVDLPSIRCVGYRQMWSYLDGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL        +     
Sbjct: 268 VYRGICATRQLAKRQVTWLRGWDNVHRLDSEQP 300


>gi|149192036|ref|ZP_01870263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio shilonii
           AK1]
 gi|148834137|gb|EDL51147.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio shilonii
           AK1]
          Length = 315

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/215 (34%), Positives = 126/215 (58%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  + + +  +P++VGGT LYF+AL   LS +P     IR++I ++  + G   LH+E
Sbjct: 85  LNEIAKIHAEGKIPLLVGGTMLYFKALLQGLSPLPAANPEIRKQIEQEATEKGWQALHNE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D + A +IHP+D QR++RALE+  +SG+S+ E   +     +P       +   +R
Sbjct: 145 LRAIDPVSAERIHPNDPQRLSRALEVYRISGKSLTEL-TETKGEPLPFRVKQFAVAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +M+++G  DE+++L  + +L  DLP ++ +G R +   L GE   D+ 
Sbjct: 204 ALLHKRIELRFEKMIQAGFEDEVKALYAREDLHPDLPSIRCVGYRQMWEYLDGESTLDDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+    ++D
Sbjct: 264 IFRGICATRQLAKRQITWLRSWDDLVWLDSEHVED 298


>gi|332083168|gb|EGI88399.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shigella boydii
           5216-82]
          Length = 301

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 74  LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 134 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML SG   E+R+L          P ++ +G R + + L+GEI+YDE 
Sbjct: 193 ELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+  T + AKRQ TWL       W+     +
Sbjct: 253 VYRGVCTTRQLAKRQITWLRGWEGVHWLDSEKPE 286


>gi|157373935|ref|YP_001472535.1| tRNA isopentenyltransferase [Shewanella sediminis HAW-EB3]
 gi|239977122|sp|A8FRD4|MIAA1_SHESH RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|157316309|gb|ABV35407.1| tRNA isopentenyltransferase [Shewanella sediminis HAW-EB3]
          Length = 303

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/209 (37%), Positives = 119/209 (56%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q  K    P++VGGT +YF+AL   LS +P    A+R +I  + +Q G   +HDE
Sbjct: 81  LHEIEQILKAGKTPLLVGGTMMYFKALLEGLSPLPAADEALRAQIILEAEQRGWQDMHDE 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD + + +IHP+D QR+ RALE+  +SG+S+ E   Q  +  +P +     I   +R
Sbjct: 141 LKRLDPVSSERIHPNDPQRLIRALEVCRISGKSMTEL-SQIKSEPLPYDVVQFAISPKDR 199

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G +DE+R+L K  +L+L LP M+ +G R     L GE +YD  
Sbjct: 200 KVLHISIEERFKLMLNQGFVDEVRALKKRSDLNLALPSMRCVGYRQCWQYLDGEFDYDTM 259

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           +++ I+AT + AKRQ TWL    + +W+ 
Sbjct: 260 VEKAIVATRQLAKRQLTWLRGWPELNWLE 288


>gi|117618481|ref|YP_855466.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|239977181|sp|A0KGS0|MIAA_AERHH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117559888|gb|ABK36836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 305

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 76/216 (35%), Positives = 116/216 (53%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +  ++  +P++VGGT LYF+AL   LS +P     IR  I E+  + G   LHDE
Sbjct: 81  LREMKEIAERGRIPLLVGGTMLYFKALLEGLSPLPSADPVIRAGIEEEAARLGWQALHDE 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 141 LVRIDPVAGARIHPNDPQRLSRALEVYRISGKTLTEL-TQVQGEGLPYRVLQFAIAPSDR 199

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +ML+ G   E+R+L +        P ++ +G R +   L GE+ YDE 
Sbjct: 200 AVLHQRIELRFDKMLQGGFEQEVRALYQRGDLTPDLPSIRCVGYRQMWDYLAGEVEYDEM 259

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             RGI+AT + AKRQ TWL       W+      +L
Sbjct: 260 RYRGIVATRQLAKRQMTWLRGWSDVTWLESGESGNL 295


>gi|89075986|ref|ZP_01162358.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           sp. SKA34]
 gi|89048335|gb|EAR53914.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           sp. SKA34]
          Length = 312

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 114/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R  I     ++G  +LHDE
Sbjct: 86  LKEMADIVAAGRIPLLVGGTMLYYKALLEGLSPLPAADLEVRAGIERDATEHGLQVLHDE 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P +     I   +R
Sbjct: 146 LVRIDPVAGARIHPNDPQRLSRALEVFRISGKTLTEL-TKTQGESLPYKVHQFAITPMDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI  RF +M+E+G   E+R+L +        P ++ +G R +   L G  + DE 
Sbjct: 205 AVLHQRIELRFNKMIEAGFEQEVRALHERGDLHLELPSIRCVGYRQMWEYLDGNYDLDEA 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+  S +D
Sbjct: 265 VFRGICATRQLAKRQITWLRGWKDLTWLDSSDVD 298


>gi|54310431|ref|YP_131451.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Photobacterium
           profundum SS9]
 gi|61214123|sp|Q6LM29|MIAA_PHOPR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|46914872|emb|CAG21649.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Photobacterium profundum SS9]
          Length = 311

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 69/214 (32%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     +R  I  + ++ G H LH+E
Sbjct: 85  LKEMADIVAEGRIPLLVGGTMLYYKALLEGLSPLPASDPDVRAGIEREAQEKGWHFLHEE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +IHP+D QR++RALE+  +SG+++ E   +     +P       I   +R
Sbjct: 145 LVRIDPVSGARIHPNDPQRLSRALEVFRISGKTLTEL-TKIQGEPLPYRVHQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E+G   E+R+L +        P ++ +G R +   L G  + DE 
Sbjct: 204 AVLHQRIEQRFEKMIEAGFEQEVRALYQRGDLHPDLPSIRCVGYRQMWDYLGGNCDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+  +  D
Sbjct: 264 VFRGVCATRQLAKRQITWLRGWKDLTWLDSNDGD 297


>gi|217974861|ref|YP_002359612.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS223]
 gi|239977451|sp|B8ECA4|MIAA_SHEB2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|217499996|gb|ACK48189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           baltica OS223]
          Length = 308

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 71/203 (34%), Positives = 110/203 (54%), Gaps = 2/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
                  P++VGGT +YF+AL   LS +P    AIR +I+ +  + G   LHD+L  +D 
Sbjct: 92  IVSMGKTPVLVGGTMMYFKALLEGLSPLPSADEAIRAEIQAEADEKGWEALHDQLREIDP 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A +IHP+D QR++RALE+  +SG+S+ E   Q  +  +P E     I   ER  L + 
Sbjct: 152 VSAERIHPNDPQRLSRALEVYRISGKSMTEL-TQTKSAPLPYEVVQFAIAPRERKVLHDL 210

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML+ G ++E+  L          P M+ +G R     L GE +YD  +++ + 
Sbjct: 211 IAQRFAIMLKQGFLEEVTELKARGDLHLDLPSMRCVGYRQCWQYLDGEFDYDTMVEKAVA 270

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
           AT + AKRQ TWL    + +W+ 
Sbjct: 271 ATRQLAKRQLTWLRSWPELNWLE 293


>gi|163759000|ref|ZP_02166086.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hoeflea
           phototrophica DFL-43]
 gi|162283404|gb|EDQ33689.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Hoeflea
           phototrophica DFL-43]
          Length = 302

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 88/204 (43%), Positives = 125/204 (61%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +R +P++VGGTGLY RALTG LS MP IP  IR+ +R +L+  G   LH EL+ LD
Sbjct: 97  DIRARRAIPVVVGGTGLYLRALTGGLSDMPSIPVEIRDPLRARLEDEGIEPLHAELARLD 156

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
             +A ++ P+D QR+ RALE+   +GQSI  F  +     +    A  I++ P+R  L  
Sbjct: 157 PQMAERLRPADRQRVLRALEVVKATGQSISSFQGRGGPMIVDPSRARCIVLEPDRPVLHA 216

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  RF +M+E GA+DE+R L+ +N+    P MKAIGV  + A ++G  + DE ++R   
Sbjct: 217 RINARFAKMVEQGALDEVRELISLNIPPQHPAMKAIGVAPLAAHIEGRTSLDEAIERSSA 276

Query: 187 ATNKYAKRQKTWLCHQFQADWIRI 210
           AT +YAKRQ TW  +Q  A W R+
Sbjct: 277 ATRQYAKRQMTWFRNQLDASWQRL 300


>gi|88858903|ref|ZP_01133544.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas tunicata D2]
 gi|88819129|gb|EAR28943.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudoalteromonas tunicata D2]
          Length = 306

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/216 (33%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    Q +++  +P++VGGT +YF+AL   +S +PE   AIR+++  + + YG   LH E
Sbjct: 83  LEHITQLHQQGKIPVLVGGTMMYFKALLEGISPLPEADAAIRQQLEAEAQMYGWPHLHQE 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D     +I  +D QRI RALE+  ++G+++ E   +  +  +P       I   +R
Sbjct: 143 LAKVDPEAGLRIKANDSQRINRALEVYRLTGKTMTELQ-KVKSEPLPFNVLQFAIAPSDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           S L +RI +RF  MLE G   E+++L + +      P ++ +G R +   L G + YDE 
Sbjct: 202 SVLHQRIEKRFKIMLEQGFETEVKALYQRDDLHPALPSIRCVGYRQMWDYLDGLVEYDEM 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RGI AT + AKRQ TWL       W+   + ++L
Sbjct: 262 VFRGIAATRQLAKRQLTWLRSWPDVTWLESGAEENL 297


>gi|242279876|ref|YP_002992005.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           salexigens DSM 2638]
 gi|259495764|sp|C6BXG0|MIAA_DESAD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|242122770|gb|ACS80466.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           salexigens DSM 2638]
          Length = 306

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/215 (30%), Positives = 112/215 (52%), Gaps = 2/215 (0%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           +  +++   +   LP++VGGTG+Y ++L   L+ +P+IP  IRE+IR++ ++ G   L+ 
Sbjct: 83  LAKERIDAAEAGELPVLVGGTGMYLQSLISGLAPIPDIPDEIRERIRKRSEEEGGPALYA 142

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
           EL  +D    ++ HP++ QR ARALE+   +G+    +  +         +  KI I  +
Sbjct: 143 ELEKVDPEYCKRTHPNNRQRNARALEVYEATGKPFSWWHNRE--VPPSPYNFLKIGIKVD 200

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
              L   ++ R  +MLE+GA++E R   +     + P    IG  +++  +KGEI+ DET
Sbjct: 201 LDELTPLLKLRIEKMLEAGAVEEARKAWENCPDENAPGWTGIGCIELMRYIKGEIDLDET 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           ++     T  YAKRQ TW   +    W      D 
Sbjct: 261 IRLWAKNTRAYAKRQLTWFKREKDIHWFAPHEYDK 295


>gi|238764691|ref|ZP_04625635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           kristensenii ATCC 33638]
 gi|238697087|gb|EEP89860.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           kristensenii ATCC 33638]
          Length = 298

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     +R++I ++    G   LH +
Sbjct: 74  LKEMAEITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAALLGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 134 LAEIDPIAAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R+L        D+P ++ +G R + + L GEI+YD+ 
Sbjct: 193 ELLHQRIELRFRQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDDM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 253 VYRGICATRQLAKRQMTWLRGWSSVQWLDSDKP 285


>gi|253690083|ref|YP_003019273.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259495770|sp|C6DFJ8|MIAA_PECCP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|251756661|gb|ACT14737.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 313

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 78/215 (36%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +
Sbjct: 89  LREMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPPADAAVRQRIEEQAKEVGWEAMHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P +     I    R
Sbjct: 149 LSEIDPVAAIRIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGDALPYQVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML +    E R L  + +L  D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLAADFEREARLLFARQDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+      +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWDDVCWLDSEKPTE 302


>gi|227326200|ref|ZP_03830224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 313

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 80/215 (37%), Positives = 121/215 (56%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +
Sbjct: 89  LREMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADLAVRQRIEEQAKEIGWEAMHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P +     I    R
Sbjct: 149 LSEIDPVAAIRIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGDALPYQVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF QML +G   E R+L  + +L  D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHERIEQRFHQMLAAGFETEARTLFARHDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+      +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWDDVCWLDSEKPTE 302


>gi|148981050|ref|ZP_01816270.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrionales
           bacterium SWAT-3]
 gi|145961026|gb|EDK26349.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrionales
           bacterium SWAT-3]
          Length = 310

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 120/214 (56%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+
Sbjct: 85  LKEMNEIVAQGKIPLLVGGTMLYYKALLEGLSPLPAADPEIRKQIEAESIEQGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LREIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF +M+E+G  +E+++L  + +L  +LP ++ +G R +   L G  + DE 
Sbjct: 204 KELHRRIELRFEKMIEAGFEEEMKALYAREDLHPELPSIRCVGYRQMWDYLDGNCDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +ID
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSENID 297


>gi|6225673|sp|O30762|MIAA_PSEPU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|2353324|gb|AAB69443.1| tRNA:isopentenyladenine transferase [Pseudomonas putida]
          Length = 322

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 123/226 (54%), Gaps = 12/226 (5%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP    A+R ++  + +  G   LH +
Sbjct: 84  LEAMAEITARGKIPLLVGGTMLYYKALIDGLADMP-ADAAVRAELERQAEALGLAELHRQ 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 143 LAEVDPESAARIHPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTV 202

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   
Sbjct: 203 ASLAIAPTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 262

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL    +  W+   + D+L
Sbjct: 263 LDGKLTENEMRERGIIATRQLAKRQFTWLRGWPEVHWLDSLACDNL 308


>gi|119474823|ref|ZP_01615176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2143]
 gi|119451026|gb|EAW32259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2143]
          Length = 343

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 110/209 (52%), Gaps = 7/209 (3%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   ++  P +   IR +I  +  ++G   LH +L+ +D
Sbjct: 97  EISARGNIPLLVGGTMLYFKALLEGIAKTPAVEPEIRRQIEREALEFGWPFLHSQLALVD 156

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPN------PFIPLESAHKIIILPE 120
              A +IHP+  QRI RAL +   SG ++ EF ++            P +     I   +
Sbjct: 157 CESAARIHPNHSQRIERALAVYRSSGTTLTEFHRRQQEGKQSSSDDCPYDVVQLAIAPAD 216

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF  M+E   IDE+ SL       +  P M+A+G R +   L GE+ ++E
Sbjct: 217 RKVLHRRIEKRFHSMIEHEFIDEVISLRAEYSLHEDLPSMRAVGYRQVWQYLAGELGHEE 276

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWI 208
            ++RGIIAT + AKRQ TWL       W+
Sbjct: 277 MIERGIIATRQLAKRQFTWLNGWKDVHWL 305


>gi|94500523|ref|ZP_01307054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanobacter
           sp. RED65]
 gi|94427313|gb|EAT12292.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanobacter
           sp. RED65]
          Length = 318

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 69/208 (33%), Positives = 114/208 (54%), Gaps = 1/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               K  +P++VGGT LYF+ L    + +P     +R  I E + ++G   +HD L  +D
Sbjct: 93  DITAKGKIPVLVGGTMLYFKFLMEGSADLPNADEKVRAHIEELVVKHGKQYIHDLLKEVD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A++++P+D QR+ RA E+ L++G+++ + W +  NP    +     I   +R  L E
Sbjct: 153 PESAQRLNPNDPQRVQRAYEVYLITGKTLTQHWAEQENPESEYDWLQFAIAPTDRKDLHE 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF QM+E G  +E+R+L          P ++A+G R +   ++G+I++DE ++RGI
Sbjct: 213 RIALRFQQMVEQGFEEEVRALYARGDLNPDLPSIRAVGYRQMWDFIEGKISHDEMIERGI 272

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
           IAT + AKRQ TWL       W+     
Sbjct: 273 IATRQLAKRQLTWLRGWQDIHWLDTFDP 300


>gi|260752432|ref|YP_003225325.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|258551795|gb|ACV74741.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
          Length = 312

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 119/217 (54%), Gaps = 7/217 (3%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K++   ++   LPI+VGGTGLY R L   ++ +P+I   +RE++R           +
Sbjct: 87  LAKKEIKNAHESGRLPILVGGTGLYIRTLLEGIAPIPDIDPELREEVRSM----SVEEAY 142

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L   D + A ++ P+D  RI RALE+   +G  +  + ++              +I+P
Sbjct: 143 SALQQEDPMAADRLRPADKTRIMRALEVMRSTGHPLHYWQQKKTGGIANEIKLQSFVIIP 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+ R  +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+   
Sbjct: 203 PANILRSRCDKRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLT 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +++   AT +YAKRQ+TW  HQ    WI+I   DD+
Sbjct: 263 MIEKAKAATRQYAKRQRTWFRHQTDESWIKI--FDDI 297


>gi|148263828|ref|YP_001230534.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           uraniireducens Rf4]
 gi|239977128|sp|A5GEV6|MIAA2_GEOUR RecName: Full=tRNA dimethylallyltransferase 2; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 2; Short=DMAPP:tRNA
           dimethylallyltransferase 2; Short=DMATase 2; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           2; Short=IPP transferase 2; Short=IPPT 2; Short=IPTase 2
 gi|146397328|gb|ABQ25961.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           uraniireducens Rf4]
          Length = 310

 Score =  168 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 68/208 (32%), Positives = 101/208 (48%), Gaps = 1/208 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
            +     + +     +VGGTGLY RAL   L   P    +IR ++ E  +  G+  L   
Sbjct: 87  AAAIDDIHSRGKSVFVVGGTGLYIRALLQGLVDSPSGDESIRRELVELAQTVGNEELLRR 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D   A ++HP+D  RI RALE+   +G+ I  F  +            KI +  ER
Sbjct: 147 LALVDPETAERLHPNDRLRIIRALEVYRQTGRPISTFRSEHGFADT-YYDCLKIGLRVER 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L  R+  R   M+E G I E+  L++   + DL  M++IG ++I A L GE   DE +
Sbjct: 206 QELYRRVESRVEVMIEQGLIAEVEGLLRAGYTPDLKSMRSIGYKEICAYLAGECTLDEAV 265

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIR 209
           Q     T  YAKRQ TW    F+ +W+ 
Sbjct: 266 QLIKRDTRHYAKRQMTWFNKDFEINWVE 293


>gi|238787538|ref|ZP_04631336.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           frederiksenii ATCC 33641]
 gi|238724325|gb|EEQ15967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           frederiksenii ATCC 33641]
          Length = 298

 Score =  168 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LYF+AL   LS +P     +RE+I ++  + G   LH +
Sbjct: 74  LKEMAEITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRERIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+ L+SG+++ E   +     +        I    R
Sbjct: 134 LAEIDPVAAARIHPNDPQRLSRALEVFLISGKTLTEL-TKISGETLAYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R+L        D+P ++ +G R + + L GEI+Y+E 
Sbjct: 193 ELLHQRIELRFHQMLDAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYNEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 253 VYRGICATRQLAKRQMTWLRGWGSVQWLDSDKP 285


>gi|238797609|ref|ZP_04641106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           mollaretii ATCC 43969]
 gi|238718606|gb|EEQ10425.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           mollaretii ATCC 43969]
          Length = 298

 Score =  168 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 72/213 (33%), Positives = 112/213 (52%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I E+  + G   LH +
Sbjct: 74  LKEMADITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEEQAAEQGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 134 LADIDPVSAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML +G   E R+L          P ++ +G R + + L GEI+Y+E 
Sbjct: 193 ELLHQRIELRFHQMLAAGFEAEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWSSVQWLDSDKP 285


>gi|157368677|ref|YP_001476666.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Serratia
           proteamaculans 568]
 gi|167011780|sp|A8G8U8|MIAA_SERP5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157320441|gb|ABV39538.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Serratia
           proteamaculans 568]
          Length = 313

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/213 (34%), Positives = 113/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P    A+RE+I ++  + G  +LH +
Sbjct: 89  LKEMAAITAAGRIPLLVGGTMLYFKALLEGLSPLPPADPAVRERIEQQAAEQGWDVLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 149 LQEIDPVAALRIHPNDPQRLSRALEVFFISGKTLTEL-TKISGESLPYHVHQFAIAPTSR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             + +RI  R+ QML +G   E R+L          P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELIHQRIELRYHQMLAAGFETEARALFARGDLHTDLPSIRCVGYRQMWSYLSGEISYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWDSVHWLDSEKP 300


>gi|260774635|ref|ZP_05883542.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260609425|gb|EEX35570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 315

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHD+
Sbjct: 85  LNEMHKIVEQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTLGWEVLHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LKEIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G   E+R L   +      P ++ +G R +   L G    D+ 
Sbjct: 204 AELHRRIELRFDKMMEAGFEQEMRELYARDDLNPDLPSIRCVGYRQMWDYLDGNCTLDDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + +GI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IFKGICATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|70734069|ref|YP_257709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf-5]
 gi|123658372|sp|Q4KJ74|MIAA_PSEF5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|68348368|gb|AAY95974.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens Pf-5]
          Length = 323

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+       +  +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+
Sbjct: 84  LAAMADITARGKIPLLVGGTMLYYKALLEGLADMPAADPQVRAELEEEAARLGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+++D   A +IHP+D QR+ RALE+  VSG ++    ++               +P   
Sbjct: 144 LAAVDPESAARIHPNDPQRLTRALEVYRVSGLTMTAHRQRQLAQSTEAGASGRSQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A+  I    R  L +RI +RFTQMLE G IDE+ +L    +L   LP ++A+G R +   
Sbjct: 204 ANLAIAPANRQVLHQRIAQRFTQMLEQGFIDEVVALRSRSDLHAGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWADLQWLDSLDCDNL 309


>gi|261823152|ref|YP_003261258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           wasabiae WPP163]
 gi|261607165|gb|ACX89651.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pectobacterium
           wasabiae WPP163]
          Length = 313

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 78/215 (36%), Positives = 119/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P    A+R++I E+ K+ G   +H +
Sbjct: 89  LREMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADAAVRQRIEEQAKEVGWEAMHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P +     I    R
Sbjct: 149 LSEIDPVAAIRIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGDALPYQVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF QML +G   E R    + +L  D+P ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQMLAAGFETEARILFTRQDLHTDMPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+      +
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWDDVCWLDSEKPTE 302


>gi|150397212|ref|YP_001327679.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           medicae WSM419]
 gi|239977459|sp|A6UB14|MIAA_SINMW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150028727|gb|ABR60844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           medicae WSM419]
          Length = 305

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 94/205 (45%), Positives = 136/205 (66%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P+ VGGTGLYF+ALTG LS MPE+P AIR+++R++L + G+  LH ELS+LD   A+
Sbjct: 97  GRMPVFVGGTGLYFKALTGGLSDMPEVPHAIRQRLRKRLMEEGAEALHYELSALDPETAQ 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           ++   DGQRI RALE+   +G+ I  + +      I    A KI++LPER  L  RI RR
Sbjct: 157 RVRSGDGQRIVRALEVMEATGRPIGFYQQSRGPVIIDATRARKIVVLPERPVLHSRINRR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML  GA++E+R+L+ ++L L++P MKAIGV+ I A+LKGE++  + ++ G   T +Y
Sbjct: 217 FEAMLGMGAVEEVRALLALDLPLEMPAMKAIGVQQIAAMLKGEMSEAQAIEAGAAQTRQY 276

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TW  +Q    W RI + + L
Sbjct: 277 AKRQMTWFRNQLDETWQRIDAAEAL 301


>gi|37681256|ref|NP_935865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus YJ016]
 gi|46576896|sp|Q7M7I8|MIAA_VIBVY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|37200007|dbj|BAC95836.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           vulnificus YJ016]
          Length = 315

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYF+AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LAAMNEIVVQGKIPLLVGGTMLYFKALLEGLSPLPAANAEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I   ER
Sbjct: 145 LQEIDPVSAARIHPNDPQRLSRALEVYRISGKTLTEL-TETKGESLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G   E+R+L          P ++ +G R +   L G    DE 
Sbjct: 204 AELHRRIELRFDKMMEAGFEQEMRALYTRKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 IYRGICATRQLAKRQITWLRSWDNLTWLDSENIE 297


>gi|317493568|ref|ZP_07951989.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918511|gb|EFV39849.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 316

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/213 (35%), Positives = 114/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LYF+AL   LS +P     IRE+I ++ ++ G   LH +
Sbjct: 89  LREMASITAEGKIPLLVGGTMLYFKALLEGLSPLPAANPQIREQIEKQAQELGWDALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+ L+SG+++ E   +     +P       I    R
Sbjct: 149 LQQVDPVAAARIHPNDPQRLSRALEVFLISGKTLTEL-TKISGETLPYNVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QM+ SG   E R L +        P ++ +G R + +  +GEI+YDE 
Sbjct: 208 EQLHQRIALRFEQMMASGFEAEARKLFERGDLHTDLPSVRCVGYRQMWSYFEGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWESVQWLDSDKP 300


>gi|238750070|ref|ZP_04611573.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia rohdei
           ATCC 43380]
 gi|238711614|gb|EEQ03829.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia rohdei
           ATCC 43380]
          Length = 298

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 115/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +
Sbjct: 74  LKEMADITAAGRIPLLVGGTMLYFKALLDGLSPLPSADAQVRQRIEQQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+ L+SG+++ E   +     +P       I    R
Sbjct: 134 LAEIDPVAAARIHPNDPQRLSRALEVFLISGKTLTEL-TKISGETLPYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML +G   E R+L        D+P ++ +G R + + L GEI+YDE 
Sbjct: 193 ELLHQRIELRFHQMLAAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 253 VYRGVCATRQLAKRQMTWLRGWGSVQWLDSDKP 285


>gi|87122646|ref|ZP_01078523.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MED121]
 gi|86162104|gb|EAQ63392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MED121]
          Length = 296

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 120/215 (55%), Gaps = 2/215 (0%)

Query: 2   LSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
              +++   K+   P++VGGT +YF AL   L+ MP+    +R+ I ++  ++G   LH 
Sbjct: 73  AKNEIEAILKRGNKPLLVGGTMMYFNALIKGLAKMPQANPEVRKDIEKEAAEFGWSHLHQ 132

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
           EL  LD   A++IHP+D QR+ RA+E+  +SG+S+ + W +        + A   ++  E
Sbjct: 133 ELERLDPESAKRIHPNDPQRLQRAIEVCRLSGRSMTDLWAEQQQSAGDYQFASIAVMPEE 192

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDE 179
           RS L +RI++RF  M+E G + E+ +L      ++D+P ++ +G R I A L GE + DE
Sbjct: 193 RSVLHDRIQQRFDIMMEQGFLAEVEALYARGDLNVDMPSVRCVGYRQIWAYLAGECDLDE 252

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
            + RG++AT + AKRQ TWL              D
Sbjct: 253 AIYRGVVATRQLAKRQVTWLRSWENLQVFDTFDKD 287


>gi|229588074|ref|YP_002870193.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens SBW25]
 gi|259495771|sp|C3KDW2|MIAA_PSEFS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229359940|emb|CAY46794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           fluorescens SBW25]
          Length = 323

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 78/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYYKALQEGLADMPAADAQVRAELEEEAARLGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+++D + A +IHP+D QR++RALE+  VSGQ++ E   +               +P   
Sbjct: 144 LAAIDPVSAARIHPNDPQRLSRALEVWRVSGQTMTEHRLKQSAQSADAGASGQSQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I    R  L ERI +RFT MLE G +DE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPANRQVLHERIAQRFTIMLEQGFVDEVVALRSRGDLHPGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWSDLHWLDSLDSDNL 309


>gi|328472282|gb|EGF43152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus 10329]
          Length = 310

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LQAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LKEIDPVSAARIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  DE+++L          P ++ +G R +   L GE   DE 
Sbjct: 204 AELHRRIELRFDKMMEAGFEDEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSDNIE 297


>gi|28899592|ref|NP_799197.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260876667|ref|ZP_05889022.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260896640|ref|ZP_05905136.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260900900|ref|ZP_05909295.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|31340218|sp|Q87L06|MIAA_VIBPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28807828|dbj|BAC61081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308086321|gb|EFO36016.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308093998|gb|EFO43693.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308106502|gb|EFO44042.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus AQ4037]
          Length = 310

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LQAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LKEIDPVSAARIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L GE   DE 
Sbjct: 204 AELHRRIELRFDKMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSDNIE 297


>gi|260774598|ref|ZP_05883510.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           metschnikovii CIP 69.14]
 gi|260610392|gb|EEX35599.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           metschnikovii CIP 69.14]
          Length = 310

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 114/209 (54%), Gaps = 2/209 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              +  +P++VGGT LY++AL   LS +P    A+R++I  + ++ G   LH +L  +D 
Sbjct: 91  IVSEGRIPLLVGGTMLYYKALLDGLSPLPAANPAVRQQIESQAQEQGWAALHAQLQQIDP 150

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           I A +IHP+D QR++RALE+  +SG+++ E   Q     IP       I   +R+ L  R
Sbjct: 151 ISAARIHPNDPQRLSRALEVYKISGKTLTEL-TQTKGESIPFRVKQFAIAPMDRAELHRR 209

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I  RF +M++SG  +E+++L   N      P ++ +G R +     G    DE + RGI 
Sbjct: 210 IELRFEKMVKSGFEEEVKALYDRNDLHPDLPSIRCVGYRQMWDYFDGNSTLDEAIYRGIC 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           AT + AKRQ TWL    +  W+   +I+ 
Sbjct: 270 ATRQLAKRQLTWLRSWDELTWLDSENIER 298


>gi|260893755|ref|YP_003239852.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex
           degensii KC4]
 gi|260865896|gb|ACX53002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex
           degensii KC4]
          Length = 315

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/217 (28%), Positives = 112/217 (51%), Gaps = 5/217 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K ++  + +  LP++VGGT LY RA+        +    +R+++ E+ ++ G+  LH
Sbjct: 82  LARKLIEEIHSRGKLPLLVGGTALYIRAVIDGYIFTVKADKELRQRLLEEAQEKGTTHLH 141

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L ++D   A +IHP D +R+ RALEI   +G+   E  K+ P    P        +  
Sbjct: 142 AQLQAIDPQAAAKIHPRDRKRLVRALEIYYQTGKPPSEVMKKEP----PPYDVLMFGLNL 197

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
            R  L  RI +R   ML +G ++E+R L++  +      M+ +G ++I A L+GEI+ + 
Sbjct: 198 AREELYRRIEQRVDAMLAAGLVEEVRRLLEQGVPPQATSMQGLGYKEIAAYLRGEISLER 257

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +      T ++AKRQ TW  H  +  W+ ++    +
Sbjct: 258 AVYLIKRNTRRFAKRQLTWFRHDPRIRWLDVAQYKGI 294


>gi|254230083|ref|ZP_04923481.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|262393032|ref|YP_003284886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|151937417|gb|EDN56277.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
 gi|262336626|gb|ACY50421.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           Ex25]
          Length = 310

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LKAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LKEVDPVSAARIHPNDPQRLSRALEVFRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L GE   DE 
Sbjct: 204 AELHRRIELRFEKMMEAGFEEEMKALHSRKDLHPDLPSIRCVGYRQMWEYLDGECTRDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|308125317|ref|ZP_05774457.2| tRNA dimethylallyltransferase [Vibrio parahaemolyticus K5030]
 gi|308112917|gb|EFO50457.1| tRNA dimethylallyltransferase [Vibrio parahaemolyticus K5030]
          Length = 304

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 79  LQAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 138

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 139 LKEIDPVSAARIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDR 197

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L GE   DE 
Sbjct: 198 AELHRRIELRFDKMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGECTRDEA 257

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 258 VFRGVCATRQLAKRQITWLRSWDDLTWLDSDNIE 291


>gi|238784775|ref|ZP_04628777.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           bercovieri ATCC 43970]
 gi|238714288|gb|EEQ06298.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           bercovieri ATCC 43970]
          Length = 298

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     IR++I E+  + G   LH +
Sbjct: 74  LQEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPQIRQRIEEQAAELGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 134 LADIDPVSAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGESLPYRVHQFAIAPVSR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QMLE+G   E R+L          P ++ +G R + + L GEI+Y+E 
Sbjct: 193 ELLHQRIELRFHQMLEAGFEAEARALFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 253 VYRGVCATRQLAKRQITWLRGWSSVQWLDSDKP 285


>gi|288940954|ref|YP_003443194.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Allochromatium
           vinosum DSM 180]
 gi|288896326|gb|ADC62162.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Allochromatium
           vinosum DSM 180]
          Length = 332

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/216 (34%), Positives = 118/216 (54%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LYFRAL   L+ +P     +R ++  + ++ G   +H  
Sbjct: 89  LAAMTEISARGRIPLLVGGTMLYFRALQQGLARLPSADAEVRAELEAEAERLGWAAMHAR 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ LD   AR+IHP+D QRI RALE++ +SG+++ +  + A +  +P      +    +R
Sbjct: 149 LAELDPDAARRIHPNDPQRIQRALEVQALSGRAMSDLIRDAEHTALPFRLLKLVRAPGDR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF  MLE G +DE+  L          P M+ +G R ++  L GE  +++ 
Sbjct: 209 AILHARIEHRFRVMLELGLVDEVSRLWARGDLTPDLPSMRCVGYRQVLNYLLGESTWEDM 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +QRGIIAT + AKRQ TWL  +    W+     D L
Sbjct: 269 VQRGIIATRQLAKRQMTWLRAEPDCHWLD-DEPDPL 303


>gi|146305669|ref|YP_001186134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina ymp]
 gi|239977437|sp|A4XPY6|MIAA_PSEMY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|145573870|gb|ABP83402.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina ymp]
          Length = 324

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 116/217 (53%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R ++  +    G   LH EL+ +D   A
Sbjct: 94  RGRIPLLVGGTMLYYKALLEGLADMPSADPVVRAELEARAAVEGWEALHRELAEVDPQSA 153

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI----------PLESAHKIIILPE 120
            +IHP+D QR+ RALE+  VSG S+ E   +                P   A   I   +
Sbjct: 154 ARIHPNDPQRLTRALEVYRVSGMSMSEHRLRQAAGNPEGGTSASGQLPYTVAQLAIAPAQ 213

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L ERI +RF  MLE G ++E+ +L    +L   LP ++A+G R +   L G+++ +E
Sbjct: 214 RQILHERIAQRFQAMLEQGFVEEVEALRSRSDLHAGLPSIRAVGYRQVWEYLDGKLSREE 273

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            ++RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 274 MVERGIIATRQLAKRQFTWLRGWGDLQWLDSLACDNL 310


>gi|156972475|ref|YP_001443382.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           ATCC BAA-1116]
 gi|269961401|ref|ZP_06175765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           1DA3]
 gi|166217000|sp|A7MX77|MIAA_VIBHB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|156524069|gb|ABU69155.1| hypothetical protein VIBHAR_00095 [Vibrio harveyi ATCC BAA-1116]
 gi|269833778|gb|EEZ87873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio harveyi
           1DA3]
          Length = 310

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LQAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LKEIDPVSAARIHPNDPQRLSRALEVFRISGKTLTEL-TQTKGDSLPYRVKQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L G+   DE 
Sbjct: 204 AELHRRIELRFDKMMEAGFEEEMKALYARKDLHPDLPSIRCVGYRQMWEYLDGDCTRDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGICATRQLAKRQITWLRSWNDLTWLDSDNIE 297


>gi|216567|dbj|BAA00643.1| miaA protein [Escherichia coli]
          Length = 216

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 73/202 (36%), Positives = 113/202 (55%), Gaps = 2/202 (0%)

Query: 14  LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQI 73
           +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +I
Sbjct: 1   IPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARI 60

Query: 74  HPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFT 133
           HP+D QR++RALE+  +SG+++ E   Q     +P +     I    R  L +RI +RF 
Sbjct: 61  HPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASRELLHQRIEQRFH 119

Query: 134 QMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
           QML SG   E+R+L          P ++ +G R + + L+GEI+YDE + RG+ AT + A
Sbjct: 120 QMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLA 179

Query: 193 KRQKTWLCHQFQADWIRISSID 214
           KRQ TWL       W+     +
Sbjct: 180 KRQITWLRGWEGVHWLDSEKPE 201


>gi|91227454|ref|ZP_01261818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           alginolyticus 12G01]
 gi|91188604|gb|EAS74895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           alginolyticus 12G01]
          Length = 310

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 115/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L        +  +P++VGGT LY++AL   LS +P     IR++I ++    G  +LHDE
Sbjct: 85  LKAMDDIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTKGWSVLHDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R
Sbjct: 145 LKEVDPVSAARIHPNDPQRLSRALEVFRISGKTLTEL-TQTKGESLPYRVKQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L GE   DE 
Sbjct: 204 AELHRRIELRFEKMMEAGFEEEMKALHSRKDLHPDLPSIRCVGYRQMWEYLDGECTRDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|119502791|ref|ZP_01624876.1| tRNA isopentenyltransferase [marine gamma proteobacterium HTCC2080]
 gi|119461137|gb|EAW42227.1| tRNA isopentenyltransferase [marine gamma proteobacterium HTCC2080]
          Length = 348

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 73/199 (36%), Positives = 106/199 (53%), Gaps = 1/199 (0%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  LPI+VGGT LYFRAL   L  MP     +R+KI       G   LH  L  +D ++A
Sbjct: 86  RGRLPILVGGTMLYFRALLEGLDDMPASDPVVRQKIEADAAAEGWPALHARLQLVDPVLA 145

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
            ++HP+  QRIAR LE+  ++G+ + ++     +  +       +I   ERS L  RI  
Sbjct: 146 ARLHPNHSQRIARGLEVWQMTGKPLSDWQSGKGHGGLGETPISLVICPKERSVLHARIAD 205

Query: 131 RFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
           R  +ML +G +DE+R L      S DLP ++A+G R +   L GE + DE +Q  + AT 
Sbjct: 206 RLDKMLSAGLLDEVRQLWSRGDLSPDLPAIRAVGYRQLWKYLDGEASLDEAVQNVLFATR 265

Query: 190 KYAKRQKTWLCHQFQADWI 208
           + AKRQ TWL       W+
Sbjct: 266 QLAKRQMTWLRRWPADGWL 284


>gi|312958651|ref|ZP_07773171.1| tRNA dimethylallyltransferase [Pseudomonas fluorescens WH6]
 gi|311287194|gb|EFQ65755.1| tRNA dimethylallyltransferase [Pseudomonas fluorescens WH6]
          Length = 323

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT LY++AL   L+ MP     +R ++ E+  + G   LHD+
Sbjct: 84  LAAMAEITARGNIPLLVGGTMLYYKALQEGLADMPAADAQVRAELEEEAARLGWQALHDQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+++D + A +IHP+D QR++RALE+  VSGQ++ E   +               +P   
Sbjct: 144 LAAVDPVSAARIHPNDPQRLSRALEVWRVSGQTMTELRLKQTAQSADAGASGQSQLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIAL 170
           A+  I    R  L ERI +RFT MLE G IDE+ +L          P ++A+G R +   
Sbjct: 204 ANLAIAPANRQVLHERIAQRFTIMLEQGFIDEVVALRSRGDLHTGLPSIRAVGYRQVWDH 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++   E  +RGIIAT + AKRQ TWL       W+     D+L
Sbjct: 264 LDGKLTSAEMQERGIIATRQLAKRQFTWLRSWSDLHWLDSLDSDNL 309


>gi|163749346|ref|ZP_02156595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           benthica KT99]
 gi|161331065|gb|EDQ01991.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           benthica KT99]
          Length = 296

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 78/209 (37%), Positives = 115/209 (55%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +     K    P++VGGT LYF+AL   LS +P     IR +I  + + +G   LHDE
Sbjct: 74  LREIADIVKSGKTPLLVGGTMLYFKALLEGLSPLPAADEVIRAEIAAEAQTHGWQHLHDE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   Q  +P +P E     I   +R
Sbjct: 134 LMRVDPVSAERIHPNDPQRLSRALEVFRISGKSLTEL-TQIKSPPLPYEVIQFAISPKDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G + E+R+L + N     LP M+ +G R     L G+ +Y+  
Sbjct: 193 KVLHLSIEERFKLMLNQGFVAEVRTLRQRNDLHLALPSMRCVGYRQCWQHLDGDYDYNTM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           + +GIIAT + AKRQ TWL    + +W+ 
Sbjct: 253 VDKGIIATRQLAKRQLTWLRGWAELNWLE 281


>gi|269137709|ref|YP_003294409.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda EIB202]
 gi|267983369|gb|ACY83198.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda EIB202]
 gi|304557763|gb|ADM40427.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda FL6-60]
          Length = 317

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 115/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q   +  +P++VGGT LY++AL   LS +P    A+R +I ++ ++ G   LH E
Sbjct: 90  LREMAQISAQGRIPLLVGGTMLYYKALLEGLSPLPPADAAVRARIEQQAREQGWEALHRE 149

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P   +   I    R
Sbjct: 150 LARIDPVAAARIHPNDPQRLSRALEVFFVSGNTLTEL-TRVSGEALPYAVSQFAIAPSSR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QMLE+G   E R L          P ++ +G R + + L GEI+YDE 
Sbjct: 209 ELLHQRIALRFQQMLEAGFEQEARRLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEM 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 269 VYRGVCATRQLAKRQMTWLRGWESVQWLDSDKP 301


>gi|294634452|ref|ZP_06712988.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda ATCC 23685]
 gi|291092162|gb|EFE24723.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Edwardsiella
           tarda ATCC 23685]
          Length = 317

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/213 (34%), Positives = 113/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     +R +I ++ ++ G   LH E
Sbjct: 90  LREMAEITAQGRIPLLVGGTMLYYKALLEGLSPLPPADAGVRARIEQQAREQGWQALHHE 149

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P   +   I    R
Sbjct: 150 LARIDPVAAARIHPNDPQRLSRALEVFFVSGNTLTEL-TRISGEALPYSVSQFAIAPSSR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML +G   E R L          P ++ +G R + + L GEI+YDE 
Sbjct: 209 ELLHQRIALRFQQMLAAGFEQEARKLFARGDLHPDLPSVRCVGYRQMWSYLAGEIDYDEM 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL       W+     
Sbjct: 269 VYRGICATRQLAKRQMTWLRGWESVQWLDSDKP 301


>gi|227822565|ref|YP_002826537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           fredii NGR234]
 gi|227341566|gb|ACP25784.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sinorhizobium
           fredii NGR234]
          Length = 312

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 100/205 (48%), Positives = 134/205 (65%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MP IP  IR+ +RE+L+  G+  LH EL S D   A 
Sbjct: 107 GRLPVFVGGTGLYFKALTGGLSEMPAIPAHIRDALRERLRMEGAAALHAELQSRDPQTAE 166

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           Q+ P DGQRI RALE+   +G+ I  + +      +    A KI++LPER+ L  RI RR
Sbjct: 167 QLGPGDGQRIVRALEVIEATGKPIRVYQQSRGPMIVDPTQARKIVVLPERALLHSRIDRR 226

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML SGA++E+R+L+ + LS D+P+MKAIGV+ I A+L+GE++  E +  G  AT +Y
Sbjct: 227 FETMLASGAVEEVRALLALKLSPDMPVMKAIGVQQIAAMLEGEMSAAEVIATGAAATRQY 286

Query: 192 AKRQKTWLCHQFQADWIRISSIDDL 216
           AKRQ TW  +Q    W RI+  DDL
Sbjct: 287 AKRQMTWFRNQLDDSWQRIAQPDDL 311


>gi|138894831|ref|YP_001125284.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus
           thermodenitrificans NG80-2]
 gi|166198911|sp|A4IMI5|MIAA_GEOTN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|134266344|gb|ABO66539.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus
           thermodenitrificans NG80-2]
          Length = 315

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 63/210 (30%), Positives = 105/210 (50%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
               +  LPIIVGGTGLY +A              A R  +R+   + G+  LH++L ++
Sbjct: 87  DISARGRLPIIVGGTGLYIQAAIYDYRFSDAPSDEAYRRALRQLAAEQGAEALHEQLKAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP++ +R+ RALE+   +G+   E+ +        L     I +  ERS L 
Sbjct: 147 DPESAARIHPNNVRRVIRALEVYHCTGKPFSEWQRGQQRQL--LYETALIGLTAERSVLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+  G I+E+RSL    L     + +AIG +++     G ++ DE +++  
Sbjct: 205 RRINERVDEMIAEGLIEEVRSLYDRGLRDCQAV-QAIGYKELYDYFDGRVSLDEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  +Q   +W  ++  + 
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVEWFDMTDPEK 293


>gi|196248598|ref|ZP_03147299.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           G11MC16]
 gi|196212323|gb|EDY07081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           G11MC16]
          Length = 315

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 104/210 (49%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
               +  LPIIVGGTGLY +A              A R  +R+   + G+  LH++L ++
Sbjct: 87  DISARGRLPIIVGGTGLYIQAAIYDYRFSDAPSDEAYRRALRQLAAEQGAEALHEQLKAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP++ +R+ RALE+   +G+   E+ +        L     I +  ER  L 
Sbjct: 147 DPESAARIHPNNVRRVIRALEVYHCTGKPFSEWQRGQQRQL--LYETALIGLTAERRVLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+  G I+E+RSL    L     + +AIG +++     G ++ DE +++  
Sbjct: 205 RRINERVDEMIAEGLIEEVRSLYDRGLRDCQAV-QAIGYKELYDYFDGRVSLDEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  +Q   +W  ++  + 
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVEWFDMTDPEK 293


>gi|302391925|ref|YP_003827745.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetohalobium
           arabaticum DSM 5501]
 gi|302204002|gb|ADL12680.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetohalobium
           arabaticum DSM 5501]
          Length = 320

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 114/210 (54%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LP++VGGTGLY +AL         E    +R+++  + +++G+  +HD+L  +
Sbjct: 87  EIVERGRLPMLVGGTGLYVKALIQGFIFPEMETDWDLRKQLEAEAEEHGTEYVHDKLKEI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D  +A ++HP+D +R+ R +E+   +G++   F ++A     P   A KI +  +R  L 
Sbjct: 147 DPTLADKLHPNDLRRVIRGIEVYQQTGKTSTHFRQKAKERP-PRYRAVKIGLKRDRDELY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR   M+++G I+E++ L +      L  M+ +G +++I   +GE + +E ++   
Sbjct: 206 ERINRRVDLMIDNGLIEEVKELYEAGYERGLTSMQGLGYKELIGYFEGEYDLEEAIRLIK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             T  +AK+Q TW     +  W  +   +D
Sbjct: 266 RDTRHFAKKQLTWFRKDDEIHWFDVGEYED 295


>gi|222056189|ref|YP_002538551.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter sp.
           FRC-32]
 gi|239977127|sp|B9M3M9|MIAA2_GEOSF RecName: Full=tRNA dimethylallyltransferase 2; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 2; Short=DMAPP:tRNA
           dimethylallyltransferase 2; Short=DMATase 2; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           2; Short=IPP transferase 2; Short=IPPT 2; Short=IPTase 2
 gi|221565478|gb|ACM21450.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter sp.
           FRC-32]
          Length = 326

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 105/203 (51%), Gaps = 1/203 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
             + +     IVGGTGLY RAL   L   P     IR ++ E  K+ G+  L   L+ +D
Sbjct: 91  DIHSRGKRVFIVGGTGLYIRALLQGLVDSPSGDEQIRGELNELAKEIGNEGLLQLLAEVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++H +D  RI RALE+   +G+ + +F ++        +     I   ER  L  
Sbjct: 151 PITAERLHHNDRVRIIRALEVYRQTGRPMSQFRQEHGFAEEMYDCLMLGI-NVERQELYS 209

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           R+ +R  +M+ESG   E+  L ++  + DL  M++IG ++I + L GEI+ D+ +Q    
Sbjct: 210 RVEKRVDEMVESGLAAEVEELFRLGYARDLKAMRSIGYKEICSFLSGEISLDQAVQLIKR 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
            T +YAKRQ TW   ++   W+ 
Sbjct: 270 DTRRYAKRQMTWFNKEYGIKWVE 292


>gi|170723844|ref|YP_001751532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida W619]
 gi|229621759|sp|B1JAD5|MIAA_PSEPW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169761847|gb|ACA75163.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           putida W619]
          Length = 323

 Score =  165 bits (418), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP    A+R  +  + +  G   LH +
Sbjct: 84  LQAMAEITARGKVPLLVGGTMLYYKALIDGLADMPPADAAVRAALEAQAQALGLTELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 144 LAEVDPESAARIHPNDPQRLIRALEVFQVSGESMTAHRQRQFAESSGADAGAGGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G++  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLTENEMRERGIIATRQLAKRQFTWLRGWSDVHWLDSLACDNL 309


>gi|12643932|sp|Q9X5G1|MIAA_ZYMMO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|5834303|gb|AAD53907.1|AF176314_17 IPP-transferase [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 312

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 119/217 (54%), Gaps = 7/217 (3%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K++   ++   LPI+VGGTGLY R L   ++ +P+I   +RE++R           +
Sbjct: 87  LAKKEIKNAHESGRLPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSM----SVEEAY 142

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L   D + A ++ P+D  RI RALE+   +G  +  + ++              +I+P
Sbjct: 143 SALQQEDPMAADRLRPTDKTRIMRALEVMRSTGHPLHYWQQKKTGGIANEIKLQSFVIIP 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+ R  +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+   
Sbjct: 203 PANILRSRCDKRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLT 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +++   AT +YAKRQ+TW  HQ    WI+I   DD+
Sbjct: 263 MIEKAKAATRQYAKRQRTWFRHQTDESWIKI--FDDI 297


>gi|327482308|gb|AEA85618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri DSM 4166]
          Length = 332

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/226 (33%), Positives = 115/226 (50%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +      +P++VGGT LYF+AL   L+ MP    ++R ++       G   LHD 
Sbjct: 93  LAAMAEITAAGRIPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQALHDR 152

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI----------PLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG ++ E   +  +             P   
Sbjct: 153 LAQVDPESAARIHPNDPQRLVRALEVHRVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTV 212

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIAL 170
           A   I   +R  L ERI RRF  M+E G ++E+ +L         +P ++A+G R +   
Sbjct: 213 AQLCIAPAQRHILHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEY 272

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G    +E ++RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 273 LDGSSTREEMVERGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 318


>gi|238918367|ref|YP_002931881.1| tRNA delta(2) -isopentenylpyrophosphate transferase, putative
           [Edwardsiella ictaluri 93-146]
 gi|238867935|gb|ACR67646.1| tRNA delta(2) -isopentenylpyrophosphate transferase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 317

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 116/213 (54%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  Q   +  +P++VGGT LY++AL   LS +P    A+R +I ++  + G  +LH E
Sbjct: 90  LREMAQISAQGRIPLLVGGTMLYYKALLEGLSPLPPADDAVRARIEQQASEQGWEVLHRE 149

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P   +   I    R
Sbjct: 150 LARIDPVAAARIHPNDPQRLSRALEVFFVSGNTLTEL-TRVSGEALPYAVSQFAIAPSRR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QMLE+G   E R L   +      P ++ +G R + + L GEI+YDE 
Sbjct: 209 ELLHQRIALRFQQMLEAGFEQEARRLFARDDLHPDLPSVRCVGYRQMWSYLAGEIDYDEM 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 269 VYRGVCATRQLAKRQMTWLRGWESVQWLDSDKP 301


>gi|329895359|ref|ZP_08270984.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC3088]
 gi|328922372|gb|EGG29716.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC3088]
          Length = 313

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 72/214 (33%), Positives = 107/214 (50%), Gaps = 4/214 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +   PI+VGGT LYF+A    LS MPE    +R  I  +    G   LH +L ++D
Sbjct: 73  DIIARGRTPILVGGTMLYFKAFLEGLSPMPESEPNMRAAIETEADLLGWPALHAQLEAVD 132

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP---LESAHKIIILPERSA 123
            I A  IHP+   RI RALE+  +SG  + ++ +Q+     P      +   +   +R+ 
Sbjct: 133 PITAANIHPNHSSRITRALEVYRLSGTPLSQWQQQSQERVAPTQQYCVSQFALAPFDRAV 192

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L ERI RRF  ML+ G I+E+++L          P ++A+G R +   L GE +    + 
Sbjct: 193 LHERIERRFELMLDQGFIEEVKALRARGDLHADLPAIRAVGYRQVWQYLGGEFDLQACID 252

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           RG+ AT + AKRQ TWL       WI   +  +L
Sbjct: 253 RGVAATRQLAKRQLTWLRKWPNLFWIYTDAHGNL 286


>gi|312882817|ref|ZP_07742550.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369509|gb|EFP97028.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 318

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 72/217 (33%), Positives = 120/217 (55%), Gaps = 2/217 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           LS+      +  +P++VGGT LY++AL   LS +P     IR++I ++    G   +HD 
Sbjct: 86  LSEMHNIVAQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQQALTLGWDTMHDR 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A++IHP+D QR++RALE+  ++G+++ E   Q     +P       I   ER
Sbjct: 146 LKEVDPVAAQRIHPNDPQRLSRALEVYQITGKTLTEL-TQTKGDSLPFNVRQFAIAPTER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L  RI +RF  M+E+G   E+R L  + +L  DLP ++ +G R +   L G   +++ 
Sbjct: 205 AELHRRIEQRFNNMIEAGFEQEVRRLYAREDLHSDLPSIRCVGYRQMWEYLDGSSTFEDA 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           + +G+ AT + AKRQ TWL       W+   +I+  F
Sbjct: 265 VFKGVCATRQLAKRQITWLRSWDNLTWLDSENIEQAF 301


>gi|295091883|emb|CBK77990.1| tRNA isopentenyltransferase (miaA) [Clostridium cf. saccharolyticum
           K10]
          Length = 343

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/215 (30%), Positives = 113/215 (52%), Gaps = 3/215 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K ++  Y +  +PI+ GGTG Y +AL   +     +  T IR ++ +  ++ G   L
Sbjct: 82  MAKKAMEEIYSRGHIPIVAGGTGFYIQALLYDIDFTETDESTEIRRELEQTAREKGPRAL 141

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L  +D   A  IH ++ +R+ RA+E    +G+ I E  ++    F P E  + +I L
Sbjct: 142 HELLREVDPESADAIHENNVKRVIRAIEFYRQTGRKISEHNREERQKFSPYEFLYYVIDL 201

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
           P R  L  RI  R ++MLE+G ++E+++L  M  + D+  M+ +G ++I+  L GE + D
Sbjct: 202 P-RPVLYSRIDERVSRMLEAGLVEEVKTLRDMGYTRDMVSMQGLGYKEILDYLNGECSLD 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E +      T  +AKRQ TW   +    W+ + + 
Sbjct: 261 EAVYIIKRDTRHFAKRQITWFKRERDVRWLNLEAF 295


>gi|290473400|ref|YP_003466266.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus bovienii SS-2004]
 gi|289172699|emb|CBJ79470.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Xenorhabdus bovienii SS-2004]
          Length = 298

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 76/214 (35%), Positives = 118/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     IR +I ++  ++G   LH +
Sbjct: 74  LKEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSSNLEIRAQIEQQAAKHGWEALHRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +DS+ A +IHP+D QR+ RALE+  +SG+++     +     +P       I    R
Sbjct: 134 LQEIDSVAAARIHPNDPQRLTRALEVFRISGKTLTAL-TEMSGEILPYRVHQFAIAPASR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QM++SG  DE+++L    +L  DLP ++ +G R + + L GEI++DE 
Sbjct: 193 EILHQRIAARFEQMIKSGFEDEVKALYARSDLHTDLPSIRCVGYRQMWSYLSGEISHDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+     +
Sbjct: 253 VYRGICATRQLAKRQITWLRGWDNVTWLDSDQPE 286


>gi|85710757|ref|ZP_01041818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           baltica OS145]
 gi|85695161|gb|EAQ33098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Idiomarina
           baltica OS145]
          Length = 318

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 74/217 (34%), Positives = 113/217 (52%), Gaps = 5/217 (2%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           ++ K      +   PI+VGGT LYF+AL   +S +PE  T +R++++ +L  +G   LH 
Sbjct: 88  LIEK---ILARGHTPILVGGTMLYFKALLEGMSALPESDTNVRQQLQFELDTHGLATLHQ 144

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
            L+ +D   A +IHP+D QR  RALE+  +S +  +    Q     +        +   +
Sbjct: 145 RLAEVDPEAAARIHPNDPQRTLRALEVYQLSAKP-MTQLVQQRRGALNYPIYQFAVAPQQ 203

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDE 179
           R+ L ERI +RF QML  G   E+ +L K N      P ++++G R +   L GE+ Y  
Sbjct: 204 RALLHERIAQRFDQMLAEGFQQEVEALFKRNDLHPDLPAIRSVGYRQMWHYLTGELTYQA 263

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D L
Sbjct: 264 MKERGIIATRQLAKRQLTWLRGWPDVHWLDTFAHDKL 300


>gi|71282631|ref|YP_267090.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Colwellia
           psychrerythraea 34H]
 gi|123634100|sp|Q48A23|MIAA_COLP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71148371|gb|AAZ28844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Colwellia
           psychrerythraea 34H]
          Length = 316

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 67/216 (31%), Positives = 112/216 (51%), Gaps = 2/216 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT +YF++L   +S +P     IR+ I  +    G   +HD+
Sbjct: 91  LVEIAEIRSNGRIPLLVGGTMMYFKSLIEGISPLPTANPEIRQAIEAEALSKGWQAMHDQ 150

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QRI RALE+  ++  ++ +   Q     +  +     I   ER
Sbjct: 151 LAEIDPVSAERIHPNDPQRITRALEVYRLTSNTLTQL-TQIKGAKLAGDVLQLAITPRER 209

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           S L ERI  R+ QM++ G   E+  L   +      P ++ +G R +   L+GE ++DE 
Sbjct: 210 STLHERIALRYQQMIDLGFEQEVIKLKSRDDLHQDLPSIRCVGYRQMWQHLEGEFDHDEM 269

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           + RG+ AT + AKRQ TWL +     W+      +L
Sbjct: 270 IFRGVCATRQLAKRQLTWLRNWPDLHWLTTDDKTNL 305


>gi|283797912|ref|ZP_06347065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           M62/1]
 gi|291074379|gb|EFE11743.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           M62/1]
          Length = 338

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 65/215 (30%), Positives = 113/215 (52%), Gaps = 3/215 (1%)

Query: 1   MLSK-KLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K + + Y +  +PI+ GGTG Y +AL   +     +  T IR ++ +  ++ G   L
Sbjct: 82  MAKKAREEIYSRGHIPIVAGGTGFYIQALLYDIDFTETDESTEIRRELEQTAREKGPRAL 141

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L  +D   A  IH ++ +R+ RA+E    +G+ I E  ++    F P E  + +I L
Sbjct: 142 HELLREVDPESADAIHENNVKRVIRAIEFYRQTGRKISEHNREERQKFSPYEFLYYVIDL 201

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
           P R  L  RI  R ++MLE+G ++E+++L  M  + D+  M+ +G ++I+  L GE + D
Sbjct: 202 P-RPVLYSRIDERVSRMLEAGLVEEVKTLRDMGYTRDMVSMQGLGYKEILDYLNGECSLD 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E +      T  +AKRQ TW   +    W+ + + 
Sbjct: 261 EAVYIIKRDTRHFAKRQITWFKRERDVRWLNLEAF 295


>gi|119776158|ref|YP_928898.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           amazonensis SB2B]
 gi|166216986|sp|A1SA22|MIAA_SHEAM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|119768658|gb|ABM01229.1| tRNA isopentenyltransferase [Shewanella amazonensis SB2B]
          Length = 306

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 114/219 (52%), Gaps = 5/219 (2%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + +  +   +   P++VGGT +YF+ L   LS +P    A+R +I  +++  G   LHDE
Sbjct: 84  VREIEETLSRGKTPLLVGGTMMYFKTLLDGLSPLPSADDAVRAQIAAEVEARGWQALHDE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D + A +IHP+D QR++RA+E+  +SG+++ E   +     +P       I   +R
Sbjct: 144 LRNIDPVSAERIHPNDPQRLSRAIEVYRISGKTLTEL-TKIKAESLPYHMVQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L   I +RF QML  G I E+ +L          P M+ +G R     L GE ++   
Sbjct: 203 TVLHGLIAKRFQQMLAEGFIGEVETLKARGDLHLELPSMRCVGYRQAWQYLDGEFDHATM 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWI---RISSIDDL 216
           +++ + AT + AKRQ TWL    +  W+      ++D L
Sbjct: 263 VEKAVAATRQLAKRQLTWLRGWPELHWLASGDEGNLDKL 301


>gi|242237986|ref|YP_002986167.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech703]
 gi|242130043|gb|ACS84345.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech703]
          Length = 313

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 82/215 (38%), Positives = 112/215 (52%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +      +P++VGGT LYF+AL   LS +P     IR +I E+ K  G   LH +
Sbjct: 89  LQAMSEITAAGRIPLLVGGTMLYFKALLEGLSPLPSANPDIRREIEERAKTEGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P       I    R
Sbjct: 149 LQEIDPVAATRIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGDALPYHVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L ERI  RF QML +G   E R L    +L   LP ++ +G R + + L GEI YDE 
Sbjct: 208 ELLHERIALRFRQMLAAGFETEARVLFARADLHPALPSIRCVGYRQMWSYLSGEIGYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI AT + AKRQ TWL       W+   S  D
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWEGVCWLDSDSPSD 302


>gi|307258065|ref|ZP_07539817.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307262463|ref|ZP_07544108.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306863428|gb|EFM95359.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867840|gb|EFM99671.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 304

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 112/214 (52%), Gaps = 3/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 74  LREMAEITASGRIPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 134 LLAIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+  L          P ++ +G R +   L G+I+ DE 
Sbjct: 193 AVLHQRIEQRFYKMMELGFQQEVEKLRARGDLHKDLPSIRCVGYRQMWEYLDGDISLDEA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSI 213
           + +GI AT + AKRQ TWL     +  W+     
Sbjct: 253 IYKGICATRQLAKRQITWLRGWNSEITWLDSLDP 286


>gi|315178345|gb|ADT85259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii NCTC 11218]
          Length = 310

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 70/214 (32%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR++I  + +Q+G   LHD+
Sbjct: 85  LREMNDIVAQGRIPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEHEAEQHGWMALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LRQIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEALPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L G    ++ 
Sbjct: 204 AELHRRIELRFEKMVEAGFEEEVKALYARKDLHPDLPSIRCVGYRQMWDYLDGNGRLEDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +++
Sbjct: 264 IFRGICATRQLAKRQITWLRSWDDLTWLDSENVE 297


>gi|332172029|gb|AEE21283.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 315

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 122/211 (57%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++  +P++VGGT +Y++ALT  LS +P+  + +R +I ++ ++ G   LH EL  +D
Sbjct: 95  DITQRGRIPLLVGGTMMYYKALTDGLSTLPQADSLVRAEIEKQAQENGWQTLHQELQGID 154

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A++IHP+D QR+ RALEI  +SG+S+ E       P  P + +   I   +R  L +
Sbjct: 155 PVSAQRIHPNDPQRLTRALEIYRISGKSMTELSLN-KQPSAPYQFSQFAIAPQDRHVLHD 213

Query: 127 RIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML SG  DE+ +   + +L LDLP M+ +G R +   L G  +Y E  ++G+
Sbjct: 214 RIAQRFDIMLNSGFEDEVATLRKREDLHLDLPSMRCVGYRQMWQYLDGNNSYQEMREKGL 273

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            AT + AKRQ TWL       W+   S D+L
Sbjct: 274 AATRQLAKRQLTWLRSWQNLHWLDTFSKDNL 304


>gi|239977576|sp|A4VQP1|MIAA_PSEU5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 323

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 76/226 (33%), Positives = 116/226 (51%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +      +P++VGGT LYF+AL   L+ MP    ++R ++       G  +LHD 
Sbjct: 84  LAAMAEITAAGRIPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQVLHDR 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI----------PLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG ++ E   +  +             P   
Sbjct: 144 LAQVDPESAARIHPNDPQRLVRALEVYCVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIAL 170
           A   I   +R  L ERI RRF  M+E G ++E+ +L         +P ++A+G R +   
Sbjct: 204 AQLCIAPAQRHILHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G    +E ++RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 264 LDGSSTREEMVERGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 309


>gi|146283981|ref|YP_001174134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri A1501]
 gi|145572186|gb|ABP81292.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           stutzeri A1501]
          Length = 332

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 76/226 (33%), Positives = 116/226 (51%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +      +P++VGGT LYF+AL   L+ MP    ++R ++       G  +LHD 
Sbjct: 93  LAAMAEITAAGRIPLLVGGTMLYFKALQEGLADMPAADASVRAELEALAASEGLQVLHDR 152

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI----------PLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG ++ E   +  +             P   
Sbjct: 153 LAQVDPESAARIHPNDPQRLVRALEVYCVSGLTMSEHRARQRSQKAGPDAPGSGVLPYTV 212

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIAL 170
           A   I   +R  L ERI RRF  M+E G ++E+ +L         +P ++A+G R +   
Sbjct: 213 AQLCIAPAQRHILHERIERRFRHMVEQGFVEEVEALRSRGDLHLGMPSIRAVGYRQVWEY 272

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G    +E ++RGIIAT + AKRQ TWL    +  W+   S D+L
Sbjct: 273 LDGSSTREEMVERGIIATRQLAKRQFTWLRSWGEVHWLDSLSCDNL 318


>gi|436154|gb|AAC43396.1| tRNA delta-2-isopentenylpyrophosphate (IPP) transferase
           [Escherichia coli]
          Length = 216

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/201 (36%), Positives = 112/201 (55%), Gaps = 2/201 (0%)

Query: 15  PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIH 74
           P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +L  +D + A +IH
Sbjct: 2   PLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIH 61

Query: 75  PSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQ 134
           P+D QR++RALE+  +SG+++ E   Q     +P +     I    R  L +RI +RF Q
Sbjct: 62  PNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQ 120

Query: 135 MLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAK 193
           ML SG   E+R+L          P ++ +G R + + L+GEI+YDE + RG+ AT + AK
Sbjct: 121 MLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAK 180

Query: 194 RQKTWLCHQFQADWIRISSID 214
           RQ TWL       W+     +
Sbjct: 181 RQITWLRGWEGVHWLDSEKPE 201


>gi|109900276|ref|YP_663531.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas atlantica T6c]
 gi|123064076|sp|Q15NR1|MIAA_PSEA6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|109702557|gb|ABG42477.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoalteromonas atlantica T6c]
          Length = 315

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 79/211 (37%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++  +P++VGGT +Y++ALT  LS +P+    +R +I ++ ++ G   LH EL  +D
Sbjct: 95  DITQRGRIPLLVGGTMMYYKALTDGLSTLPQADPLVRAEIEKQAEKNGWQALHQELQGID 154

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A++IHP+D QR++RALEI  +SG+S+ E       P  P + +   I   +R  L +
Sbjct: 155 PVSAQRIHPNDPQRLSRALEIYRISGKSMTELSLN-KQPSAPYQFSQFAIAPSDRHILHD 213

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML SG  DE+  L    +L LDLP M+ +G R +   L GE  Y E  ++G+
Sbjct: 214 RIAQRFDIMLNSGFEDEVIELKSRADLHLDLPSMRCVGYRQMWQYLDGENIYQEMREKGL 273

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            AT + AKRQ TWL       W+   S D+L
Sbjct: 274 AATRQLAKRQLTWLRSWQNLHWLDTFSKDNL 304


>gi|294139255|ref|YP_003555233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           violacea DSS12]
 gi|293325724|dbj|BAJ00455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           violacea DSS12]
          Length = 308

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 77/209 (36%), Positives = 115/209 (55%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +     K    P++VGGT LYF+AL   LS +P     IR +I  +   +G   LHD 
Sbjct: 86  LREIADIVKSGKTPLLVGGTMLYFKALLEGLSPLPAADEVIRAEIAAEALTHGWQHLHDA 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+S+ E   +  +P +P E     I   +R
Sbjct: 146 LKRVDPVSAARIHPNDPQRLSRALEVFRISGKSMTEL-TKIKSPPLPYEVIQFAISPKDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDET 180
             L   I  RF  ML  G ++E++SL + N    DLP M+ +G R     L G+ +Y+  
Sbjct: 205 KVLHLSIEERFKLMLNQGFVEEVQSLRQRNDLHLDLPSMRCVGYRQCWEHLDGDYDYNTM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           + +GIIAT + AKRQ TWL    + +W+ 
Sbjct: 265 VDKGIIATRQLAKRQLTWLRGWSELNWLE 293


>gi|289424065|ref|ZP_06425851.1| tRNA isopentenyltransferase [Peptostreptococcus anaerobius 653-L]
 gi|289155490|gb|EFD04169.1| tRNA isopentenyltransferase [Peptostreptococcus anaerobius 653-L]
          Length = 308

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 107/218 (49%), Gaps = 5/218 (2%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M S+ +   +K+  L I+ GGTGLY  +L   +         +IR+ + E L   G   L
Sbjct: 82  MASQIISDIHKRGKLAIVTGGTGLYLNSLVYDMDFGGTNSDPSIRKDLEEILNDKGKDYL 141

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           +  L  L    A++IHP++ +R+ RA+E+    G             + P   A  I++ 
Sbjct: 142 YRLLQDLSPEAAKRIHPNNTKRVIRAIEVYKTGGDMGDF---SNDLKYNPKFDAKIIVLN 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +RS L +RI +R   M + G +DE++ L +M  +  +  MK IG ++++    G++  +
Sbjct: 199 RDRSILYDRINQRVDMMFDMGLLDEVKGLHQMGYTSQMQSMKGIGYKEVLEYFDGKMTLE 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           E++      T +YAKRQ TW      A W+ +  + +L
Sbjct: 259 ESIDILKQGTRRYAKRQITWFKRYENALWLDLDKVTEL 296


>gi|289662672|ref|ZP_06484253.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 327

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 107/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A+R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSQLPEADQAVRASIAAEAEQLGWAGLHAQLAGVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGPRLPVRVLKVVLAPRERAVLHT 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML    + E++ L  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIAHRLDAMLAQDFLGEVQRLRALPQMQAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|153874640|ref|ZP_02002782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beggiatoa sp.
           PS]
 gi|152068895|gb|EDN67217.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beggiatoa sp.
           PS]
          Length = 308

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 112/208 (53%), Gaps = 1/208 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
                 +P++VGGT LYF +L   LS +P     +R+ ++ + +Q G   LH  L+ +D 
Sbjct: 88  IKSAGRIPLLVGGTMLYFHSLQQGLSTLPSANPQVRQHLKNEAEQIGWPALHQRLAKIDP 147

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A++IHP+D QRI RALEI   SGQ++  ++ +AP           +I   ERS L  +
Sbjct: 148 QTAQRIHPNDAQRIGRALEIYEESGQTMSTWYAKAPPQPWNESIIKLVIAPTERSVLHAK 207

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  MLE G I+E+R L +        P M+ +G R +   L GE+ YD   ++ II
Sbjct: 208 IAQRFHTMLEQGFIEEVRRLFEQGDLNPDLPAMRCVGYRQVWHYLAGELLYDNLPEKAII 267

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
           AT + AKRQ TWL  Q  ADW      D
Sbjct: 268 ATRQLAKRQMTWLRTQTDADWFDSDEPD 295


>gi|239832268|ref|ZP_04680597.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824535|gb|EEQ96103.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ochrobactrum
           intermedium LMG 3301]
          Length = 335

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 91/207 (43%), Positives = 134/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           K   PI VGGTGLYFRAL G LS MPE+P  +R   R +++  G  +LH  L   D  +A
Sbjct: 122 KDRTPIFVGGTGLYFRALLGGLSQMPEVPGDVRAYWRGRMETDGPELLHRILGERDPDMA 181

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + P+D QRI RALE+   +G+S++ + +      +   SAHKI++ P+R+ L ERI +
Sbjct: 182 ATLQPADSQRIVRALEVLEGTGKSLLYWQQTKGRAIVDENSAHKIVLAPDRAWLSERIAQ 241

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  M ++GAIDE+++L+ ++L   LP MKAIGVR+I A L+G ++ +E ++R +IAT +
Sbjct: 242 RFALMWDNGAIDEVKALLALDLDPGLPAMKAIGVREITAYLEGTMSREEAVERSVIATRQ 301

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q  A W   ++ +D F
Sbjct: 302 YAKRQSTWFRNQLDASWSVHANSNDAF 328


>gi|260770598|ref|ZP_05879530.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii CIP 102972]
 gi|260614428|gb|EEX39615.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           furnissii CIP 102972]
          Length = 310

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 70/214 (32%), Positives = 116/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR++I  + +Q+G   LHD+
Sbjct: 85  LREMNDIVAQGRIPLLVGGTMLYYKALLEGLSPLPAADPEIRQQIEHEAEQHGWLALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LRHIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGEALPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+E+G  +E+++L          P ++ +G R +   L G    ++ 
Sbjct: 204 AELHRRIELRFEKMVEAGFEEEVKALYARKDLHPDLPSIRCVGYRQMWDYLDGNGRLEDA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RGI AT + AKRQ TWL       W+   +++
Sbjct: 264 IFRGICATRQLAKRQITWLRSWDDLTWLDSENVE 297


>gi|226939875|ref|YP_002794948.1| MiaA [Laribacter hongkongensis HLHK9]
 gi|226714801|gb|ACO73939.1| MiaA [Laribacter hongkongensis HLHK9]
          Length = 311

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 74/212 (34%), Positives = 110/212 (51%), Gaps = 2/212 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LYF+AL   LS +P    AIR  +  +    G   LH EL+ +D
Sbjct: 88  DIVARGRIPLLVGGTMLYFKALAEGLSDLPPANPAIRAGLDARAAMLGWPALHQELARID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P D QR+ RALE+  ++GQ +  F        +P       +   ER+ + E
Sbjct: 148 PQTAARLAPHDSQRLQRALEVWQLTGQPLSSFHTDEKTTALPFNVLRLALDTGERAWIHE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL--PIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI RRF  ML++G +DE+R+L+     L    P M+ +G R     L+GE + DE ++RG
Sbjct: 208 RIARRFRLMLDAGFVDEMRTLLHDYPELHPDLPSMRCVGYRQAWEWLRGECSEDEFIERG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           I AT + AKRQ TW+        +   S D L
Sbjct: 268 IAATRQLAKRQITWMRSMPDLVRLECRSADTL 299


>gi|104783873|ref|YP_610371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           entomophila L48]
 gi|122401627|sp|Q1I448|MIAA_PSEE4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|95112860|emb|CAK17588.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Pseudomonas entomophila L48]
          Length = 323

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 80/226 (35%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP    A+R ++  +    G   LH +
Sbjct: 84  LDAMAEITARGKIPLLVGGTMLYYKALVEGLADMPPADAAVRAELEAQASALGLGELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA----------PNPFIPLES 111
           L+ +D   A +IHP+D QR+ RALE+  VSG+S+    ++            N  +P   
Sbjct: 144 LAEVDPESAARIHPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGANGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G +DE+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFVDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G +  +E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGHLTENEMQERGIIATRQLAKRQFTWLRGWDGVHWLDSLACDNL 309


>gi|291528990|emb|CBK94576.1| tRNA isopentenyltransferase (miaA) [Eubacterium rectale M104/1]
          Length = 328

 Score =  164 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 110/215 (51%), Gaps = 3/215 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K L + Y+   +PIIVGGTG Y +AL   +     ++    R+ + +   ++G+H L
Sbjct: 92  MAKKALNEIYEAGKIPIIVGGTGFYIQALLYDIDFTKQDVDEEYRKSLYDFANEHGNHAL 151

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D      IH ++ +R+ RA+E      + I +  +       P   A+ ++  
Sbjct: 152 HEKLKDIDPASYESIHENNVKRVIRAIEYYHTCHEPISKHNETERAKQSPYSFAYFVLDD 211

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             +  L ERI +R   M+ +G +DE++ L  M  + D+  MK IG ++I+A L GE + D
Sbjct: 212 VRQR-LYERIDKRVDIMVSNGLVDEVKKLKAMGCTSDMVSMKGIGYKEILAYLDGEYSLD 270

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E + +  + + ++AKRQ TW   +    WI  +  
Sbjct: 271 EAVDKIKLESRRFAKRQLTWFRREKDTIWIEKNEY 305


>gi|307132705|ref|YP_003884721.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Dickeya dadantii 3937]
 gi|306530234|gb|ADN00165.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Dickeya dadantii 3937]
          Length = 313

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 81/211 (38%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +      +P++VGGT LYF+AL   LS +P     +R++I E+ +  G   LH +
Sbjct: 89  LQAMAEITAAGRIPLLVGGTMLYFKALLEGLSPLPSADAQVRQEIEERARIEGWEALHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A +IHP+D QR++RALE+  VSG ++ E   +     +P       I    R
Sbjct: 149 LSVIDPVSAARIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGEALPYRVHQFAIAPATR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L ERI  RF QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE 
Sbjct: 208 ELLHERIALRFRQMLESGFETEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           + RGI AT + AKRQ TWL    +  W+   
Sbjct: 268 VYRGICATRQLAKRQMTWLRGWEEVCWLDSD 298


>gi|325293407|ref|YP_004279271.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           sp. H13-3]
 gi|325061260|gb|ADY64951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           sp. H13-3]
          Length = 298

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 96/206 (46%), Positives = 138/206 (66%)

Query: 5   KLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSS 64
            +   +++  P+IVGGTGLYF+ALTG LS MP IP  IRE++R +L + GS +LH ELS 
Sbjct: 91  LVDLRRQQRFPVIVGGTGLYFKALTGGLSDMPAIPDDIRERLRARLIEEGSTVLHAELSR 150

Query: 65  LDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSAL 124
            D ++A+ + P DGQRI RALE+   +G+SI+EF K +    +  + A K ++LPER  L
Sbjct: 151 CDPLMAQGLQPGDGQRIVRALEVMEATGKSIMEFQKASGPMIVDPDRAEKFVVLPERPVL 210

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            +RI RRF  M+ESGA++E+++L+ +NL+ D   MKAIGV  I  +L G ++  E +++ 
Sbjct: 211 HDRINRRFETMMESGAVEEVKALLALNLAPDATAMKAIGVSQIADMLAGGMSEAEVIEKS 270

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRI 210
             AT +YAKRQ TW  +Q   DW RI
Sbjct: 271 AAATRQYAKRQMTWFRNQMGPDWARI 296


>gi|325916039|ref|ZP_08178329.1| tRNA isopentenyltransferase MiaA [Xanthomonas vesicatoria ATCC
           35937]
 gi|325537715|gb|EGD09421.1| tRNA isopentenyltransferase MiaA [Xanthomonas vesicatoria ATCC
           35937]
          Length = 327

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/211 (33%), Positives = 103/211 (48%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  LPI+ GGTGLYFRA+   LS +PE    +R  I  + +Q G   LH +L  +D
Sbjct: 91  DIVARGKLPILAGGTGLYFRAVLEGLSQLPEADPTVRAAIAAEAEQVGWAGLHAQLRRID 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A +IH +D QRI RALE+  +SG+ I  +    P P +PL     ++   +R+ L  
Sbjct: 151 PIAAARIHATDPQRIQRALEVYRLSGRPISHWQALPPGPRLPLRVLKIVLAPQDRAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL------PIMKAIGVRDIIALLKGEINYDET 180
           RI +R   ML    + E+  L ++     +      P ++A+G R     L G  +  E 
Sbjct: 211 RIAQRLDAMLAQDFLAEVTRLRELPQMRTVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +    W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDTRWFDPE 301


>gi|238757518|ref|ZP_04618703.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           aldovae ATCC 35236]
 gi|238704280|gb|EEP96812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           aldovae ATCC 35236]
          Length = 310

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 71/213 (33%), Positives = 112/213 (52%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +
Sbjct: 86  LKEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADLPVRQRIEQQAAEQGWEALHQQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 146 LAEIDPVAAARIHPNDPQRLSRALEVFYISGKTLTEL-TKISGETLPYRVHQFAIAPVSR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF QML++G   E R+L          P ++ +G R + + L GEI+Y+E 
Sbjct: 205 ELLHRRIELRFHQMLDAGFEQEARALFDRGDLHTDLPAVRCVGYRQMWSYLSGEIDYNEM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 265 VYRGVCATRQLAKRQMTWLRGWSSVQWLDSDKP 297


>gi|325661605|ref|ZP_08150229.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472132|gb|EGC75346.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 320

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             Y +  +PIIVGGTG Y +AL   +     E  +  REK+    K+ G+  LH +L+ +
Sbjct: 91  DIYSRGKIPIIVGGTGFYIQALLYDIDFTENEGDSVYREKLEALAKEKGAAYLHGQLAMV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALE    +GQ I E  ++      P +  + ++         
Sbjct: 151 DPKSAEEIHANNIKRVIRALEFYHQTGQKISEHNERERQKASPYQFCYFVLNDRRECL-Y 209

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI +R  QM+ +G + E+++L +   +  +  M+ +G ++I + L+G+ + +E +    
Sbjct: 210 ERIDQRVDQMIRNGLVQEVQTLKERGCTKQMVSMQGLGYKEIFSYLEGDCSLEEAVYIIK 269

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W++   ++
Sbjct: 270 RDTRHFAKRQLTWFKRERDVIWVQKDELN 298


>gi|331084837|ref|ZP_08333925.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330410931|gb|EGG90353.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 320

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             Y +  +PIIVGGTG Y +AL   +     E  +  REK+    K+ G+  LH +L+ +
Sbjct: 91  DIYSRGKIPIIVGGTGFYIQALLYDIDFTENEGDSVYREKLEALAKEKGAAYLHGQLAMV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALE    +GQ I E  ++      P +  + ++         
Sbjct: 151 DPKSAEEIHANNIKRVIRALEFYHQTGQKISEHNERERQKESPYQFCYFVLNDRRECL-Y 209

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI +R  QM+ +G + E+++L +   +  +  M+ +G ++I + L+G+ + +E +    
Sbjct: 210 ERIDQRVDQMIRNGLVQEVQTLKERGCTKQMVSMQGLGYKEIFSYLEGDCSLEEAVYIIK 269

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W++   ++
Sbjct: 270 RDTRHFAKRQLTWFKRERDVIWVQKDELN 298


>gi|241205500|ref|YP_002976596.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240859390|gb|ACS57057.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 297

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 93/200 (46%), Positives = 134/200 (67%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MPEIP  +REK+R +L + G   L+ EL+  D  +A 
Sbjct: 97  GRLPVFVGGTGLYFKALTGGLSDMPEIPEVLREKLRTRLLEEGPDGLYSELAEADPAMAA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI +F  ++    I  + A KI++LP+R+ L +RI  R
Sbjct: 157 SLNRQDGQRIVRALEVVKATGRSIADFQGRSGPVVIDADEARKIVVLPDRAVLHQRINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA  E+R+L+ ++L  + P+MKAIGV  I A+L+GE+  DE L++G  AT +Y
Sbjct: 217 FEKMLQQGAEYEVRALLALDLPAEAPVMKAIGVSQITAMLRGEMTRDEVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRIS 211
           AKRQ TW  +Q    W R++
Sbjct: 277 AKRQMTWFRNQMDGSWERLT 296


>gi|271502154|ref|YP_003335180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech586]
 gi|270345709|gb|ACZ78474.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya
           dadantii Ech586]
          Length = 313

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 81/203 (39%), Positives = 117/203 (57%), Gaps = 2/203 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGT LYF+AL   LS +P    +IR++I E+ +  G   LH +LS++D + A 
Sbjct: 99  GRIPLLVGGTMLYFKALLEGLSPLPSADASIRQEIEERARTEGWEALHRQLSAIDPVAAA 158

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           +IHP+D QR++RALE+  VSG ++ E   +     +P       I    R  L ERI  R
Sbjct: 159 RIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGEALPYRVHQFAIAPATRELLHERIALR 217

Query: 132 FTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE + RGI AT +
Sbjct: 218 FRQMLESGFETEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQ 277

Query: 191 YAKRQKTWLCHQFQADWIRISSI 213
            AKRQ TWL       W+     
Sbjct: 278 LAKRQMTWLRGWEGVRWLDSDQP 300


>gi|254429837|ref|ZP_05043544.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alcanivorax sp.
           DG881]
 gi|196196006|gb|EDX90965.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alcanivorax sp.
           DG881]
          Length = 348

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 68/225 (30%), Positives = 110/225 (48%), Gaps = 13/225 (5%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           LS   + +    LP++VGGT LYF+AL   L+ +PE    +R +I       G   +H  
Sbjct: 105 LSHIEEIHANGKLPLLVGGTVLYFKALVEGLAPLPEADPQVRAEIAALADAQGWPAVHQA 164

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI------------PL 109
           L+ +D + A ++ P+D QR+ RALE+  ++G+ +  F  +     I            P 
Sbjct: 165 LAEVDPVTAARLKPTDRQRLQRALEVFRLTGRPLSAFHAEHHTTVIKNRDGLSQFSGLPY 224

Query: 110 ESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDII 168
                 +   +R  L E+I  RF  ML++G + E+  L +        P ++A+G R + 
Sbjct: 225 PVLSLALAPRDRGWLHEQIALRFRAMLDAGLLAEVEGLRQQTQLHPALPGIRAVGYRQVW 284

Query: 169 ALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
             L G+ +YD  ++RGIIAT + AKRQ TWL       W   + +
Sbjct: 285 EYLDGQYDYDTMVERGIIATRQLAKRQFTWLRKWPDLQWFDSNDL 329


>gi|320539678|ref|ZP_08039342.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Serratia symbiotica str. Tucson]
 gi|320030290|gb|EFW12305.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Serratia symbiotica str. Tucson]
          Length = 311

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/211 (33%), Positives = 113/211 (53%), Gaps = 2/211 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P    ++RE I ++  + G   LH +
Sbjct: 87  LKEMADITSAGRIPLLVGGTMLYYKALLAGLSPLPPADPSVRECIEQQAVEQGWKALHRQ 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR+ RALE+  +SG+++ E   +     +P       I    R
Sbjct: 147 LQEIDPVAALRIHPNDPQRLFRALEVFFISGKTLTEM-IKISGESLPYHVHQFAIAPSSR 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + + +RI  R+ QML +G   E R+L   +      P ++++G R + + L GE++YDE 
Sbjct: 206 ALIHQRIELRYQQMLAAGFEAEARALFAWDDLHIDLPSIRSVGYRQMWSYLSGEMSYDEM 265

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           + RGI AT + AKRQ TWL       W+   
Sbjct: 266 VYRGICATRQLAKRQMTWLRGWNSVHWLDSE 296


>gi|116749353|ref|YP_846040.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophobacter
           fumaroxidans MPOB]
 gi|239977463|sp|A0LJK3|MIAA_SYNFM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|116698417|gb|ABK17605.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophobacter
           fumaroxidans MPOB]
          Length = 342

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 1/205 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            ++   +PI+VGGTGLY + LT  +         +R ++ E+    G   LH+ L  +D 
Sbjct: 118 LHEAGKVPIVVGGTGLYLKVLTRGICAGAPGDPDVRRRLIEEELTLGLPALHERLRDVDP 177

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
            +  +IHP+D QRI RALE+   SG+ +  + +Q      P  +    +  P R  L  R
Sbjct: 178 PLGARIHPNDRQRILRALEVFHHSGKPLSYWQRQHRFEDAPYRTLKIFLHRP-REVLYAR 236

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I  R   M+  G +DE+R+L+ M    +L  M+++G R +   L+GE++ DE +      
Sbjct: 237 INDRVDAMMAQGFLDEVRNLLAMGCGPELKPMQSLGYRQMARHLRGEMSLDEAVNEIRRD 296

Query: 188 TNKYAKRQKTWLCHQFQADWIRISS 212
           T +YAKRQ TW     +  W   + 
Sbjct: 297 TRRYAKRQLTWFRADPEYRWFDAAD 321


>gi|22124543|ref|NP_667966.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           KIM 10]
 gi|45440382|ref|NP_991921.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594776|ref|YP_068967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809902|ref|YP_653818.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Antiqua]
 gi|108813459|ref|YP_649226.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Nepal516]
 gi|145600849|ref|YP_001164925.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Pestoides F]
 gi|150260584|ref|ZP_01917312.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CA88-4125]
 gi|153950565|ref|YP_001402608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419131|ref|YP_001605280.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Angola]
 gi|165926687|ref|ZP_02222519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165936572|ref|ZP_02225140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166011861|ref|ZP_02232759.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166214048|ref|ZP_02240083.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167400714|ref|ZP_02306223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419000|ref|ZP_02310753.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423725|ref|ZP_02315478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|170026015|ref|YP_001722520.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186893783|ref|YP_001870895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927575|ref|YP_002345450.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CO92]
 gi|229836632|ref|ZP_04456798.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Pestoides A]
 gi|229840244|ref|ZP_04460403.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229842322|ref|ZP_04462477.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229903939|ref|ZP_04519052.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Nepal516]
 gi|294502481|ref|YP_003566543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Z176003]
 gi|21263774|sp|Q8ZIW3|MIAA_YERPE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|61214046|sp|Q66FB6|MIAA_YERPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123072502|sp|Q1C0Z9|MIAA_YERPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123372928|sp|Q1CEF4|MIAA_YERPN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166217002|sp|A4TRP0|MIAA_YERPP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167011781|sp|A7FMY0|MIAA_YERP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238687243|sp|A9QYN2|MIAA_YERPG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238688464|sp|B1JMP0|MIAA_YERPY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238691359|sp|B2K203|MIAA_YERPB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21957341|gb|AAM84217.1|AE013665_6 delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis KIM 10]
 gi|45435238|gb|AAS60798.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51588058|emb|CAH19664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777107|gb|ABG19626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Nepal516]
 gi|108781815|gb|ABG15873.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Antiqua]
 gi|115346186|emb|CAL19054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CO92]
 gi|145212545|gb|ABP41952.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Pestoides F]
 gi|149289992|gb|EDM40069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           CA88-4125]
 gi|152962060|gb|ABS49521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162351946|gb|ABX85894.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Angola]
 gi|165915688|gb|EDR34297.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165921310|gb|EDR38534.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165989220|gb|EDR41521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166204843|gb|EDR49323.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166962994|gb|EDR59015.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167050082|gb|EDR61490.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057895|gb|EDR67641.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169752549|gb|ACA70067.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186696809|gb|ACC87438.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679709|gb|EEO75812.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Nepal516]
 gi|229690632|gb|EEO82686.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229696610|gb|EEO86657.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229706316|gb|EEO92324.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis Pestoides A]
 gi|262360511|gb|ACY57232.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           D106004]
 gi|294352940|gb|ADE63281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Yersinia pestis
           Z176003]
 gi|320013762|gb|ADV97333.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 313

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 70/213 (32%), Positives = 112/213 (52%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LYF+AL   LS +P     +R++I ++  + G   LH +
Sbjct: 89  LKEMADITAAGRIPLLVGGTMLYFKALLDGLSPLPSADPQVRQRIEQQASELGWGALHQQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +IHP+D QR++RALE+  +SG+++ E   +     +P       I    R
Sbjct: 149 LAVIDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TKISGETLPYRVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML++G   E R L          P ++ +G R + + L GEI+Y++ 
Sbjct: 208 ELLHQRIELRFHQMLDAGFEAEARVLFDRGDLHTDLPAIRCVGYRQMWSYLSGEIDYNDM 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RG+ AT + AKRQ TWL       W+     
Sbjct: 268 VYRGVCATRQLAKRQMTWLRGWSSVQWLDSDKP 300


>gi|261254058|ref|ZP_05946631.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           orientalis CIP 102891]
 gi|260937449|gb|EEX93438.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           orientalis CIP 102891]
          Length = 316

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 118/214 (55%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +  ++  +P++VGGT LY++AL   LS +P     IR++I ++    G   LHDE
Sbjct: 86  LNEMNKIVEQGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEQEALTGGWDKLHDE 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 146 LKEIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGESLPYRVKQFAIAPKER 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  R+ ++LE+G  DE+R+L   +      P ++ +G R +   L G    D+ 
Sbjct: 205 AELHRRIELRYEKILEAGFEDEMRALYARDDLHPDLPSIRCVGYRQMWDYLDGNCTLDDA 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + +G+ AT + AKRQ TWL       W+   +I+
Sbjct: 265 IFKGVCATRQLAKRQITWLRSWDDLTWLDSENIE 298


>gi|307246898|ref|ZP_07528963.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307249034|ref|ZP_07531042.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307253650|ref|ZP_07535517.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307255880|ref|ZP_07537681.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260333|ref|ZP_07542040.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307264671|ref|ZP_07546251.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|239977342|sp|B3H330|MIAA_ACTP7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|306852183|gb|EFM84423.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306854492|gb|EFM86687.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858886|gb|EFM90932.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861148|gb|EFM93141.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865584|gb|EFM97465.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869983|gb|EFN01747.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 304

 Score =  163 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 3/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 74  LREMAEITASGRIPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 134 LLAIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+  L    +L  DLP ++ +G R +   L G+I+ DE 
Sbjct: 193 AVLHQRIEQRFYKMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSI 213
           + +GI AT + AKRQ TWL     +  W+     
Sbjct: 253 IYKGICATRQLAKRQITWLRGWNSEITWLDSLDP 286


>gi|114773230|ref|ZP_01450465.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium HTCC2255]
 gi|114546349|gb|EAU49258.1| tRNA delta(2)-isopentenylpyrophosphate transferase [alpha
           proteobacterium HTCC2255]
          Length = 313

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP++VGGT +YF AL   LS +P     IR  I E+  + G   +H +L+ +D
Sbjct: 95  EIIGRGHLPVLVGGTMMYFNALIKGLSTLPASNACIRADIEEQATEKGWAAMHAQLALID 154

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A++IHP+D QRI RALE+  +SG+ +     ++  P  P   A   I   ERS L E
Sbjct: 155 PLCAQRIHPNDPQRITRALEVYQISGRPMSALQAESSGPI-PYTIAQFAIAPQERSVLHE 213

Query: 127 RIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF QMLE     E+ +LM + +L  DLP M+ +G R +   L G+++  +  +RG+
Sbjct: 214 RIELRFQQMLEQNFEAEVSALMARQDLLEDLPSMRCVGYRQMWQYLSGQMSRSDMFERGV 273

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           IAT + AKRQ TWL       W+   + +++
Sbjct: 274 IATRQLAKRQVTWLRSWDDVIWLDTFANNNV 304


>gi|209884423|ref|YP_002288280.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oligotropha
           carboxidovorans OM5]
 gi|239977425|sp|B6JB74|MIAA_OLICO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|209872619|gb|ACI92415.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oligotropha
           carboxidovorans OM5]
          Length = 305

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 83/207 (40%), Positives = 120/207 (57%), Gaps = 1/207 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +  LPI +GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH+EL+  D
Sbjct: 85  EVHAEGRLPIFIGGTGLYFKALTRGLSDVPPVPDEVRQGVRARLDRDGPEALHEELARRD 144

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P D  RIARALE+   +G+ + ++      P +P E    + + P+R+AL E
Sbjct: 145 PQAAARLKPRDRVRIARALEVVEATGRPLADWHAHGLPPLLPAEGVTALFLAPDRAALYE 204

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RRF  M  SGA+ E  +L +  L   LP MKA GV  +I  L GE+  +E +  G I
Sbjct: 205 RIDRRFEVMAASGALAEAEALGRRGLDPLLPAMKAHGVPALIRHLAGELTREEAIAIGQI 264

Query: 187 ATNKYAKRQKTWLCHQ-FQADWIRISS 212
            T  YAKRQ TW  HQ  + +WI  + 
Sbjct: 265 DTRHYAKRQFTWFRHQLPEFEWIAPND 291


>gi|224826522|ref|ZP_03699623.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lutiella
           nitroferrum 2002]
 gi|224601123|gb|EEG07305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lutiella
           nitroferrum 2002]
          Length = 319

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 71/209 (33%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LYF+AL   LS MP    A R ++  +  +YG   LH +L+  D
Sbjct: 89  DIAARGKVPLLVGGTMLYFKALIDGLSDMPPADVATRAQLDLEAAKYGWPALHAQLAEAD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++ P D QRI RALE+  ++G+ +  +  +  N     +     +I  +R+ L E
Sbjct: 149 PITAARLEPLDSQRIQRALEVFRLTGKPLSAWHAEGRNQAARFQMLKLALIPHDRAWLHE 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLS--LDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF  MLE   +DE+  L +       DLP M+ +G R     L G+ +Y + L +G
Sbjct: 209 RIALRFRLMLEQFFLDEVVRLRQRYPDLTPDLPSMRCVGYRQAWEHLDGQASYADFLDKG 268

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSI 213
           I AT + AKRQ TWL        +  +S 
Sbjct: 269 IAATRQLAKRQLTWLRSMPDITVLEPTSP 297


>gi|78356827|ref|YP_388276.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|123741269|sp|Q310R5|MIAA_DESDG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78219232|gb|ABB38581.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 310

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/206 (31%), Positives = 108/206 (52%), Gaps = 2/206 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +    LP++VGGTGLY RAL   ++ +P+IP  + +K +E+    G+  LH  L + D
Sbjct: 91  EEHAHGRLPLLVGGTGLYLRALLDGIAAIPDIPETVSQKWQERCAARGAPALHRLLEAQD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++HP+D QRI RALE++  +G+ +  +  Q          A KI +      L  
Sbjct: 151 PQTAERLHPNDSQRIVRALEVQEATGRPLSWWHAQ--PVPPSPYRAVKIGVSATLDGLTP 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           R+ +R   ML +GA+DE R+ M +  +   P    IG  ++ + +KG ++ DE  +  + 
Sbjct: 209 RLAKRIEMMLAAGALDEARNAMGICDNPRAPGWSGIGCAELYSYIKGAVSLDECKRLWLH 268

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISS 212
            T +YAKRQ TW   +    W+  + 
Sbjct: 269 NTRQYAKRQLTWFRREPNLHWLDGTD 294


>gi|325271236|ref|ZP_08137781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas sp.
           TJI-51]
 gi|324103639|gb|EGC00941.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas sp.
           TJI-51]
          Length = 323

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 79/226 (34%), Positives = 121/226 (53%), Gaps = 11/226 (4%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    +   +  +P++VGGT LY++AL   L+ MP     +R ++  +    G   LH +
Sbjct: 84  LQAMAEISGRGKIPLLVGGTMLYYKALVDGLADMPAADAGVRAELEAQAAALGLGELHRQ 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP----------FIPLES 111
           L+ +D + A +IHP+D QR+ RALE+  VSG+S+    ++               +P   
Sbjct: 144 LAEVDPVSAARIHPNDPQRLIRALEVYRVSGESMTAHRQRQFAESRGADAGAGGHLPYTV 203

Query: 112 AHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIAL 170
           A   I   +R  L +RI  RF+QMLE G IDE+RSL    +L   LP ++A+G R +   
Sbjct: 204 ASLAIAPTDRHILHQRIALRFSQMLEQGFIDEVRSLRARSDLHAGLPSIRAVGYRQVWDY 263

Query: 171 LKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           L G+++  E  +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 264 LDGKLSESEMRERGIIATRQLAKRQFTWLRGWPDVHWLDSLACDNL 309


>gi|283856409|ref|YP_162873.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|283775409|gb|AAV89762.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 283

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 119/217 (54%), Gaps = 7/217 (3%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K++   ++   LPI+VGGTGLY R L   ++ +P+I   +RE++R           +
Sbjct: 58  LAKKEIKNAHESGRLPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSM----SVEEAY 113

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L   D + A ++ P+D  RI RALE+   +G  +  + ++              +I+P
Sbjct: 114 SALQQEDPMAADRLRPTDKTRIMRALEVMRSTGHPLHYWQQKKTGGIANEIKLQSFVIIP 173

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+ R  +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+   
Sbjct: 174 PANILRSRCDKRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLT 233

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +++   AT +YAKRQ+TW  HQ    WI+I   DD+
Sbjct: 234 MIEKAKAATRQYAKRQRTWFRHQTDESWIKI--FDDI 268


>gi|165977403|ref|YP_001652996.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250342|ref|ZP_07336541.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251735|ref|ZP_07337906.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|238687529|sp|B0BTY5|MIAA_ACTPJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|165877504|gb|ABY70552.1| tRNA delta-2-isopentylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302649165|gb|EFL79350.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650812|gb|EFL80969.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 314

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 116/214 (54%), Gaps = 3/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 84  LREMAEITASGRIPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 144 LLAIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+  L    +L  DLP ++ +G R +   L G+I+ DE 
Sbjct: 203 AVLHQRIEQRFYKMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSI 213
           + +GI AT + AKRQ TWL     +  W+     
Sbjct: 263 IYKGICATRQLAKRQITWLRGWNSEITWLDSLDP 296


>gi|86358397|ref|YP_470289.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli
           CFN 42]
 gi|123511420|sp|Q2K6H4|MIAA_RHIEC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|86282499|gb|ABC91562.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CFN 42]
          Length = 297

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 136/200 (68%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MP+IP A+RE++R +L + G+  L+ ELS +D  +A 
Sbjct: 97  GQLPVFVGGTGLYFKALTGGLSDMPDIPEALREELRRRLVEEGTDALYAELSDVDPAMAA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI +F  ++    I  + A KI++LP+R+ L  RI  R
Sbjct: 157 GLNRQDGQRIVRALEVTKATGRSIADFQGRSGPVVIDADEARKIVVLPDRAVLHARINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA DE+++L+ + L  + P+MKAIGV  I A+LKGE+  DE L++G  AT +Y
Sbjct: 217 FEKMLQQGAEDEVKALLALGLPAEAPVMKAIGVSQIAAMLKGEMTRDEVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRIS 211
           AKRQ TW  +Q    W R++
Sbjct: 277 AKRQMTWFRNQMDDSWQRLT 296


>gi|291524849|emb|CBK90436.1| tRNA isopentenyltransferase (miaA) [Eubacterium rectale DSM 17629]
          Length = 328

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/215 (27%), Positives = 109/215 (50%), Gaps = 3/215 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K L + Y+   +PI+VGGTG Y +AL   +     ++    R+ + +   ++G+H L
Sbjct: 92  MAKKALNEIYEAGKIPIVVGGTGFYIQALLYDIDFTKQDVDEEYRKSLYDFANEHGNHAL 151

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D      IH ++ +R+ RA+E      + I +  +       P   A+ ++  
Sbjct: 152 HEKLKDIDPASYESIHENNVKRVIRAIEYYHTCHEPISKHNETERAKQSPYSFAYFVLDD 211

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             +    ERI +R   M+ +G +DE++ L  M  + D+  MK IG ++I+A L GE + D
Sbjct: 212 VRQRL-YERIDKRVDIMVSNGLVDEVKKLKTMGCTSDMVSMKGIGYKEILAYLDGEYSLD 270

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E + +  + + ++AKRQ TW   +    WI  +  
Sbjct: 271 EAVDKVKLESRRFAKRQLTWFRREKDTIWIEKNEY 305


>gi|84393187|ref|ZP_00991951.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus 12B01]
 gi|84376239|gb|EAP93123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus 12B01]
          Length = 310

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 71/214 (33%), Positives = 117/214 (54%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++  +   +  +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+
Sbjct: 85  INEMNKIVAEGKIPLLVGGTMLYYKALLEGLSPLPAADQEIRKQIEAESIEQGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LREIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF +M+E+G  DE+++L   +      P ++ +G R +   L G  + DE 
Sbjct: 204 KELHRRIELRFEKMIEAGFEDEMKALYARDDLHPELPSIRCVGYRQMWDYLDGNCDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|225174622|ref|ZP_03728620.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169749|gb|EEG78545.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 310

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 112/214 (52%), Gaps = 4/214 (1%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILH 59
             K +     +  LPI+VGGTGLY RA+    S     +    R  +  + +Q+GS  LH
Sbjct: 80  AKKAITDITNRGKLPILVGGTGLYVRAVVHGFSFSESGMDEEYRAGLHREAEQHGSQYLH 139

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L+++D   A ++HP+D +R+ RALE+   S + I     +  +   P+ +  +  +  
Sbjct: 140 GKLAAVDPEAAEKLHPNDLRRVIRALEVYRQSKRPISHQVDKTSDE--PIYNTVQFGLTM 197

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
            R  L  RI +R   ML++G +DE+R+L+   +      ++++G + I+A L G+I+ +E
Sbjct: 198 PRELLYRRIEKRVDSMLDAGLVDEVRNLLNEGVPPAAKSLQSLGYKQIVAYLTGQISLEE 257

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
            ++     T ++AKRQ TW        W+ + ++
Sbjct: 258 AIRLIKRDTRRFAKRQLTWFRRDEDLIWLDMHAL 291


>gi|110634094|ref|YP_674302.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           sp. BNC1]
 gi|123162267|sp|Q11HI8|MIAA_MESSB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110285078|gb|ABG63137.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Chelativorans
           sp. BNC1]
          Length = 292

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 97/201 (48%), Positives = 131/201 (65%), Gaps = 1/201 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +R + I VGGTGLYFRALT  LS MPEIP A+R + R++L + G   LH  L   D
Sbjct: 88  EALARRAV-IFVGGTGLYFRALTEGLSPMPEIPEAVRIRWRKRLAEEGGEALHRLLGEAD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +I PSD QRI RALE+   SG+ I  +  QA +P + + S  KI+++P+R+ L  
Sbjct: 147 PLAASRIRPSDSQRIVRALEVVEASGRPISYWQGQASHPLVDMTSCRKIVLMPDRNTLAS 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +RF QML  GA++E++ L+ ++L   +P MKAIGVR+I A+L GEI+ DE   R I 
Sbjct: 207 RIEKRFDQMLRHGAVEEVKQLLALDLPPSMPAMKAIGVREISAVLAGEISLDEAGSRAIA 266

Query: 187 ATNKYAKRQKTWLCHQFQADW 207
           AT +YAKRQ TW  HQ   DW
Sbjct: 267 ATRQYAKRQITWFRHQLGPDW 287


>gi|127511499|ref|YP_001092696.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           loihica PV-4]
 gi|166216988|sp|A3QAD9|MIAA_SHELP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|126636794|gb|ABO22437.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Shewanella
           loihica PV-4]
          Length = 308

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 116/210 (55%), Gaps = 2/210 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
                  P++VGGT LYF+AL   LS +P    AIR +I ++++  G   LHDEL  +D 
Sbjct: 92  ILAAGKTPLLVGGTMLYFKALLEGLSPLPSADEAIRAEIAKEVEAKGWQALHDELRQIDP 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A +IHP+D QR++RA+E+  +SG+S+ E   Q     +P +     I   +R  L   
Sbjct: 152 VSADRIHPNDPQRLSRAIEVYRISGKSLTEL-TQVKAEALPYKVVQFGIAPKDRKVLHLA 210

Query: 128 IRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I  RF  ML  G ++E++ L    +L LDLP M+ +G R +   L GE +YD  +++ I+
Sbjct: 211 IAERFKLMLNQGFVEEVQRLKARADLHLDLPSMRCVGYRQVWQYLDGEYDYDTMVEKSIV 270

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           AT + AKRQ TWL      +W+      +L
Sbjct: 271 ATRQLAKRQLTWLRGWADLNWLESGDESNL 300


>gi|302670848|ref|YP_003830808.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
           [Butyrivibrio proteoclasticus B316]
 gi|302395321|gb|ADL34226.1| tRNA delta(2)-isopentenylpyrophosphate transferase MiaA
           [Butyrivibrio proteoclasticus B316]
          Length = 312

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/216 (30%), Positives = 113/216 (52%), Gaps = 3/216 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           ++ + +     +  +PIIVGGTG Y +A+   +     +   + R  + E++K  G H L
Sbjct: 79  LVKEAIADISSRGKVPIIVGGTGFYIQAVLYDIDFTETDEDDSYRHILEERVKTEGVHAL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+EL ++D + A  IH ++ +R+ RALE    +G+ I E  ++      P +  + ++  
Sbjct: 139 HEELRAVDPVSADMIHENNSKRVIRALEYFHKTGRPISEHNEEQHQRLSPYDFRYFVLTD 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            ER  L  RI +R  QM+E G +DE++SL K N+      M+++G R+I+  L GE + +
Sbjct: 199 -ERKTLYSRIDKRVDQMIEDGLVDEVKSLEKYNIPRAATSMQSLGYREILGYLDGEYDLE 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
             +    + T  +AKRQ TW   +    WI  +  D
Sbjct: 258 RAIYLIKLNTRHFAKRQLTWFRREKDVIWIDKNEFD 293


>gi|291546136|emb|CBL19244.1| tRNA isopentenyltransferase (miaA) [Ruminococcus sp. SR1/5]
          Length = 317

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 111/216 (51%), Gaps = 3/216 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  + ++  Y K  +PI+VGGTG Y +A+T  +           R ++ E  +Q G   L
Sbjct: 80  MAKEAMEKIYDKGRIPILVGGTGFYIQAVTRDIDFTSSNQDDHYRRELEELAEQKGPSFL 139

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           HD L+ +D   A+ IH ++ +R+ RALE    +G  I E  ++      P   A+ ++  
Sbjct: 140 HDMLAQVDPKSAQDIHENNVKRVIRALEFYKQNGTRISEHNEEQKEHTSPYALAYFVLNA 199

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
           P R  L ERI  R  +ML++G ++E++ L +M     +  M+ +G ++I+  + GE  Y+
Sbjct: 200 P-RPLLYERIDTRVDEMLKNGLVEEVKKLREMGCHRGMVSMQGLGYKEILDWMDGEYPYE 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T  +AKRQ TW   + +  W+   + D
Sbjct: 259 EAVRILKRDTRHFAKRQLTWFRREDEVTWVDKDNFD 294


>gi|325924509|ref|ZP_08186028.1| tRNA isopentenyltransferase MiaA [Xanthomonas gardneri ATCC 19865]
 gi|325545004|gb|EGD16339.1| tRNA isopentenyltransferase MiaA [Xanthomonas gardneri ATCC 19865]
          Length = 327

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 108/211 (51%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE    +R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSQLPEADPQVRLTIAAEAEQLGWAALHAQLAQVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PIAAARIHSTDPQRIQRALEVYRISGRPISYWQALPPGPRLPVRVLKVVLAPRERAVLHT 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL------SLDLPIMKAIGVRDIIALLKGEINYDET 180
           RI +R   ML    + E+  L  +         LDLP ++A+G R     L G  +  + 
Sbjct: 211 RIEQRLDAMLAQDFLAEVERLRALPQLRAVAAPLDLPAIRAVGYRHAWEYLDGAGSLAQF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
            ++ I AT + AKRQ TWL  +  A W    
Sbjct: 271 REKAIHATRQLAKRQLTWLRGELDARWFDPE 301


>gi|330501622|ref|YP_004378491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina NK-01]
 gi|328915908|gb|AEB56739.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           mendocina NK-01]
          Length = 323

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 119/217 (54%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP    AIR ++  +    G  +LH EL+++D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPSADPAIRAELEARALAEGWDVLHRELAAVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI----------PLESAHKIIILPE 120
            +IH +D QR+ RALE+  VSG S+ E  ++                P   A   I   +
Sbjct: 153 ARIHRNDPQRLTRALEVYRVSGLSMTEHRRRQAAGNPDTGTSGGGQLPYTVAQLAIAPAQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L +RI +RF  MLE G ++E+ +L    +L   LP ++A+G R +   L GE++ ++
Sbjct: 213 RQILHDRIAQRFRAMLEQGFVEEVEALRSRSDLHAGLPSIRAVGYRQVWEYLDGELSREQ 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            ++RG+IAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MVERGVIATRQLAKRQFTWLRGWDGLHWLDSLACDNL 309


>gi|95931316|ref|ZP_01314031.1| tRNA isopentenyltransferase [Desulfuromonas acetoxidans DSM 684]
 gi|95132617|gb|EAT14301.1| tRNA isopentenyltransferase [Desulfuromonas acetoxidans DSM 684]
          Length = 301

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 106/210 (50%), Gaps = 2/210 (0%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           ++  + +++  LP++VGGTGLY RALT  L  +P    A+R +  ++ +   +  L+  L
Sbjct: 87  ARIKEIHQRGHLPLVVGGTGLYIRALTDGLLDLPGENEALRREFLDE-EALCAGTLYHRL 145

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
              D  +A+++HP+D  RI RALE+  ++G  + ++  +      P     K+ +  +R+
Sbjct: 146 QGCDPQMAQRLHPNDVTRIVRALEVFELTGTPLSQWQLEHGFKEQPYRVL-KVAVGMDRA 204

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L +RI RR   M++ G + E R L+    S  L  M+ IG    +  ++ E+  +  + 
Sbjct: 205 ELYDRINRRVMLMMDQGLVVETRQLLDRGYSPQLKSMRTIGYEQAVRYVQNELTREAAIA 264

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISS 212
                T +YAKRQ TW        W+   S
Sbjct: 265 DIQQETRRYAKRQLTWFRKDKSIIWVDYDS 294


>gi|85859790|ref|YP_461992.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophus
           aciditrophicus SB]
 gi|123516899|sp|Q2LUR0|MIAA2_SYNAS RecName: Full=tRNA dimethylallyltransferase 2; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 2; Short=DMAPP:tRNA
           dimethylallyltransferase 2; Short=DMATase 2; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           2; Short=IPP transferase 2; Short=IPPT 2; Short=IPTase 2
 gi|85722881|gb|ABC77824.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Syntrophus
           aciditrophicus SB]
          Length = 311

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 110/210 (52%), Gaps = 1/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +K+    I+VGGTGLY RA+ G L   P    A+R      L++ G   L+  L + D
Sbjct: 92  ELHKRGKKIIVVGGTGLYIRAVLGGLFDGPAADEALRRHYFTILEREGKAGLYGMLKARD 151

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  IHP+D  R+ RALE+  ++G SI+E  ++      P     KI +   RS L E
Sbjct: 152 RRAAAIIHPNDTTRMIRALEVLDLTGVSIVEQQQEHRFAQRPYRVL-KIGLRCSRSVLYE 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R  +ML  G +DE+R L+ M     L  M+A+G R ++  LKGE++ DE + +   
Sbjct: 211 RIEARTEEMLAQGFLDEVRQLLDMGFHEGLRPMQALGYRQMVGFLKGELDLDEAVDQLKR 270

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T +YAKRQ TW     +  W    + +++
Sbjct: 271 ETRRYAKRQLTWFGADPEIRWFEPGNEEEI 300


>gi|86148235|ref|ZP_01066532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           MED222]
 gi|218708322|ref|YP_002415943.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus LGP32]
 gi|239977474|sp|B7VI54|MIAA_VIBSL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|85834005|gb|EAQ52166.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           MED222]
 gi|218321341|emb|CAV17291.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio
           splendidus LGP32]
          Length = 310

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 121/214 (56%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +S+  +   +  +P++VGGT LY++AL   LS +P     IR++I  +  + G   LHD+
Sbjct: 85  ISEMNKIVAEGKIPLLVGGTMLYYKALLEGLSPLPAADQEIRKQIEAESIEQGWQALHDQ 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   ER
Sbjct: 145 LREIDPVSAERIHPNDPQRLSRALEVYRISGKTLTEL-TQTKGDSLPFRVKQFAIAPKER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF +M+E+G  DE+++L  + +L  +LP ++ +G R +   L G  + DE 
Sbjct: 204 KELHRRIELRFEKMIEAGFEDEMKALYAREDLHPELPSIRCVGYRQMWDYLDGNCDLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+   +I+
Sbjct: 264 VFRGVCATRQLAKRQITWLRSWDDLTWLDSENIE 297


>gi|149910177|ref|ZP_01898823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moritella sp.
           PE36]
 gi|149806763|gb|EDM66727.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moritella sp.
           PE36]
          Length = 311

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 71/206 (34%), Positives = 116/206 (56%), Gaps = 2/206 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGT LYF+ L   LS +P    AIR+ I  + K  G   LH ELS  D   A 
Sbjct: 99  GKIPLLVGGTMLYFKVLLEGLSPVPTSVPAIRQAIEAEAKLRGWESLHHELSLYDPESAA 158

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           ++H +D QR+ RA+E+  ++G+S+ E   Q     +P + +   I   +++ L ERI +R
Sbjct: 159 RLHKNDAQRVCRAVEVYRLTGKSLTEL-TQQKGESLPYDVSQFAIAPTDKAVLHERIEQR 217

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F  M+E+G   E+++L + +      P M+ +G R +   L G++++DE + RG++AT +
Sbjct: 218 FKLMIEAGFETEVQALHQRDDLHLDLPSMRCVGYRQMWEYLDGKMDHDEMVFRGVVATRQ 277

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDL 216
            AKRQ TWL       W+   + D+L
Sbjct: 278 LAKRQMTWLKSWNDLTWLDSKADDNL 303


>gi|116252992|ref|YP_768830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|239977441|sp|Q1ME89|MIAA_RHIL3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115257640|emb|CAK08737.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 297

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 94/200 (47%), Positives = 134/200 (67%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MPEIP  +REK+R +L Q G   LH EL+  D  +A 
Sbjct: 97  GRLPVFVGGTGLYFKALTGGLSDMPEIPETLREKLRTRLLQEGPDGLHAELAVADPAMAA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI +F  ++    I    A KI++LP+R+ L +RI  R
Sbjct: 157 SLNRQDGQRIVRALEVMKATGRSIADFQGRSGPVIIDAAEARKIVVLPDRAVLHQRINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA DE+R+L+ +++  + P+MKAIGV  I+A+L+GE+   E L++G  AT +Y
Sbjct: 217 FEKMLQQGAEDEVRALLALDMPAEAPVMKAIGVSQIVAMLRGEMTRGEVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRIS 211
           AKRQ TW  +Q    W R++
Sbjct: 277 AKRQMTWFRNQMDDSWERLT 296


>gi|241761987|ref|ZP_04760071.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
 gi|241373453|gb|EER63040.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ATCC 10988]
          Length = 283

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 119/217 (54%), Gaps = 7/217 (3%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K++   ++   LPI+VGGTGLY R L   ++ +P+I   +RE++R           +
Sbjct: 58  LAKKEIKNAHESGRLPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSM----SVEDAY 113

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L   D + A ++ P+D  RI RALE+   +G  +  + ++              +I+P
Sbjct: 114 SALQQEDPMAADRLRPTDKTRIMRALEVMRSTGHPLHYWQQKKTGGIANEIKLQSFVIIP 173

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+ R  +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++GEI+   
Sbjct: 174 PANILRSRCDKRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRGEIDRLT 233

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +++   AT +YAKRQ+TW  HQ    WI+I   DD+
Sbjct: 234 MIEKAKAATRQYAKRQRTWFRHQTDESWIKI--FDDI 268


>gi|189424058|ref|YP_001951235.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           lovleyi SZ]
 gi|239977142|sp|B3E5Z1|MIAA1_GEOLS RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|189420317|gb|ACD94715.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           lovleyi SZ]
          Length = 305

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 63/199 (31%), Positives = 111/199 (55%), Gaps = 1/199 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++   PI+ GGTGLY RAL   L+  P     +RE +R++L+  G+  L  EL+ +D   
Sbjct: 90  QRGKRPILAGGTGLYLRALLRGLNDAPGEDPVLRETLRKRLECEGAETLLAELAKVDPDT 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           ++++HP++  RI RALE+   +G  + +F  +      P +S    + LP R  L +RI 
Sbjct: 150 SQRLHPNNRNRIIRALEVFQTTGIPLSQFQAEHGFADSPYDSLQFCLDLP-RPELYQRID 208

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   ML +G + E++ L++  +  D   ++AIG ++++A L+GE +++E ++     T 
Sbjct: 209 DRVDAMLAAGLVAEVQGLLQSGVPADCKPLQAIGYKEVLAHLQGEYDHNEMVRLIKRNTR 268

Query: 190 KYAKRQKTWLCHQFQADWI 208
            +AKRQ TW   +    W+
Sbjct: 269 HFAKRQLTWFRSEPAMQWV 287


>gi|327189898|gb|EGE57029.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CNPAF512]
          Length = 297

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 93/201 (46%), Positives = 133/201 (66%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MPEIP  +RE++R +L   G   LH EL ++D  ++ 
Sbjct: 97  GQLPVFVGGTGLYFKALTGGLSDMPEIPEELREELRTRLIAEGPEGLHAELEAIDPAMSA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI EF ++     I  + A KI++LP+R+ L  RI  R
Sbjct: 157 SLNRQDGQRIVRALEVIKATGRSITEFQRRRGPVLIDTDKARKIVVLPDRAVLHARINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA DE+R+L+ + L ++ P+MKAIGV  I A+LK E+  +E L++G  AT +Y
Sbjct: 217 FEKMLQQGAEDEVRALLALGLPVEAPVMKAIGVSQIAAMLKDEMTREEVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRISS 212
           AKRQ TW  +Q    W R++ 
Sbjct: 277 AKRQMTWFRNQMDESWERLAP 297


>gi|166712460|ref|ZP_02243667.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzicola BLS256]
          Length = 327

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 77/211 (36%), Positives = 107/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A+R  I  +  Q G   LH EL+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSHLPEADRAVRASIAAEAAQIGWAGLHSELARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGPRLPVRVLKVVLAPRERAVLHG 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI RR   ML  G + E+  +  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIERRLDAMLAQGFLAEVEQVRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|322515246|ref|ZP_08068244.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           ureae ATCC 25976]
 gi|322118751|gb|EFX90957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           ureae ATCC 25976]
          Length = 314

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++VGGT LY++AL   LS +P    AIR +I  K +Q G   LH E
Sbjct: 84  LREMAEITASGRIPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIEAKAEQIGWSSLHRE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 144 LLTIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L  RI +RF +M+E G   E+  L          P ++ +G R +   L G+I+ DE 
Sbjct: 203 QVLHHRIEQRFHKMMELGFQQEVEKLHARGDLHKDLPSIRCVGYRQMWEHLDGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIR 209
           + +GI AT + AKRQ TWL     + +W+ 
Sbjct: 263 VYKGICATRQLAKRQITWLRGWGSEIEWLD 292


>gi|219871387|ref|YP_002475762.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis SH0165]
 gi|239977381|sp|B8F662|MIAA_HAEPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219691591|gb|ACL32814.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis SH0165]
          Length = 314

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 75/218 (34%), Positives = 120/218 (55%), Gaps = 3/218 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 83  LREMADITAQGKIPLLVGGTMLYYKALLDGLSPLPSADPDIRAEIEAKAEQIGWAGLHQE 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I A++I+P+D QRI RALE+  +SG+++ E   Q     IP E     I+  ER
Sbjct: 143 LVNIDPISAKRINPNDSQRINRALEVFYISGKTMTELTAQQGE-AIPYEIMQFAIVPQER 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+  G   E+R L +        P ++ +G R +   L+G+ + DE 
Sbjct: 202 AVLHQRIEQRFHKMINLGFEQEVRRLYQRGDLNVDLPSIRCVGYRQMWEYLEGQTSLDEA 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSIDDLF 217
           + +GI AT + AKRQ TWL     + +W+     ++ +
Sbjct: 262 IFKGICATRQLAKRQITWLRGWTSEIEWLDSLDPENSY 299


>gi|251788131|ref|YP_003002852.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya zeae
           Ech1591]
 gi|247536752|gb|ACT05373.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Dickeya zeae
           Ech1591]
          Length = 313

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 80/203 (39%), Positives = 115/203 (56%), Gaps = 2/203 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGT LYF+AL   LS +P     +R++I E+ +  G   LH +LS +D + A 
Sbjct: 99  GRIPLLVGGTMLYFKALLEGLSPLPSADARVRQEIEERARNEGWEALHRQLSVIDPVAAA 158

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           +IHP+D QR++RALE+  VSG ++ E   +     +P       I    R  L ERI  R
Sbjct: 159 RIHPNDPQRLSRALEVFFVSGNTLTEL-TKTSGEALPYRVHQFAIAPATRELLHERIALR 217

Query: 132 FTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F QMLESG   E R+L  + +L+  LP ++ +G R + + L GEI+YDE + RGI AT +
Sbjct: 218 FRQMLESGFEAEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQ 277

Query: 191 YAKRQKTWLCHQFQADWIRISSI 213
            AKRQ TWL       W+     
Sbjct: 278 LAKRQMTWLRGWEAVRWLDSDQP 300


>gi|125973293|ref|YP_001037203.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum ATCC 27405]
 gi|281417497|ref|ZP_06248517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum JW20]
 gi|166198903|sp|A3DDI1|MIAA_CLOTH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|125713518|gb|ABN52010.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum ATCC 27405]
 gi|281408899|gb|EFB39157.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum JW20]
          Length = 313

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 108/216 (50%), Gaps = 3/216 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHIL 58
           +  K + +   K  LPI+ GGTGLY  +L   L     I    +R+K+ ++ K+ G+  L
Sbjct: 79  LALKYIDEILSKGKLPIVAGGTGLYINSLIYNLEFSDTICDWELRKKLEQEAKEKGNEYL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D   A +IH ++ +R+ RA+E+   + + I     +      P  +   I I 
Sbjct: 139 HNKLKEIDPKAAEKIHMNNVKRVIRAIEVYTYTKKPISVHQ-EESRKNPPRHNFILIGIT 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R   MLE G + E+  L++M        M+ +G ++I++ L+GE + D
Sbjct: 198 MDREKLYDRINKRVDLMLEKGLVKEVEKLVEMGYDKSTIAMQGLGYKEILSYLRGERSLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T +YAKRQ TW        WI     D
Sbjct: 258 EAVEILKRDTRRYAKRQMTWFRKIENVYWINKDEFD 293


>gi|256003773|ref|ZP_05428761.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum DSM 2360]
 gi|255992334|gb|EEU02428.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum DSM 2360]
 gi|316940475|gb|ADU74509.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           thermocellum DSM 1313]
          Length = 313

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 108/216 (50%), Gaps = 3/216 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHIL 58
           +  K + +   K  LPI+ GGTGLY  +L   L     I    +R+K+ ++ K+ G+  L
Sbjct: 79  LALKYIDEILSKGKLPIVAGGTGLYINSLIYNLEFSDTICDWELRKKLEQEAKEKGNEYL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D   A +IH ++ +R+ RA+E+   + + I     +      P  +   I I 
Sbjct: 139 HNKLKEIDPKAAEKIHMNNVKRVIRAIEVYTYTKKPISVHQ-EESRKNPPRHNFILIGIT 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R   MLE G + E+  L++M        M+ +G ++I++ L+GE + D
Sbjct: 198 MDREKLYDRINKRVDLMLEKGLVKEVEKLVEMGYDKSTIAMQGLGYKEILSYLRGERSLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T +YAKRQ TW        WI     D
Sbjct: 258 EAVEILKRDTRRYAKRQMTWFRKIENVYWINKDEFD 293


>gi|238924110|ref|YP_002937626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Eubacterium
           rectale ATCC 33656]
 gi|238875785|gb|ACR75492.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Eubacterium
           rectale ATCC 33656]
          Length = 328

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 110/215 (51%), Gaps = 3/215 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K L + Y+   +PI+VGGTG Y +AL   +     ++  + R+ + +   ++G+H L
Sbjct: 92  MAKKALNEIYEAGKIPIVVGGTGFYIQALLYDIDFTKQDVDESYRKSLYDFANEHGNHAL 151

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D      IH ++ +R+ RA+E      + I +  +       P   A+ ++  
Sbjct: 152 HEKLKDIDPASYESIHENNVKRVIRAIEYYHTCHEPISKHNETERAKQSPYSFAYFVLDD 211

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             +    ERI +R   M+ +G ++E++ L  M  + D+  MK IG ++I+A L GE + D
Sbjct: 212 VRQRL-YERIDKRVDIMVSNGLVNEVKKLKAMGCTSDMVSMKGIGYKEILAYLDGEYSLD 270

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E + +  + + ++AKRQ TW   +    WI  +  
Sbjct: 271 EAVDKVKLESRRFAKRQLTWFRREKDTIWIEKNEY 305


>gi|153853165|ref|ZP_01994574.1| hypothetical protein DORLON_00559 [Dorea longicatena DSM 13814]
 gi|149753951|gb|EDM63882.1| hypothetical protein DORLON_00559 [Dorea longicatena DSM 13814]
          Length = 314

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 107/216 (49%), Gaps = 3/216 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHIL 58
           M  K ++  Y    +PIIVGGTG Y +AL   +           R+ +    K+ G+  L
Sbjct: 81  MAKKAMEQIYANGHIPIIVGGTGFYIQALLYDIDFTSTSQDDNYRQDLENLAKEKGAEYL 140

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L  +D   A  IH ++ +R+ RALE    +GQ +    ++      P E  + ++  
Sbjct: 141 HNMLREIDPKSAEDIHANNIKRVIRALEYYHQTGQKMSRHNEEERQKESPYEFVYFVLNA 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
           P R  L +RI RR  QM+  G ++E++ L +M  + ++  M+ +G ++I+A L GE   D
Sbjct: 201 P-REQLYQRIDRRVDQMMSEGLVEEVKRLKEMGCTKEMVSMQGLGYKEILAYLDGEYALD 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E +      T  +AKRQ TW   + Q  WI+    D
Sbjct: 260 EAVYTIKRDTRHFAKRQLTWFRRERQVTWIQKEKYD 295


>gi|237809129|ref|YP_002893569.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tolumonas
           auensis DSM 9187]
 gi|259495773|sp|C4L9N0|MIAA_TOLAT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|237501390|gb|ACQ93983.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tolumonas
           auensis DSM 9187]
          Length = 310

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 116/215 (53%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR+ I  +    G   LH +
Sbjct: 86  LREIETIVAQGRIPLLVGGTMLYYKALLEGLSPLPAADPLIRQAIEAEASLSGWEALHAQ 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L S+D + A +IHP+D QR++RALE+  +SGQ++ E   Q     +P  +    I   +R
Sbjct: 146 LQSIDPVAAARIHPNDPQRLSRALEVYRISGQTLTEL-TQTKGEQLPYRTLQFAIAPTDR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L++RI  RF  ML  G   E+R+L          P ++ +G R +   L G+I+YDE 
Sbjct: 205 ELLRQRIAERFHLMLSQGFEQEVRALYDRGDLNADLPSIRCVGYRQMWEYLDGQISYDEM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + RGI+AT + AKRQ TWL       W+   +I++
Sbjct: 265 VYRGIVATCQLAKRQMTWLRSWQNVTWLETGAINN 299


>gi|311030167|ref|ZP_07708257.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           m3-13]
          Length = 316

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 107/213 (50%), Gaps = 4/213 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDE 61
           +K  +   +  +PIIVGGTGLY +++               R ++ ++ ++ G   LH E
Sbjct: 85  NKIDEISSRGRIPIIVGGTGLYIQSVLYDYQFSESGKDEETRLRLEKRSQEIGVDKLHQE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D   A  IHP++ +R+ RALEI   +G+++ E+          L     I +  +R
Sbjct: 145 LTDIDPKSAANIHPNNVRRVIRALEIFYTTGKTMSEYQDTQQPES--LYDIALIGLTMDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI  R   M++ G + E+++L    +      ++AIG +++ A L G++  ++ +
Sbjct: 203 ERLYERINLRVDLMMKEGLLREVQTLHNNGIRDCQS-IQAIGYKELYAYLDGKVTLEQAV 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
                 + +YAKRQ TW  ++    WI ++  D
Sbjct: 262 DDLKQNSRRYAKRQLTWFRNKMDVTWIDMTDGD 294


>gi|294626634|ref|ZP_06705231.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292599054|gb|EFF43194.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 327

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 107/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   ++R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGRLPILAGGTGLYFRALLDGLSHLPEADQSVRASIAAEAQQIGWAGLHAQLAGVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVRVLKVVLAPRERAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML    + E+R L  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIAHRLDAMLAQDFLAEVRRLRALPQIQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|21242483|ref|NP_642065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|25008755|sp|Q8PLQ5|MIAA_XANAC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21107931|gb|AAM36601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 327

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 107/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A+R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGRLPILAGGTGLYFRALLEGLSQLPEADQAVRASIAAEAQQIGWAGLHAQLARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVRVLKVVLAPRERAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML    + E+R L  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIAHRLDAMLAQDFLTEVRRLRALPQLQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|56419847|ref|YP_147165.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus
           kaustophilus HTA426]
 gi|61213913|sp|Q5L0D9|MIAA_GEOKA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56379689|dbj|BAD75597.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) [Geobacillus kaustophilus HTA426]
          Length = 315

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 62/207 (29%), Positives = 103/207 (49%), Gaps = 4/207 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LPIIVGGTGLY +A              A R  +++   + G+  LH  L ++
Sbjct: 87  EISARGRLPIIVGGTGLYIQAALYDYQFSAAPSDEAYRRALKQLAAEQGAEALHRRLEAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D I A +IHP + +R+ RALE+   +G+   E+ +        L  A  + +  ER AL 
Sbjct: 147 DPISAARIHPHNIRRVIRALEVYHCTGKPFSEWQQGQSKRL--LYEAAIVGLTAEREALY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+ +G I+E R+L    L     + +AIG +++     G ++ DE +++  
Sbjct: 205 RRINERVDEMIAAGLIEEARALYDRGLRDCQAV-QAIGYKELYDYFDGRVSLDEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
             + +YAKRQ TW  +Q    W  ++ 
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVKWFDMTD 290


>gi|237745901|ref|ZP_04576381.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes HOxBLS]
 gi|229377252|gb|EEO27343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes HOxBLS]
          Length = 313

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  ++  LP++ GGT LYF+ALTG L  +P    AIR ++ E+  + G   +H  L+ LD
Sbjct: 90  EIQQRGKLPLLAGGTMLYFKALTGGLDELPPANPAIRARLDEEAARTGWPAMHKRLAELD 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I AR++ P+D QRI RALEI  ++G+ +  F        +P       +   +RS L E
Sbjct: 150 PITARRLKPNDSQRIQRALEIIELTGKPLSTFHSGEKQTRLPFRLIPIALEPSDRSKLHE 209

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF QMLE+  + E  + ++    L   +P M+ +G R     L GE +      +G
Sbjct: 210 RIAHRFDQMLENDRLIEEVAHLRSRDDLHPGMPSMRCVGYRQTWQYLDGEFDRKTLRDKG 269

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           I AT + AKRQ TWL        I   + D
Sbjct: 270 IAATRQLAKRQLTWLRSMPDRITIDCLAPD 299


>gi|190892521|ref|YP_001979063.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CIAT 652]
 gi|239977440|sp|B3PTP8|MIAA_RHIE6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190697800|gb|ACE91885.1| tRNA delta(2)-isopentenylpyrophosphate transferase protein
           [Rhizobium etli CIAT 652]
          Length = 297

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 93/201 (46%), Positives = 131/201 (65%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MPEIP  +RE++R +L   G   LH EL ++D  ++ 
Sbjct: 97  GQLPVFVGGTGLYFKALTGGLSDMPEIPEGLREELRMRLVAEGPEGLHAELEAIDPAMSA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI EF ++     I  + A KI++LP+R+ L  RI  R
Sbjct: 157 SLNRQDGQRIVRALEVIKATGRSIAEFHRRLGPVLIDADEARKIVVLPDRAVLHARINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA  E+R+L+ + L    P+MKAIGV  I A+LKGE+  +E L++G  AT +Y
Sbjct: 217 FEKMLQQGAESEVRALLALGLPAVAPVMKAIGVSQITAMLKGEMTREEVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRISS 212
           AKRQ TW  +Q    W R++ 
Sbjct: 277 AKRQMTWFRNQMDESWERLAP 297


>gi|254719425|ref|ZP_05181236.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|265984429|ref|ZP_06097164.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|306839201|ref|ZP_07472018.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp. NF
           2653]
 gi|264663021|gb|EEZ33282.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           83/13]
 gi|306405748|gb|EFM62010.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp. NF
           2653]
          Length = 310

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 92/207 (44%), Positives = 135/207 (65%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSIRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 ATLQPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|110803443|ref|YP_698495.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens SM101]
 gi|123146165|sp|Q0STR2|MIAA_CLOPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110683944|gb|ABG87314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens SM101]
          Length = 310

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 112/218 (51%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L ERI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYERINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIR---ISSIDDL 216
           +     +  YAKRQ TW     +A +I     SS +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFSSEEDI 299


>gi|297530512|ref|YP_003671787.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           C56-T3]
 gi|297253764|gb|ADI27210.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           C56-T3]
          Length = 315

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 62/207 (29%), Positives = 103/207 (49%), Gaps = 4/207 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LPIIVGGTGLY +A              A R  +++   + G+  LH  L ++
Sbjct: 87  EISARGRLPIIVGGTGLYIQAALYDYQFSAAPSDEAYRRALKQLAAEQGAEALHRRLEAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D I A +IHP + +R+ RALE+   +G+   E+ +        L  A  + +  ER AL 
Sbjct: 147 DPISAARIHPHNIRRVIRALEVYHCTGKPFSEWQQGQSKRL--LYEAAIVGLTAEREALY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+ +G I+E R+L    L     + +AIG +++     G ++ DE +++  
Sbjct: 205 RRINERVDEMIAAGLIEEARALYDRGLRDCQAV-QAIGYKELYDYFDGRVSLDEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
             + +YAKRQ TW  +Q    W  ++ 
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVKWFDMTD 290


>gi|294665637|ref|ZP_06730914.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292604583|gb|EFF47957.1| tRNA delta 2 -isopentenylpyrophosphate transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 327

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 75/211 (35%), Positives = 107/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   ++R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGRLPILAGGTGLYFRALLDGLSHLPEADQSVRASIAAEAQQIGWAGLHAQLAGVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++    R+ L E
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVRVLKVVLAPRARAVLHE 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML    + E+R L  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIAHRLDAMLAQDFLAEVRRLRALPQIQAVAAPLDLPAVRAVGYRQAWQYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|254714428|ref|ZP_05176239.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
 gi|254717325|ref|ZP_05179136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261219154|ref|ZP_05933435.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261322216|ref|ZP_05961413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
 gi|260924243|gb|EEX90811.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M13/05/1]
 gi|261294906|gb|EEX98402.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M644/93/1]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 91/207 (43%), Positives = 134/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|110800286|ref|YP_695806.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens ATCC 13124]
 gi|168214983|ref|ZP_02640608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens CPE str. F4969]
 gi|182626355|ref|ZP_02954110.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens D str. JGS1721]
 gi|123049874|sp|Q0TRD4|MIAA_CLOP1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110674933|gb|ABG83920.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens ATCC 13124]
 gi|170713604|gb|EDT25786.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens CPE str. F4969]
 gi|177908374|gb|EDT70919.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens D str. JGS1721]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
           +     +  YAKRQ TW     +A +I      S +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDI 299


>gi|307825899|ref|ZP_07656114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylobacter
           tundripaludum SV96]
 gi|307733018|gb|EFO03880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylobacter
           tundripaludum SV96]
          Length = 317

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 75/201 (37%), Positives = 116/201 (57%), Gaps = 1/201 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++  +PI+VGGT LYF  L   L+++PE    IR K+ + L+Q G  +LH  L+ +D
Sbjct: 91  DITRRGKIPILVGGTMLYFNVLNSGLAVLPEADADIRAKLDQDLEQLGKEVLHSRLADID 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IHP+D QR+ RALE+  +SG+ +  F+  A    IP +    +I   +R+ L +
Sbjct: 151 PESAARIHPNDPQRVQRALEVYEISGKPLTSFFTAAQAQVIPYQKIKLVIAPQDRAILHD 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            I  RF QMLE G IDE+ +L K    +  +P ++A+G R   + L+GE + +   ++ I
Sbjct: 211 LIACRFKQMLEQGFIDEVEALYKRGDLTEKMPSIRAVGYRQAWSYLQGEYDLETMTEKAI 270

Query: 186 IATNKYAKRQKTWLCHQFQAD 206
           IAT + AKRQ TWL  +  A 
Sbjct: 271 IATRQLAKRQFTWLRRETDAT 291


>gi|148560416|ref|YP_001259286.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ovis
           ATCC 25840]
 gi|161619337|ref|YP_001593224.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella canis
           ATCC 23365]
 gi|163843645|ref|YP_001628049.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           ATCC 23445]
 gi|225627843|ref|ZP_03785880.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           str. Cudo]
 gi|254702113|ref|ZP_05163941.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|254704650|ref|ZP_05166478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|254708065|ref|ZP_05169893.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|254710436|ref|ZP_05172247.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|256031929|ref|ZP_05445543.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|256061450|ref|ZP_05451594.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|256160127|ref|ZP_05457821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|256255333|ref|ZP_05460869.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|256369806|ref|YP_003107317.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           microti CCM 4915]
 gi|260169065|ref|ZP_05755876.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           F5/99]
 gi|260566104|ref|ZP_05836574.1| tRNA isopentenyltransferase [Brucella suis bv. 4 str. 40]
 gi|261222534|ref|ZP_05936815.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|261315566|ref|ZP_05954763.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261318005|ref|ZP_05957202.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|261325456|ref|ZP_05964653.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|261752683|ref|ZP_05996392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|261755343|ref|ZP_05999052.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|261758569|ref|ZP_06002278.1| tRNA isopentenyltransferase [Brucella sp. F5/99]
 gi|265989035|ref|ZP_06101592.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|265998499|ref|ZP_06111056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|294852717|ref|ZP_06793390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           NVSL 07-0026]
 gi|166201470|sp|A5VRD9|MIAA_BRUO2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081944|sp|A9M648|MIAA_BRUC2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081945|sp|B0CHH8|MIAA_BRUSI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148371673|gb|ABQ61652.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ovis
           ATCC 25840]
 gi|161336148|gb|ABX62453.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella canis
           ATCC 23365]
 gi|163674368|gb|ABY38479.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           ATCC 23445]
 gi|225617848|gb|EEH14893.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           str. Cudo]
 gi|255999969|gb|ACU48368.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           microti CCM 4915]
 gi|260155622|gb|EEW90702.1| tRNA isopentenyltransferase [Brucella suis bv. 4 str. 40]
 gi|260921118|gb|EEX87771.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           B1/94]
 gi|261297228|gb|EEY00725.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis B2/94]
 gi|261301436|gb|EEY04933.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           neotomae 5K33]
 gi|261304592|gb|EEY08089.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261738553|gb|EEY26549.1| tRNA isopentenyltransferase [Brucella sp. F5/99]
 gi|261742436|gb|EEY30362.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 5 str. 513]
 gi|261745096|gb|EEY33022.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           bv. 3 str. 686]
 gi|262553123|gb|EEZ08957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella ceti
           M490/95/1]
 gi|264661232|gb|EEZ31493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           pinnipedialis M292/94/1]
 gi|294821306|gb|EFG38305.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           NVSL 07-0026]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 91/207 (43%), Positives = 134/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|163802744|ref|ZP_02196634.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           AND4]
 gi|159173451|gb|EDP58273.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Vibrio sp.
           AND4]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LY++AL   LS +P     IR++I  +    G  +LHDEL  +D
Sbjct: 90  DIVAEGKIPLLVGGTMLYYKALLEGLSPLPAANPEIRQQIEREALTKGWSVLHDELKEID 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IHP+D QR++RALE+  +SG+++ E   Q     +P       I   +R+ L  
Sbjct: 150 PVSAVRIHPNDPQRLSRALEVFRISGKTLTEL-TQKKGDSLPYRVKQFAIAPKDRAELHR 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF +M+E+G  +E+  L          P ++ +G R +   L G+   DE + RGI
Sbjct: 209 RIEQRFDKMMEAGFEEEMNVLYARKDLHPDLPSIRCVGYRQMWEYLDGDCTRDEAIFRGI 268

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
            AT + AKRQ TWL       W+   +I
Sbjct: 269 CATRQLAKRQITWLRSWNDLTWLDSENI 296


>gi|23502261|ref|NP_698388.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           1330]
 gi|38258118|sp|Q8CY40|MIAA_BRUSU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|23348234|gb|AAN30303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella suis
           1330]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 91/207 (43%), Positives = 134/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|254787457|ref|YP_003074886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Teredinibacter
           turnerae T7901]
 gi|237685337|gb|ACR12601.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Teredinibacter
           turnerae T7901]
          Length = 323

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 67/205 (32%), Positives = 107/205 (52%), Gaps = 2/205 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
                   P++VGGT LYF+AL   LS MP    A+R +I ++    G   +H  L  +D
Sbjct: 92  NIVAAGRTPLLVGGTMLYFKALLEGLSDMPASQPAVRAQIEQEALAIGWPGMHQHLMDID 151

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILPERSALK 125
              AR++HP+   RI+RALE+  +SG+++  F   + +  +   +     +   +R+ L 
Sbjct: 152 PETARELHPNHSHRISRALEVYRISGKTMSHFRANSGSGLLDSYQWVQLAVAPRDRAVLH 211

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRG 184
           +RI  RF  ML++G + E+ +L +        P ++A+G R +   L GEI+  E + RG
Sbjct: 212 QRIATRFENMLDAGLLGEVEALYRRGDLHPDLPAIRAVGYRQVWEYLSGEIDRSEMVARG 271

Query: 185 IIATNKYAKRQKTWLCHQFQADWIR 209
           + AT + AKRQ TWL       WI 
Sbjct: 272 VAATRQLAKRQLTWLRGWPDLCWID 296


>gi|261419518|ref|YP_003253200.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y412MC61]
 gi|319766334|ref|YP_004131835.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y412MC52]
 gi|261375975|gb|ACX78718.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y412MC61]
 gi|317111200|gb|ADU93692.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y412MC52]
          Length = 314

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 62/207 (29%), Positives = 103/207 (49%), Gaps = 5/207 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LPIIVGGTGLY +A              A R  +++   + G+  LH  L ++
Sbjct: 87  EISARGRLPIIVGGTGLYIQAALYDYQFSAAPSDEAYRRALKQLAAEQGAEALHRRLEAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D I A +IHP + +R+ RALE+   +G+   E+ +        L  A  + +  ER AL 
Sbjct: 147 DPISAARIHPHNIRRVIRALEVYHCTGKPFSEWQQTEKRL---LYEAAIVGLTAEREALY 203

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+ +G I+E R+L    L     + +AIG +++     G ++ DE +++  
Sbjct: 204 RRINERVDEMIAAGLIEEARALYDRGLRDCQAV-QAIGYKELYDYFDGRVSLDEAIEQLK 262

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
             + +YAKRQ TW  +Q    W  ++ 
Sbjct: 263 QNSRRYAKRQLTWFRNQMPVKWFDMTD 289


>gi|306843272|ref|ZP_07475881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO2]
 gi|306286538|gb|EFM58121.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO2]
          Length = 310

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 92/207 (44%), Positives = 135/207 (65%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSIRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|239977339|sp|B9JGK2|MIAA_AGRRK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 298

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/206 (45%), Positives = 129/206 (62%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q  ++   P+ VGGTGLYF+ALTG LS MP+IPT IR ++RE+L   G+  L+ EL   D
Sbjct: 93  QLREEGRTPVFVGGTGLYFKALTGGLSDMPDIPTEIRSRLRERLLAEGTDELYRELVLCD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  +   DGQRI RALE+   +GQSI  F  +     I  + A KI++LP+R+ L +
Sbjct: 153 PTAAESLSSQDGQRIVRALEVIEATGQSIAAFQGKTGPVIIDADRARKIVVLPDRAVLHQ 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  RF +ML  GA  E+++L+ + LS ++P+MKAIGV  I A+L+GE+   E L  G  
Sbjct: 213 RINGRFEKMLAMGAEAEVKALLALGLSPEMPVMKAIGVSQIAAMLRGEMTRAEVLDTGAA 272

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISS 212
           AT +YAKRQ TW  +Q    W R+S 
Sbjct: 273 ATRQYAKRQMTWFRNQMDESWERVSP 298


>gi|222086372|ref|YP_002544906.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           radiobacter K84]
 gi|221723820|gb|ACM26976.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           radiobacter K84]
          Length = 317

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 94/206 (45%), Positives = 129/206 (62%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q  ++   P+ VGGTGLYF+ALTG LS MP+IPT IR ++RE+L   G+  L+ EL   D
Sbjct: 112 QLREEGRTPVFVGGTGLYFKALTGGLSDMPDIPTEIRSRLRERLLAEGTDELYRELVLCD 171

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  +   DGQRI RALE+   +GQSI  F  +     I  + A KI++LP+R+ L +
Sbjct: 172 PTAAESLSSQDGQRIVRALEVIEATGQSIAAFQGKTGPVIIDADRARKIVVLPDRAVLHQ 231

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  RF +ML  GA  E+++L+ + LS ++P+MKAIGV  I A+L+GE+   E L  G  
Sbjct: 232 RINGRFEKMLAMGAEAEVKALLALGLSPEMPVMKAIGVSQIAAMLRGEMTRAEVLDTGAA 291

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISS 212
           AT +YAKRQ TW  +Q    W R+S 
Sbjct: 292 ATRQYAKRQMTWFRNQMDESWERVSP 317


>gi|319645875|ref|ZP_08000105.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           BT1B_CT2]
 gi|317391625|gb|EFV72422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           BT1B_CT2]
          Length = 314

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 110/215 (51%), Gaps = 4/215 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
            K  +  ++  LP+IVGGTGLY +++    S   E      R ++     + G+  +HD 
Sbjct: 86  QKIAEIGRRGKLPMIVGGTGLYIQSVLYDYSFTEEAGDPEFRAEMEAFSAKRGAEYVHDL 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L   D   AR IHP++ +R+ RALEI   +G+++ E  +        L +   I +  ER
Sbjct: 146 LKERDPEAARAIHPNNKRRVIRALEILHTTGKTMSEHMEGQRKEL--LYTTALIGLTMER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L +RI  R  QM++ G +DE++ L   N+     + +AIG +++ A L+G  + +E +
Sbjct: 204 EVLYDRINSRVDQMMDEGLLDEVKLLYDENVRNCQSV-QAIGYKELYAHLEGRASLEEAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +     + +YAKRQ TW  +Q    W  ++   ++
Sbjct: 263 ETLKRNSRRYAKRQLTWFRNQMDVAWFDMTPPVNI 297


>gi|226887623|pdb|2ZM5|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe)
 gi|226887624|pdb|2ZM5|B Chain B, Crystal Structure Of Trna Modification Enzyme Miaa In The
           Complex With Trna(Phe)
          Length = 316

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 114/214 (53%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++         +P++VGGT LYF+AL   LS +P     +R +I ++  + G   LH +
Sbjct: 89  LAEXADITAAGRIPLLVGGTXLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQ 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D + A +IHP+D QR++RALE+  +SG+++ E   Q     +P +     I    R
Sbjct: 149 LQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTEL-TQTSGDALPYQVHQFAIAPASR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF Q L SG   E+R+L          P ++ +G R   + L+GEI+YDE 
Sbjct: 208 ELLHQRIEQRFHQXLASGFEAEVRALFARGDLHTDLPSIRCVGYRQXWSYLEGEISYDEX 267

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + RG+ AT + AKRQ TWL       W+     +
Sbjct: 268 VYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPE 301


>gi|168218090|ref|ZP_02643715.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens NCTC 8239]
 gi|182379913|gb|EDT77392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens NCTC 8239]
          Length = 310

 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKSKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
           +     +  YAKRQ TW     +A +I      S +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDI 299


>gi|315122496|ref|YP_004062985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495898|gb|ADR52497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 303

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 156/215 (72%), Positives = 184/215 (85%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  +  K   LPIIVGGTGLYFRALTGQ S+MPEIP +IR+ +REKL++YG H+LHDE
Sbjct: 88  IKKITEVQKNGHLPIIVGGTGLYFRALTGQFSVMPEIPMSIRKNVREKLEKYGPHVLHDE 147

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +DS  A++IH SDGQRIARALEIK+VSGQSI EFWKQ+ NP IP+ESA+KI+ILPER
Sbjct: 148 LSQIDSCAAQKIHLSDGQRIARALEIKMVSGQSITEFWKQSSNPIIPIESAYKIVILPER 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           S LK++I +RF +ML+SGAIDEIRSLMKMNLSLDLPIMKAIGV DI+ALLKGEINY+ETL
Sbjct: 208 SYLKDKISQRFKRMLDSGAIDEIRSLMKMNLSLDLPIMKAIGVWDIMALLKGEINYEETL 267

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            RGIIATN+YAK+Q TW CHQ   DW +I+S DDL
Sbjct: 268 LRGIIATNQYAKKQITWFCHQLNEDWKKITSADDL 302


>gi|52080340|ref|YP_079131.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           licheniformis ATCC 14580]
 gi|52785719|ref|YP_091548.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           licheniformis ATCC 14580]
 gi|81691059|sp|Q65JA9|MIAA_BACLD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|52003551|gb|AAU23493.1| tRNA isopentenylpyrophosphate transferase MiaA [Bacillus
           licheniformis ATCC 14580]
 gi|52348221|gb|AAU40855.1| MiaA [Bacillus licheniformis ATCC 14580]
          Length = 314

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 110/215 (51%), Gaps = 4/215 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
            K  +  ++  LP+IVGGTGLY +++    S   E      R ++     + G+  +HD 
Sbjct: 86  QKIAEIDRRGKLPMIVGGTGLYIQSVLYDYSFTEEAGDPEFRAEMEAFSAKRGAEYVHDL 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L   D   AR IHP++ +R+ RALEI   +G+++ E  +        L +   I +  ER
Sbjct: 146 LKERDPEAARAIHPNNKRRVIRALEILHTTGKTMSEHMEGQRKEL--LYTTALIGLTMER 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L +RI  R  QM++ G +DE++ L   N+     + +AIG +++ A L+G  + +E +
Sbjct: 204 EVLYDRINSRVDQMMDEGLLDEVKLLYDENVRNCQSV-QAIGYKELYAHLEGRASLEEAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +     + +YAKRQ TW  +Q    W  ++   ++
Sbjct: 263 ETLKRNSRRYAKRQLTWFRNQMDVAWFDMTPPVNI 297


>gi|209550119|ref|YP_002282036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|239977442|sp|B5ZVU9|MIAA_RHILW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|209535875|gb|ACI55810.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 297

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 93/200 (46%), Positives = 130/200 (65%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MP+IP A+RE++R +L   G   LH EL+ +D  +A 
Sbjct: 97  GQLPVFVGGTGLYFKALTGGLSDMPDIPEALREELRGRLLMEGPDRLHAELAEVDPAMAA 156

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI +F  Q+    I    A KI++LPER+ L  RI  R
Sbjct: 157 GLNRQDGQRIVRALEVVKATGRSIADFQGQSGPVVIDAAQARKIVVLPERAVLHARINGR 216

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML   A DE+R+L+ + L  + P+MKAIGV  + A+L GE+  D+ L++G  AT +Y
Sbjct: 217 FEKMLRERAEDEVRALLALGLPAEAPVMKAIGVSQMAAMLSGEMTRDDVLEKGAAATRQY 276

Query: 192 AKRQKTWLCHQFQADWIRIS 211
           AKRQ TW  +Q    W R++
Sbjct: 277 AKRQMTWFRNQMDESWERLT 296


>gi|226324944|ref|ZP_03800462.1| hypothetical protein COPCOM_02736 [Coprococcus comes ATCC 27758]
 gi|225206292|gb|EEG88646.1| hypothetical protein COPCOM_02736 [Coprococcus comes ATCC 27758]
          Length = 321

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 66/210 (31%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 5   KLQRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELS 63
            ++ YK+  +PI+VGGTG Y +AL   +     E  TA R+K+    K++G+  LHD L 
Sbjct: 91  MVEIYKRGRIPIVVGGTGFYIQALLYDIDFEKGEENTAYRKKLETYAKEHGAQALHDRLR 150

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
             D   A  IH ++ +R+ RALE    +G  I E  +       P + A+ ++    RS 
Sbjct: 151 EADPKSADAIHANNVKRVIRALEYYHETGTKISEHNEAEREKDSPYQFAYFVLNDV-RSR 209

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           L ERI RR   M+E G +DE+ +L     + ++  M+ +G ++I+  L G+ + +E +  
Sbjct: 210 LYERIDRRVDLMVEQGLVDEVTALKTRGCTREMISMQGLGYKEILDYLDGKNSLEEAVTI 269

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISSI 213
               T  +AKRQ TW   +   +WI+    
Sbjct: 270 LKRDTRHFAKRQLTWFRRERDVNWIQKEEF 299


>gi|254522787|ref|ZP_05134842.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas sp. SKA14]
 gi|219720378|gb|EED38903.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas sp. SKA14]
          Length = 317

 Score =  161 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 78/211 (36%), Positives = 109/211 (51%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +   PI+ GGTGLYFRAL   LS MPE   A+R  +  +  + G   LH EL+ +D
Sbjct: 91  DIVARGKTPILAGGTGLYFRALLQGLSPMPEADPALRAALTAEAAERGWAALHAELAEVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IH +D QRI RALE+  +SG  I E+ ++     +P+ +   I+   +R+ L  
Sbjct: 151 PSAAARIHATDPQRIQRALEVYRLSGTPISEWQRRPGVAPLPVRTLKLILAPRDRAVLHR 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM------NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           RI  RF  ML  G +DE+R+L  M         LDLP ++A+G R     L GE +    
Sbjct: 211 RIEARFDLMLAQGFLDEVRALRAMPEMAAVKAPLDLPAVRAVGYRQAWEYLDGEGDAARF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIFATRQLAKRQLTWLRGELDARWFDPH 301


>gi|18310139|ref|NP_562073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens str. 13]
 gi|21263768|sp|Q8XL85|MIAA_CLOPE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|18144818|dbj|BAB80863.1| tRNA isopentenylpyrophosphate transferase [Clostridium perfringens
           str. 13]
          Length = 310

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
           +     +  YAKRQ TW     +A +I      S +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDI 299


>gi|254363114|ref|ZP_04979168.1| tRNA isopentenyltransferase [Mannheimia haemolytica PHL213]
 gi|153095001|gb|EDN75564.1| tRNA isopentenyltransferase [Mannheimia haemolytica PHL213]
          Length = 317

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 114/210 (54%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH E
Sbjct: 84  LREMADITSQGKIPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I   +I+P+D QRI RALE+  ++G+++ E   Q     +P       I   +R
Sbjct: 144 LVKIDPIAGARINPNDSQRINRALEVFYITGKTMTELTAQQGE-ALPYNILQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G  +E++ L          P ++ +G R +   L+G+I+ DE 
Sbjct: 203 AVLHQRIEQRFHKMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + +GI AT + AKRQ TWL     +  W+ 
Sbjct: 263 IFKGICATRQLAKRQITWLRGWQGELTWLD 292


>gi|167037588|ref|YP_001665166.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040250|ref|YP_001663235.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X514]
 gi|256750827|ref|ZP_05491712.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914334|ref|ZP_07131650.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X561]
 gi|307724430|ref|YP_003904181.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X513]
 gi|320116003|ref|YP_004186162.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|238687563|sp|B0K1A4|MIAA_THEPX RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238687659|sp|B0K9L7|MIAA_THEP3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166854490|gb|ABY92899.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X514]
 gi|166856422|gb|ABY94830.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256750410|gb|EEU63429.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889269|gb|EFK84415.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X561]
 gi|307581491|gb|ADN54890.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter sp. X513]
 gi|319929094|gb|ADV79779.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 315

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/217 (32%), Positives = 121/217 (55%), Gaps = 4/217 (1%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++    YK+  LPIIVGGTGLY  ++   +     E     REK++E    YGS  L+
Sbjct: 81  AKEIIKDIYKRGKLPIIVGGTGLYINSIIYIMHFSDFEGSKEFREKMKELANTYGSQYLY 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIIL 118
           ++L S+D   A++IHP+D +RI RALE+   +G+ I  + K +     P  +     +  
Sbjct: 141 EKLKSVDPEAAKKIHPNDIRRIIRALEVYEFTGKPISYYQKMSGMRLNPEYQPIMIGLNF 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R  +M+++  ++E+ +L+K+  + D   M+A+G ++I+  LKGEI+ +
Sbjct: 201 RDRQILYDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTAMQALGYKEIVEYLKGEISLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +++    T +YAKRQ TW        W  +    +
Sbjct: 261 EAIEKIKKGTRRYAKRQITWFKGYDFIKWFFVDDYKN 297


>gi|168208147|ref|ZP_02634152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens E str. JGS1987]
 gi|170660577|gb|EDT13260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens E str. JGS1987]
          Length = 310

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 59/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNLIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
           +     +  YAKRQ TW     +A +I      S +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDI 299


>gi|169344276|ref|ZP_02865257.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens C str. JGS1495]
 gi|169297607|gb|EDS79708.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens C str. JGS1495]
          Length = 310

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+VGGTGLY  ++   ++    +     RE++ +    +G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILVGGTGLYINSIICNMNFAESDKDEEYREELEKIANDHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ ++ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLEQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIR---ISSIDDL 216
           +     +  YAKRQ TW     +A +I     SS +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFSSEEDI 299


>gi|126209414|ref|YP_001054639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae L20]
 gi|307251233|ref|ZP_07533154.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|239977160|sp|A3N3P8|MIAA_ACTP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|126098206|gb|ABN75034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|306856749|gb|EFM88884.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 304

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 3/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++ GGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 74  LREMAEITASGRIPLLAGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 134 LLAIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+  L    +L  DLP ++ +G R +   L G+I+ DE 
Sbjct: 193 AVLHQRIEQRFYKMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEA 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSI 213
           + +GI AT + AKRQ TWL     +  W+     
Sbjct: 253 IYKGICATRQLAKRQITWLRGWNSEITWLDSLDP 286


>gi|92113402|ref|YP_573330.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Chromohalobacter salexigens DSM 3043]
 gi|123084128|sp|Q1QY27|MIAA_CHRSD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|91796492|gb|ABE58631.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Chromohalobacter salexigens DSM 3043]
          Length = 312

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 104/214 (48%), Gaps = 1/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++      +   PI+VGGT +Y + L   ++ +P    A+RE +  + +  G   LH E
Sbjct: 85  LAEMRDISSQGRTPILVGGTMMYIKRLIDGVASLPARDPALREALNARAESEGLVALHRE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A  IHP + QR+ RALE+  ++G+++ E W +      P       +    R
Sbjct: 145 LSRVDPVAAETIHPHNRQRLLRALEVYQLTGRALGELWAEQARETFPWRLVSIALAPNAR 204

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L  RI  RF  ML +G  DE+ +L          P ++ +G R +   L+GE +    
Sbjct: 205 HVLHARIAERFDSMLAAGFRDEVAALQARGDLHRGLPAIRCVGYRQMWEHLRGETDAATM 264

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
            +RG+ AT + AKRQ TWL       WI   + D
Sbjct: 265 RERGLAATRQLAKRQLTWLRGWEGVHWIDSDASD 298


>gi|225852873|ref|YP_002733106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis ATCC 23457]
 gi|256113940|ref|ZP_05454728.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256263643|ref|ZP_05466175.1| tRNA isopentenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|265995287|ref|ZP_06107844.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|254811014|sp|C0RE30|MIAA_BRUMB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|225641238|gb|ACO01152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis ATCC 23457]
 gi|262766400|gb|EEZ12189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263093697|gb|EEZ17702.1| tRNA isopentenyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409413|gb|ADZ66478.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis M28]
 gi|326539120|gb|ADZ87335.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis M5-90]
          Length = 310

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 90/207 (43%), Positives = 133/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|62290285|ref|YP_222078.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700207|ref|YP_414781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis biovar Abortus 2308]
 gi|189024518|ref|YP_001935286.1| tRNA isopentenyltransferase [Brucella abortus S19]
 gi|237815792|ref|ZP_04594789.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus str. 2308 A]
 gi|254689587|ref|ZP_05152841.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 6 str. 870]
 gi|254694077|ref|ZP_05155905.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254730618|ref|ZP_05189196.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 4 str. 292]
 gi|256257836|ref|ZP_05463372.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|260546827|ref|ZP_05822566.1| tRNA isopentenyltransferase [Brucella abortus NCTC 8038]
 gi|260755114|ref|ZP_05867462.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 6 str. 870]
 gi|260758333|ref|ZP_05870681.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 4 str. 292]
 gi|260884126|ref|ZP_05895740.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|261214373|ref|ZP_05928654.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|297248673|ref|ZP_06932391.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 5 str. B3196]
 gi|75505252|sp|Q57CB7|MIAA_BRUAB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|123547603|sp|Q2YS31|MIAA_BRUA2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238689388|sp|B2S6L5|MIAA_BRUA1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|62196417|gb|AAX74717.1| MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616308|emb|CAJ11365.1| ATP/GTP-binding site motif A (P-loop):tRNA isopentenyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|189020090|gb|ACD72812.1| tRNA isopentenyltransferase [Brucella abortus S19]
 gi|237789090|gb|EEP63301.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus str. 2308 A]
 gi|260095877|gb|EEW79754.1| tRNA isopentenyltransferase [Brucella abortus NCTC 8038]
 gi|260668651|gb|EEX55591.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 4 str. 292]
 gi|260675222|gb|EEX62043.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 6 str. 870]
 gi|260873654|gb|EEX80723.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 9 str. C68]
 gi|260915980|gb|EEX82841.1| isopentenyl-diphosphate:tRNA isopentenyltransferase [Brucella
           abortus bv. 3 str. Tulya]
 gi|297175842|gb|EFH35189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           abortus bv. 5 str. B3196]
          Length = 310

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 90/207 (43%), Positives = 133/207 (64%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|299131886|ref|ZP_07025081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Afipia sp.
           1NLS2]
 gi|298592023|gb|EFI52223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Afipia sp.
           1NLS2]
          Length = 310

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 82/207 (39%), Positives = 121/207 (58%), Gaps = 1/207 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +      LPI +GGTGLYF+ALT  LS +P +P A+RE IR++L+Q G   L++EL   D
Sbjct: 85  ETQANGRLPIFIGGTGLYFKALTRGLSNVPPVPDAVREAIRQRLEQNGPEALYEELGKRD 144

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P D  RIARALE+   +G+ + E+      P +P +    + + P+R  + E
Sbjct: 145 PEAAGRLKPRDRVRIARALEVVEATGRPLAEWHAHGLPPLLPPQGVVALFLAPDRKVVYE 204

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           +I RRF  M++ GA++E R+L    L   LP MKA GV  +I  L GE++ +E +  G I
Sbjct: 205 QIDRRFESMMDRGALEEARALGSRGLDPLLPAMKAHGVPALIRHLAGELSREEAIAIGQI 264

Query: 187 ATNKYAKRQKTWLCHQ-FQADWIRISS 212
            T  YAKRQ TW  HQ  + +W+   +
Sbjct: 265 DTRHYAKRQFTWFRHQLPEFEWVAPDA 291


>gi|261496337|ref|ZP_05992732.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307981|gb|EEY09289.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 317

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 114/210 (54%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH E
Sbjct: 84  LREMADITSQGKIPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I   +I+P+D QRI RALE+  ++G+++ E   Q     +P       I   +R
Sbjct: 144 LVKIDPIAGARINPNDSQRINRALEVFYITGKTMTELTAQQGE-ALPYNILQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G  +E++ L          P ++ +G R +   L+G+I+ DE 
Sbjct: 203 AVLHQRIEQRFHKMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + +GI AT + AKRQ TWL     +  W+ 
Sbjct: 263 IFKGICATRQLAKRQITWLRGWQGELTWLD 292


>gi|261493049|ref|ZP_05989589.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261311269|gb|EEY12432.1| tRNA isopentenyltransferase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 317

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 114/210 (54%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P    AIR +I  +  Q+G   LH E
Sbjct: 84  LREMADITSQGKIPLLVGGTMLYYKALLEGLSPLPSADPAIRAEIESRAAQHGWATLHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I   +I+P+D QRI RALE+  ++G+++ E   Q     +P       I   +R
Sbjct: 144 LVKIDPIAGARINPNDSQRINRALEVFYITGKTMTELTAQQGE-ALPYNILQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G  +E++ L          P ++ +G R +   L+G+I+ DE 
Sbjct: 203 AVLHQRIEQRFHKMIELGFEEEVKRLFLRKDLHINLPSIRCVGYRQMWEYLQGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + +GI AT + AKRQ TWL     +  W+ 
Sbjct: 263 IFKGICATRQLAKRQITWLRGWQGELTWLD 292


>gi|326795797|ref|YP_004313617.1| tRNA dimethylallyltransferase [Marinomonas mediterranea MMB-1]
 gi|326546561|gb|ADZ91781.1| tRNA dimethylallyltransferase [Marinomonas mediterranea MMB-1]
          Length = 310

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 120/215 (55%), Gaps = 1/215 (0%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           ++ +          P++VGGT +YF AL   L+ MP+   AIR++I ++ + YG   LH 
Sbjct: 82  VVKEVSDIVAAGKKPLLVGGTMMYFNALQKGLAEMPQSNEAIRDEIEQEARDYGWEHLHK 141

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
           ELS +D   A++IHP+D QR+ RALE+  VSG+++ E W +     +P    +  ++  E
Sbjct: 142 ELSRIDPESAKRIHPNDPQRLQRALEVYRVSGKTMTELWAKQEPQKLPFNMINLAVMPDE 201

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDE 179
           RS L  RI  RF QM++ G ++E+  L +      +LP ++ +G R +   L+GE + D+
Sbjct: 202 RSILHRRIEERFHQMMDLGFLNEVEDLYQRGDLTLELPSIRCVGYRQLWQYLEGEDSLDD 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
            + +GI+AT + AKRQ TWL            S D
Sbjct: 262 AIFKGIVATRQLAKRQLTWLRGWEDLAIFDSLSKD 296


>gi|167855441|ref|ZP_02478206.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis 29755]
 gi|167853435|gb|EDS24684.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parasuis 29755]
          Length = 314

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 76/218 (34%), Positives = 118/218 (54%), Gaps = 3/218 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY+++L   LS +P    AIR +I  K +Q G   LH E
Sbjct: 83  LREMANITAQGKIPLLVGGTMLYYKSLLDGLSPLPSADPAIRAEIEAKAEQIGWAGLHQE 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A +I+P+D QRI RALE+  +SG+++ E   Q     IP E     I   ER
Sbjct: 143 LVKIDPISAERINPNDSQRINRALEVFYISGKTMTELTAQQGE-GIPYEITQFAIAPQER 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M++ G   E+R L +        P ++ +G R +   L+G+ + DE 
Sbjct: 202 AVLHQRIEQRFHKMIDLGFEQEVRQLYQRGDLNVDLPSIRCVGYRQMWEYLEGQTSLDEA 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQ-ADWIRISSIDDLF 217
           + RGI AT + AKRQ TWL       +W+     ++ +
Sbjct: 262 IFRGICATRQLAKRQITWLRGWMSGLEWLDSLDPENSY 299


>gi|261380283|ref|ZP_05984856.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           subflava NJ9703]
 gi|284796795|gb|EFC52142.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           subflava NJ9703]
          Length = 313

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/211 (34%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +   P+IVGGT +YF ALT  L+ +P    A+R +++ + K++G   L+  L  +D
Sbjct: 88  EIHARGRYPLIVGGTMMYFHALTEGLNDLPGADAAVRAQLQAEKKEHGLAGLYRRLQEVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++  +D QRI RALE+ L++G+ + E + +       L+     +I  +R  L +
Sbjct: 148 PITAGRLKANDSQRIERALEVYLLTGRPLSEHFTEQKQAASLLDLCTVALIPEDRHLLHQ 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           +I +RF  MLE G +DEI +L +    L   +P M+ +G R     L+GE +YD  +++G
Sbjct: 208 QIEKRFLSMLEHGFLDEIHALRRDYPQLHADMPSMRCVGYRQAWDYLEGETDYDTFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           IIAT + AKRQ TWL     A  +   +  D
Sbjct: 268 IIATRQLAKRQLTWLRKIPLAHTLDPYADSD 298


>gi|21231168|ref|NP_637085.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768824|ref|YP_243586.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|25008754|sp|Q8P9X8|MIAA_XANCP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|81305209|sp|Q4UTQ7|MIAA_XANC8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|21112807|gb|AAM41009.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66574156|gb|AAY49566.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. 8004]
          Length = 327

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 105/211 (49%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  +PI+ GGTGLYFRA    L+ MPE   A+R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGKIPILAGGTGLYFRAALEGLAQMPEADPAVRLAIAAEAEQVGWGALHAQLARID 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +  +   P  P+     ++   +R+ L  
Sbjct: 151 PVAAARIHATDRQRIQRALEVYRISGKPISYWQTRPAGPRAPVRVLKLVLAPRQRAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML  G + E+  L  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIAMRLDVMLADGFLTEVEQLRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + + AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAVQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|255280934|ref|ZP_05345489.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bryantella
           formatexigens DSM 14469]
 gi|255268382|gb|EET61587.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bryantella
           formatexigens DSM 14469]
          Length = 321

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 111/215 (51%), Gaps = 3/215 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHIL 58
           +  K + Q Y+K  +PI+VGGTG Y +A+   +     +  ++ R ++ +  K+ G   L
Sbjct: 81  LAKKYMAQIYEKGKIPILVGGTGFYIQAVLYDIDFTQNDGDSSYRRELEQLAKEKGCTYL 140

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           HD L+++D   A++IH ++ +R+ RALE    SG  I    +       P  +A+ ++  
Sbjct: 141 HDMLAAVDPKSAQEIHANNVKRVIRALEFYHESGTPISAHNECQRQKESPYNAAYFVL-N 199

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L ERI RR  +ML++G +DE+R L     +  +  M+ +G ++I+  L G    +
Sbjct: 200 ENRQTLYERIDRRVDEMLKNGLLDEVRHLKAQGCTAGMVSMQGLGYKEILDYLDGNCTLE 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E + R    T  +AKRQ TW   + +  W++    
Sbjct: 260 EAVYRLKRDTRHFAKRQITWFKREREVIWLQKEEF 294


>gi|107104044|ref|ZP_01367962.1| hypothetical protein PaerPA_01005117 [Pseudomonas aeruginosa PACS2]
 gi|313109946|ref|ZP_07795874.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 39016]
 gi|310882376|gb|EFQ40970.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 39016]
          Length = 313

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 114/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A
Sbjct: 83  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESA 142

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 143 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 202

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 203 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 263 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 299


>gi|78047323|ref|YP_363498.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|123585339|sp|Q3BUR5|MIAA_XANC5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78035753|emb|CAJ23444.1| tRNA isopentenyltransferase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 327

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 74/211 (35%), Positives = 105/211 (49%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE    +R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSHLPEADQTVRASIAAEAQQIGWAGLHAQLARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P P +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISAWQALPPGPRLPVRVLKVVLAPRERAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML    + E++ L  +          DLP ++A+G R     L G     E 
Sbjct: 211 RIAHRLDAMLAQDFLGEVQRLRALPQMQAVAAPLDLPAVRAVGYRQAWQYLDGAGGLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|53729028|ref|ZP_00134307.2| COG0324: tRNA delta(2)-isopentenylpyrophosphate transferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
          Length = 314

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 115/214 (53%), Gaps = 3/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +      +P++ GGT LY++AL   LS +P     IR +I  K +Q G   LH E
Sbjct: 84  LREMAEITASGRIPLLAGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R
Sbjct: 144 LLAIDPIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+  L    +L  DLP ++ +G R +   L G+I+ DE 
Sbjct: 203 AVLHQRIEQRFYKMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSI 213
           + +GI AT + AKRQ TWL     +  W+     
Sbjct: 263 IYKGICATRQLAKRQITWLRGWNSEITWLDSLDP 296


>gi|268611655|ref|ZP_06145382.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruminococcus
           flavefaciens FD-1]
          Length = 303

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/214 (28%), Positives = 104/214 (48%), Gaps = 3/214 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDE 61
            K      +  +PI+VGGTGLY  +L   +         A RE++    +  G+  LH  
Sbjct: 88  EKIADILSRGKVPIVVGGTGLYIDSLLENVKFSEGGSDEAYREELYAFARANGNEALHAR 147

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ LD   A  IHP++  R+ RA+E+  V+G+   E   ++     P +S    +   +R
Sbjct: 148 LAELDPEAAEGIHPNNLVRVVRAIEVCHVTGRRFSELKAESKLVESPYDSLIFGLNFEDR 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L +RI  R  +M+++G ++E R L +   S       AIG +++I   +G ++ ++ +
Sbjct: 208 QKLYDRINLRVDEMVKAGLVEEARDLWQQ--SGMKTAANAIGYKELIPYFEGTMSLEDCI 265

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
                 T +YAKRQ TW     + +WI +  I+ 
Sbjct: 266 GIIKQETRRYAKRQLTWFRKNGRINWIFLDRINK 299


>gi|186973101|pdb|3CRM|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
 gi|186973102|pdb|3CRQ|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
 gi|186973103|pdb|3CRR|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna
           Modification Through A Channel
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|254238340|ref|ZP_04931663.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa C3719]
 gi|126170271|gb|EAZ55782.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa C3719]
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|116053094|ref|YP_793413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|254244165|ref|ZP_04937487.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 2192]
 gi|122256893|sp|Q02F73|MIAA_PSEAB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|115588315|gb|ABJ14330.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126197543|gb|EAZ61606.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa 2192]
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 114/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|15600138|ref|NP_253632.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAO1]
 gi|218894040|ref|YP_002442909.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa LESB58]
 gi|21263786|sp|Q9HUL9|MIAA_PSEAE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|226704736|sp|B7V208|MIAA_PSEA8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|9951225|gb|AAG08330.1|AE004907_8 delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAO1]
 gi|218774268|emb|CAW30085.1| delta 2-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa LESB58]
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|296391785|ref|ZP_06881260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PAb1]
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 114/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  +    G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEALAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|49083702|gb|AAT51113.1| PA4945 [synthetic construct]
          Length = 324

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/217 (34%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  + G S+ +  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|254518942|ref|ZP_05130998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           7_2_43FAA]
 gi|226912691|gb|EEH97892.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           7_2_43FAA]
          Length = 308

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/221 (26%), Positives = 109/221 (49%), Gaps = 5/221 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K +     +  LPI+ GGTGLY  ALT  ++    E     R ++ E  +++G+  +
Sbjct: 80  MAQKCIDDIISRGKLPILTGGTGLYINALTCNMNFTEAENDLKYRSELEELAEKHGNEYI 139

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L  +D I  ++IH ++ +R+ RALE+  ++ +    F         P +  + ++  
Sbjct: 140 HNMLKDIDPISYKEIHYNNRKRVIRALEVYKLTKKPFSSFNAGEEFYNGPYDVTYYVL-N 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L  RI  R   M++ G ++E   L +M  +  +  M+ IG ++I   L+ +I+ +
Sbjct: 199 MDREKLYNRINLRVDMMMDKGLLEECIKLKEMGYNSSVQSMQGIGYKEIFYYLENKISLN 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS--SIDDLF 217
           E ++     +  YAKRQ TW     +A  +     S D++F
Sbjct: 259 EAVEMIKQGSRNYAKRQLTWFRRDPRAIILDKDIFSEDEIF 299


>gi|323697722|ref|ZP_08109634.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. ND132]
 gi|323457654|gb|EGB13519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans ND132]
          Length = 308

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/209 (31%), Positives = 110/209 (52%), Gaps = 2/209 (0%)

Query: 1   MLSKKLQRYK-KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +   +++  + +  LPI+VGGTGLY R+L   ++ +PEIP  IR ++ +++   G   LH
Sbjct: 81  LAVDRIEAVRGEGRLPILVGGTGLYLRSLLTGIAPIPEIPEDIRRQVLDRVAAEGPQALH 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            EL+  D   A +IHP+D QR ARA E+ L +G+++  +  ++ +   P + A KI +  
Sbjct: 141 AELTRTDPDYAAKIHPNDTQRNARAAEVFLATGRTMTWWHTESEHAPAPYD-ALKIGMRL 199

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+  +  R   MLE G +DE R+        D P    IG  +++  L+G +   E
Sbjct: 200 ALNDLEPLLAARIDVMLERGGLDEARAAFARCPDPDAPGWTGIGCAELLGFLRGALTLAE 259

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWI 208
             ++ +  T  YAKRQ TW   +    W 
Sbjct: 260 AREKWVRNTRAYAKRQLTWFNREADIHWF 288


>gi|119946845|ref|YP_944525.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Psychromonas
           ingrahamii 37]
 gi|166216071|sp|A1SZL1|MIAA_PSYIN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|119865449|gb|ABM04926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Psychromonas
           ingrahamii 37]
          Length = 305

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P++VGGT LY++AL   LS +P     +R +I ++  + G   LHD+L  +D
Sbjct: 89  EITDRGHTPLLVGGTMLYYKALVDGLSPLPSANPKVRAQIEKEALENGWQALHDKLEQID 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QR+ARALE+  +SG+S+ E   +  +  IP       I   E+S L  
Sbjct: 149 PVSAARIHVNDPQRLARALEVFRISGKSLTEL-TKVKSDPIPYNIKQFAIAPLEKSVLHA 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  MLESG   E+R L +        P M+ +G R +   L+G ++Y+E   RGI
Sbjct: 208 RIEQRFELMLESGFEQEVRKLYQRGDLHLDLPSMRCVGYRQMWEYLQGTMDYEEMRFRGI 267

Query: 186 IATNKYAKRQKTWLCHQFQADWI---RISSIDDL 216
           +AT + AKRQ TWL       W+      + + +
Sbjct: 268 VATRQLAKRQMTWLRGWQNVTWLETGHADNFERI 301


>gi|120435019|ref|YP_860705.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gramella
           forsetii KT0803]
 gi|239977382|sp|A0LZ43|MIAA_GRAFK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|117577169|emb|CAL65638.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Gramella
           forsetii KT0803]
          Length = 302

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 98/217 (45%), Gaps = 6/217 (2%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  + + K  + ++VGG+GLY +A+T  L   P++   IR  + + L++ G   L  +
Sbjct: 82  ILKLKELFNKHKVAVMVGGSGLYIKAITEGLDDFPKVDPEIRRNLNQHLEEDGIDWLQKK 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD    +     +  R+ RALEI + +G+    F  Q             I ++ +R
Sbjct: 142 LYVLDPEYYKTADVMNPHRLIRALEICIETGKPFSSFLNQKKPER--NFKNITIGLMADR 199

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             + +RI +R   M+ +G I+E R L           +  +G +++ +   G+ + +  +
Sbjct: 200 EMIYDRINKRVDLMIRNGLIEEARELYPQKEL---NALNTVGYKELFSFFDGKTDLETAI 256

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS-SIDDLF 217
                 T ++AKRQ TW     +  W     +  ++F
Sbjct: 257 SEIKKNTRRFAKRQLTWFRKDPEIKWFEFDENSKNIF 293


>gi|304311743|ref|YP_003811341.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HdN1]
 gi|301797476|emb|CBL45696.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HdN1]
          Length = 370

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 113/219 (51%), Gaps = 6/219 (2%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  + +     P++VGGT LY+RAL   ++ +P     +R +I    +  G   +H  
Sbjct: 142 LREMAEIHAFGATPVLVGGTMLYYRALQQGMADLPPANPEVRAEIEAIAQTAGWPQVHAL 201

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPF-----IPLESAHKII 116
           L+++D I A +IHP+D QR+ RALE+  ++G  + E+ ++  +       IP       +
Sbjct: 202 LAAVDPIAANRIHPTDPQRLQRALEVYKITGVPLSEWHQRQKDAEIQSGAIPWNITAVAL 261

Query: 117 ILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEI 175
             P+RS+L E I RRF QMLE G  +E+  L          P M+A+G R +   L G  
Sbjct: 262 CPPQRSSLHEAIARRFRQMLEDGFEEEVLGLRARGDLTLKHPSMRAVGYRQMWEYLDGTT 321

Query: 176 NYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
             D+ +++GI+AT + AKRQ TWL       W+     D
Sbjct: 322 TRDQMIEQGIVATRQLAKRQITWLRSWPSLQWLDPMQKD 360


>gi|225027643|ref|ZP_03716835.1| hypothetical protein EUBHAL_01902 [Eubacterium hallii DSM 3353]
 gi|224954957|gb|EEG36166.1| hypothetical protein EUBHAL_01902 [Eubacterium hallii DSM 3353]
          Length = 322

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 108/209 (51%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y    +PIIVGGTG Y +AL   +     E   + R+++ +  K+ G   L++ L  +
Sbjct: 91  KIYAAGHIPIIVGGTGFYIQALLYDIDFSEHEGKESYRKELEQLAKEKGKEYLYEILKEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A+ +H ++ +R+ RALE    +G  + E  K+      P   A+ ++   +R  L 
Sbjct: 151 DPEYAQIVHFNNVKRVIRALEYHKETGHKLSEHNKEQRQKDSPYNFAYFVLYH-DREVLY 209

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI RR   M+E G ++E++ L++   + DL  M+ +G ++      GE++ +ET+ +  
Sbjct: 210 DRINRRVDLMMEDGLLEEVKGLIEEGYTKDLVSMQGLGYKEFFDYFDGEMSLEETVDKVK 269

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T ++AKRQ TW   + +  W+     +
Sbjct: 270 RDTRRFAKRQLTWFRREKEVVWLNKKEYE 298


>gi|220905298|ref|YP_002480610.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|239977366|sp|B8J3C2|MIAA_DESDA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219869597|gb|ACL49932.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 323

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/207 (32%), Positives = 107/207 (51%), Gaps = 2/207 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              +  +P++VGGTGLYF+ L    + +P +  A+      +L+  GS  +H EL+ +D 
Sbjct: 105 ILSRGKIPLLVGGTGLYFQTLLHGTAEIPPVDPALTAAFTARLEDVGSQAMHAELARVDP 164

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A +IHP+D QRI RALE+   +G+    + K A     P  +   +++      L+ R
Sbjct: 165 DYATRIHPNDRQRIVRALEVHAATGKPFTWWHKHA--MSRPPCNGPLLVLDAPLPWLEPR 222

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           + RR   MLESGA+DE  + +K     D P    IG  + +A L+G + +D      +  
Sbjct: 223 LARRLDMMLESGAMDEAAAALKNCDDDDAPGWTGIGCAEALAFLRGRLGFDACRDLWLRN 282

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T  YAKRQ TW   + +A W+   ++D
Sbjct: 283 TRAYAKRQLTWFRARPEAVWLPPDNVD 309


>gi|319649405|ref|ZP_08003563.1| TRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           2_A_57_CT2]
 gi|317399039|gb|EFV79719.1| TRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           2_A_57_CT2]
          Length = 320

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 58/214 (27%), Positives = 109/214 (50%), Gaps = 4/214 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDE 61
           SK  +   +  LP+IVGGTGLY +++               R+ + E+ ++ G+  L  E
Sbjct: 85  SKITEITSRGKLPMIVGGTGLYIQSVIYDYQFSDAPSDEEFRKTLEERAEREGNDALFKE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L ++D   A +IHP++ +R+ RALEI   +G+++ ++ +        L     I +  +R
Sbjct: 145 LLAIDPESAEKIHPNNIRRVVRALEIYHCTGKTMSQYQENQDPAL--LYDTALIGLTMDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI  R   M++ G ++E+R+L  + L      ++AIG +++     G ++ ++ +
Sbjct: 203 DTLYERINLRVEIMMKEGLLEEVRALYDLGLKDCQS-IQAIGYKELYEYFNGRVSLEDAV 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
                 + +YAKRQ TW  ++   +W  +S   D
Sbjct: 262 GNLKQNSRRYAKRQLTWFRNKMNVEWFDMSDTAD 295


>gi|118581368|ref|YP_902618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelobacter
           propionicus DSM 2379]
 gi|239977120|sp|A1AT90|MIAA1_PELPD RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|118504078|gb|ABL00561.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelobacter
           propionicus DSM 2379]
          Length = 309

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/202 (31%), Positives = 103/202 (50%), Gaps = 1/202 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             ++   PI+VGGTGLY RAL   L   P     +R +++E+ ++ G+  + + L  +D 
Sbjct: 92  IIRRGKRPIVVGGTGLYLRALLHGLVDSPSGAGELRRRLQEEARELGNQAMLERLRRVDP 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
            +A  IHP++  RI R LE+  ++G  +  +  +         S    I   ER  L ER
Sbjct: 152 QLATTIHPNNLVRIIRGLEVYHLTGIPLSRYQHEHGFAAERYRSLAIGIR-VERRELYER 210

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I RR  +ML +G +DE+R+L++     +L  M++IG R+    L G  + +ET       
Sbjct: 211 IERRVDRMLATGLLDEVRALLEAGFGPELKAMRSIGYRESCDFLAGNSSLEETTALIKRN 270

Query: 188 TNKYAKRQKTWLCHQFQADWIR 209
           T +YAKRQ TW     +  W+ 
Sbjct: 271 TRRYAKRQLTWFNADPEIIWLE 292


>gi|152996646|ref|YP_001341481.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MWYL1]
 gi|239977410|sp|A6VYL7|MIAA_MARMS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150837570|gb|ABR71546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinomonas sp.
           MWYL1]
          Length = 310

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/209 (32%), Positives = 112/209 (53%), Gaps = 1/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   K   P++VGGT +YF AL   L+ MP+    +R  I  +  + G   LH+EL   D
Sbjct: 88  EILAKGKTPLLVGGTMMYFNALQKGLAEMPQADAELRVIIEAEAAEKGWAALHEELQRFD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IHP+D QR+ RA+E+  ++G+++  FW+Q     +P E  +  ++  ERS L E
Sbjct: 148 PEAASRIHPNDPQRLQRAIEVYRLTGKTMTHFWRQQEAVSLPFEMINMAVMPKERSVLHE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  M++ G + E+    +    ++D+P M+ +G R +   L G    ++ + +G+
Sbjct: 208 RIEQRFYDMMDQGFLAEVEGFYRRGDLTIDMPSMRCVGYRQLWQYLDGVDLLEDAIFKGV 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
           +A+ + AKRQ TWL            S D
Sbjct: 268 VASRQLAKRQLTWLRGWEDLMIFDSLSKD 296


>gi|237748582|ref|ZP_04579062.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes OXCC13]
 gi|229379944|gb|EEO30035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter
           formigenes OXCC13]
          Length = 312

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 111/215 (51%), Gaps = 5/215 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  ++  LP++VGGT LYF+ LT  L  +P     IR K+ E+  Q G   +H +LSSLD
Sbjct: 90  EIRQRGKLPLLVGGTMLYFKGLTSGLDDLPGANPEIRAKLDEEAAQIGWPGMHAKLSSLD 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A ++ P+D QRI RALEI  ++G+ + E          P +     +   +RS L E
Sbjct: 150 PVTADRLKPNDAQRIQRALEIIELTGKPLSELHSGQQARSFPFDIIPIALEPSDRSKLHE 209

Query: 127 RIRRRFTQMLESGAIDEIRS--LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF QML+   + E       + +L   +P M+ +G R     L GE +     ++G
Sbjct: 210 RIALRFDQMLKDDLLIEEVRKLRERGDLHPGMPSMRCVGYRQTWEYLDGEFDRKALREKG 269

Query: 185 IIATNKYAKRQKTWLCHQFQ---ADWIRISSIDDL 216
           I AT + AKRQ TWL    +    D +  +++ D+
Sbjct: 270 IAATRQLAKRQLTWLRSMPERISIDCLSPNALSDI 304


>gi|306844289|ref|ZP_07476881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO1]
 gi|306275361|gb|EFM57102.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella sp.
           BO1]
          Length = 310

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 91/207 (43%), Positives = 135/207 (65%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS MPE+   +R+  R +++  G+  LH  LS  D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQMPEVSAQVRDHWRGRMEAEGAKALHAVLSVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L ERI R
Sbjct: 155 ATLQPSDSQRIVRALEVLESTGKSLLEWQKAKGRALVDDQSAQKIVLRPDRAWLGERIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+++L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVKALLALDLDPALPAMKAIGVREVSAFLAETMSREEVIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|154504382|ref|ZP_02041120.1| hypothetical protein RUMGNA_01886 [Ruminococcus gnavus ATCC 29149]
 gi|153795311|gb|EDN77731.1| hypothetical protein RUMGNA_01886 [Ruminococcus gnavus ATCC 29149]
          Length = 322

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/211 (29%), Positives = 107/211 (50%), Gaps = 3/211 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  + L   Y++  +PI+VGGTG Y +AL   +S    E   + R+++ E  ++ G+  L
Sbjct: 80  MAKEALDGIYQRGHIPIVVGGTGFYIQALLYDISFEDNEEDHSYRKELEELAQEEGAEKL 139

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H  L  +D   A +IH ++ +R+ RALE    +G+ I E   +         SA+ ++  
Sbjct: 140 HQMLRQVDEKAALEIHANNVKRVIRALEFYHQTGEKISEHNAKEREKESAYNSAYFVLND 199

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R+ L ERI +R   M E G ++E+ +L +   +  +  M+ +G ++I A L GE   +
Sbjct: 200 -DRANLYERINKRVDAMFEEGLVEEVTALQERGYTRGMVSMQGLGYKEIFAYLDGECTLE 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           E  +     T  +AKRQ TW   +    WI 
Sbjct: 259 EAKEIIKRDTRHFAKRQITWFKRERDVIWIN 289


>gi|167758188|ref|ZP_02430315.1| hypothetical protein CLOSCI_00526 [Clostridium scindens ATCC 35704]
 gi|167664085|gb|EDS08215.1| hypothetical protein CLOSCI_00526 [Clostridium scindens ATCC 35704]
          Length = 323

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/208 (30%), Positives = 104/208 (50%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y +  +P+IVGGTG Y +A+   +         A R+++ +     G   LH+ L  +
Sbjct: 87  EIYSRGHIPVIVGGTGFYIQAVLYDIDFTENDGDRAFRQELMDYADANGPLSLHERLKEV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IHP++ +R+ RALE    +G+ I E  ++      P    + ++   ER  L 
Sbjct: 147 DPKAADAIHPNNTKRVIRALEFCHQTGKKISEHNEKEREKESPYNFVYFVLND-ERQKLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR   M++ G ++E+  L +M  + D+  M+ +G ++I+A L GE   DE +    
Sbjct: 206 ERIDRRVDLMIQEGLVEEVSRLKEMGYARDMVSMQGLGYKEILACLDGECTLDEAIYMIK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             T  +AKRQ TW   + Q  WI   + 
Sbjct: 266 RDTRHFAKRQITWFKRERQVIWIEKEAY 293


>gi|167753757|ref|ZP_02425884.1| hypothetical protein ALIPUT_02039 [Alistipes putredinis DSM 17216]
 gi|167658382|gb|EDS02512.1| hypothetical protein ALIPUT_02039 [Alistipes putredinis DSM 17216]
          Length = 300

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/210 (28%), Positives = 93/210 (44%), Gaps = 5/210 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q + +    I VGG+GLY +AL   +  +PE    +R  +R++L   G   L +EL  LD
Sbjct: 88  QLFVRHDTVIAVGGSGLYVKALCEGMDDLPEADPELRRTLRQRLANEGLESLGEELKRLD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            +   Q+  S+  R+ RALE+ L +G+   E   +            KI     R+ L  
Sbjct: 148 PVYYAQVDRSNPARVVRALEVCLQTGRPYSEQ--RTKPRRERNFRILKIGTDVPRAELYG 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR  +ML  G   E R L           ++ +G +++ A   G  + DE ++    
Sbjct: 206 RIDRRVDEMLAEGLEVEARRLYPYKHL---NALQTVGYKELFAYFDGRCSRDEAVELIKR 262

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T +YAKRQ TW     +  W      D +
Sbjct: 263 NTRRYAKRQLTWFRRDPEIFWTPPGDTDKI 292


>gi|254516808|ref|ZP_05128866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium NOR5-3]
 gi|219674313|gb|EED30681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium NOR5-3]
          Length = 315

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 72/205 (35%), Positives = 113/205 (55%), Gaps = 2/205 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++   PI+VGGT LY+ AL   L+ MP    A+R  I     + G   +H EL+ +D   
Sbjct: 76  RRGRRPILVGGTMLYYNALLKGLAAMPGAHPAVRNDIASMAARDGWPAVHRELARVDPES 135

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALKERI 128
           A +IHP+  QR++RALE+  V+G+++ +  +Q     + +  A  I I P +R  L  RI
Sbjct: 136 AARIHPNHSQRLSRALEVYRVTGKTLTQLHQQDQTSALNIADALAIAIAPLQREVLHARI 195

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
             RF +M+  G +DE+R L +        P ++A+G R + + L+GE + +E  +RG+IA
Sbjct: 196 EARFREMMRCGFLDEVRCLKERGDLHADLPAIRAVGYRQLWSHLEGECSLEEAQERGVIA 255

Query: 188 TNKYAKRQKTWLCHQFQADWIRISS 212
           T + AKRQ TWL       WI   +
Sbjct: 256 TRQLAKRQFTWLRKWPDLQWIHTDA 280


>gi|160880511|ref|YP_001559479.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           phytofermentans ISDg]
 gi|189081949|sp|A9KL08|MIAA_CLOPH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|160429177|gb|ABX42740.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           phytofermentans ISDg]
          Length = 313

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/209 (29%), Positives = 106/209 (50%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +PIIVGGTG Y +A+   +     +  T  R+++ E  +  G+  LHD L   
Sbjct: 86  EIYSKGKVPIIVGGTGFYIQAVLKDIDFTENDSDTPYRKELEELAQTEGAIKLHDILKQC 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D + A  IHP++ +R  RA+E   ++G+ I +  ++      P + A+ ++   +R  L 
Sbjct: 146 DPVAAEAIHPNNIKRTIRAIEYFKLTGEPISKHNEEQRGNESPYQYAYFVLNN-DREILY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           E I  R  +ML++G + E+  L +      L  M+ +G ++I A L+GE + +ET+    
Sbjct: 205 ENIDLRVDKMLDAGLVKEVLWLKEQGYDRSLVSMQGLGYKEIYAYLEGECSLEETVYLLK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W+     +
Sbjct: 265 RDTRHFAKRQLTWFKREQDVIWLSKKDYN 293


>gi|152976107|ref|YP_001375624.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|189081942|sp|A7GR71|MIAA_BACCN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|152024859|gb|ABS22629.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           cytotoxicus NVH 391-98]
          Length = 316

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 58/210 (27%), Positives = 107/210 (50%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  K+  LPIIVGGTGLY +++        E   TA RE++ +  ++ G   +H +L  +
Sbjct: 91  EITKRGKLPIIVGGTGLYIQSVLYDYQFTDEAGDTAYRERMEKLAEEQGVEFVHKKLEEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A++IH ++ +R+ RALEI   +G+ + E  ++  N    L     I +  +R+ L 
Sbjct: 151 DPESAKRIHANNVRRVIRALEIFQTTGKKMSEQLEKQKNEL--LYDVVLIGLTMDRTMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M+E G   E++ L +  +      ++AIG +++     G  + +E + +  
Sbjct: 209 DRINLRVDLMMEQGLEQEVKRLYQNGVRDCQS-IQAIGYKELYRYFAGATSLEEAISQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVAWFDVTDGEK 297


>gi|4768874|gb|AAD29668.1|AF124757_28 tRNA delta(2)-isopentenylpyrophosphate transferase [Zymomonas
           mobilis subsp. mobilis ZM4]
          Length = 312

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 11/222 (4%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           +  K++   ++   LPI+VGGTGLY R L   ++ +P+I   +RE++R           +
Sbjct: 87  LAKKEIKNAHESGRLPILVGGTGLYIRTLLEGIAPIPDIAPELREEVRSM----SVEEAY 142

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L   D + A ++ P+D  RI RALE+   +G  +  + ++              +I+P
Sbjct: 143 SALQQEDPMAADRLRPTDKTRIMRALEVMRSTGHPLHYWQQKKTGGIANEIKLQSFVIIP 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
             + L+ R  +RF QMLE GA  E+  LM   L  DLPIM+AIGVR+I + ++ EI+   
Sbjct: 203 PANILRSRCDKRFDQMLEQGAEKEVIRLMGRQLPADLPIMRAIGVREIASYIRREIDRLT 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADW------IRISSIDD 215
            +++   AT +YAKRQ+TW  HQ    W      I  + IDD
Sbjct: 263 MIEKAKAATRQYAKRQRTWFRHQTDESWIIFFDDINFNPIDD 304


>gi|229544345|ref|ZP_04433404.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           coagulans 36D1]
 gi|229325484|gb|EEN91160.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           coagulans 36D1]
          Length = 348

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 109/210 (51%), Gaps = 4/210 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LP+IVGGTGLY +++             A R ++ +  ++ G  +L+  
Sbjct: 115 EKISDIASRGKLPMIVGGTGLYIQSVLYDYRFSDIAGDPAYRAELEKIARREGPGLLYKL 174

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L   D   A +IHP + +R+ RALE+   SG+++ ++ KQ  +   PL  A  I ++ ER
Sbjct: 175 LEKTDPESAAKIHPHNVRRVIRALEVCHFSGRTMQDYKKQQQDE--PLYCAALIGLVMER 232

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L +RI  R  QM+E G I+E+R L   NL      ++AIG +++     G +  DE +
Sbjct: 233 EKLYQRINERVDQMMERGLIEEVRKLYDKNLRGVQS-IQAIGYKELYDYFDGRMTLDEAV 291

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
            R    T ++AKRQ TW  ++ + +W  ++
Sbjct: 292 SRLKQNTRRFAKRQLTWFRNKMEIEWFDMT 321


>gi|225076486|ref|ZP_03719685.1| hypothetical protein NEIFLAOT_01532 [Neisseria flavescens
           NRL30031/H210]
 gi|224952165|gb|EEG33374.1| hypothetical protein NEIFLAOT_01532 [Neisseria flavescens
           NRL30031/H210]
          Length = 313

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +   P+IVGGT +YF ALT  L+ +P   TA+R +++ +  ++G   L+  L  +D
Sbjct: 88  EIHARGRYPLIVGGTMMYFHALTEGLNDLPSADTAVRAQLQAEKNEHGLAGLYRRLQEVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++  +D QRI RALE+ L++G+ + E + +       L+     +I  +R  L +
Sbjct: 148 PITAGRLKANDSQRIERALEVYLLTGKPLSEHFTEQKQAAPLLDLCTVALIPEDRHLLHQ 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           +I +RF  MLE G +DEI +L +    L   +P M+ +G R     L+GE +YD  +++G
Sbjct: 208 QIEKRFLNMLEHGFLDEIHALRRDYPQLYADMPSMRCVGYRQAWDYLEGETDYDTFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           I+AT + AKRQ TWL     A  +   +  D
Sbjct: 268 IVATRQLAKRQLTWLRKIPLAHTLDPYADSD 298


>gi|190573717|ref|YP_001971562.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia K279a]
 gi|229621760|sp|B2FL25|MIAA_STRMK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190011639|emb|CAQ45258.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia K279a]
          Length = 317

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 109/211 (51%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +   PI+ GGTGLYFRAL   LS MPE    +RE +  +  + G   LH EL+ +D
Sbjct: 91  DIVARGKTPILAGGTGLYFRALLQGLSPMPEADPVMREALSTEAAERGWAALHAELAKVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IH +D QRI RALE+  ++G  I E+ ++     +P+ +   I+   +R+ L +
Sbjct: 151 PAAAARIHATDPQRIQRALEVYRLTGTPISEWQRRPGVAPLPVRTLKLILAPRDRAVLHQ 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  RF  ML  G +DE+R+L  M          DLP ++A+G R     L GE +    
Sbjct: 211 RIEARFDAMLAQGFLDEVRALRAMPEMAAVTAPLDLPAVRAVGYRQAWEYLDGEGDAARF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIFATRQLAKRQLTWLRGELDARWFDPH 301


>gi|17986899|ref|NP_539533.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|256045023|ref|ZP_05447924.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|260565378|ref|ZP_05835862.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991450|ref|ZP_06104007.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|21263771|sp|Q8YI29|MIAA_BRUME RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|17982540|gb|AAL51797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260151446|gb|EEW86540.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002234|gb|EEZ14809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brucella
           melitensis bv. 1 str. Rev.1]
          Length = 310

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 89/207 (42%), Positives = 132/207 (63%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYFRAL G LS  PE+   +R+  R +++  G+  LH  L   D  +A
Sbjct: 95  QGRVPIFVGGTGLYFRALLGGLSQTPEVSAQVRDHWRGRMEAEGAKALHAVLCVRDPAIA 154

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
             + PSD QRI RALE+   +G+S++E+ K      +  +SA KI++ P+R+ L  RI R
Sbjct: 155 AALQPSDSQRIVRALEVLESTGKSLLEWQKVKGRALVDDQSAQKIVLRPDRAWLGVRIAR 214

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF+ M   GAIDE+R+L+ ++L   LP MKAIGVR++ A L   ++ +E ++R +IAT +
Sbjct: 215 RFSAMWAEGAIDEVRALLALDLDPALPAMKAIGVREVSAFLAETMSREEAIERSVIATRQ 274

Query: 191 YAKRQKTWLCHQFQADWIRISSIDDLF 217
           YAKRQ TW  +Q   DW   +S +++F
Sbjct: 275 YAKRQSTWFRNQLGEDWRVYASGEEVF 301


>gi|323486937|ref|ZP_08092252.1| hypothetical protein HMPREF9474_04003 [Clostridium symbiosum
           WAL-14163]
 gi|323399709|gb|EGA92092.1| hypothetical protein HMPREF9474_04003 [Clostridium symbiosum
           WAL-14163]
          Length = 317

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 104/221 (47%), Gaps = 7/221 (3%)

Query: 1   MLSKKL-----QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYG 54
           M  KK        Y +  LPII GGTG Y +AL   +     E   A R  +    ++ G
Sbjct: 76  MFQKKAREALEDIYSRGSLPIIAGGTGFYIQALLYDIDFTETEEDNAFRCGMERLAREKG 135

Query: 55  SHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK 114
              LH  L   D   A  IHP++ +R+ RALE    +G+ I +  +       P +  + 
Sbjct: 136 PGFLHAMLKQADPESAAAIHPNNIKRVIRALEYHHQTGEKISDHNESERQKESPYQFFYY 195

Query: 115 IIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGE 174
           ++   +R+ L ERI RR  QM+  G I+E++SL  M  +  +  M+ +G ++I+  L G 
Sbjct: 196 VV-NTDRAILYERIDRRVDQMIRDGLIEEVKSLRAMGCTRQMVSMQGLGYKEIMDYLDGL 254

Query: 175 INYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +E +      T  +AKRQ TW   +    W+ +   D+
Sbjct: 255 YSLEEAIHILKRDTRHFAKRQLTWFKRERCVRWLNLPDFDN 295


>gi|188991939|ref|YP_001903949.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|229621761|sp|B0RTZ0|MIAA_XANCB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167733699|emb|CAP51904.1| tRNA isopentenyltransferase [Xanthomonas campestris pv. campestris]
          Length = 327

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/211 (33%), Positives = 106/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  +PI+ GGTGLYFRA    L+ MPE   A+R  I  + +Q G   LH +L+ +D
Sbjct: 91  QIVARGKIPILAGGTGLYFRAALEGLAQMPEADPAVRLAIAAEAEQVGWGALHAQLARID 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +  +   P  P+     ++   +R+ L  
Sbjct: 151 PVAAARIHATDRQRIQRALEVYRISGKPISYWQTRPAGPRAPVRVLKLVLAPRQRAVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI  R   ML  G + E+  L  +          DLP ++A+G R     L G  +  E+
Sbjct: 211 RIAMRLDVMLADGFLTEVEQLRALPQMRAVAAPLDLPAVRAVGYRQAWEYLDGAGSLAES 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + + AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAVQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|52425572|ref|YP_088709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mannheimia
           succiniciproducens MBEL55E]
 gi|61214027|sp|Q65SD6|MIAA_MANSM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|52307624|gb|AAU38124.1| MiaA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 314

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 74/210 (35%), Positives = 114/210 (54%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +     ++  +P++VGGT LY++AL   LS +P+    +R KI EK +++G   LH E
Sbjct: 84  LREMADITEQGRIPLLVGGTMLYYKALLEGLSPLPQADEKVRSKIEEKAQKFGWATLHKE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D + A +I+P+D QRI RALE+  +SG+S+ E   +     +P       I   +R
Sbjct: 144 LSLIDPVSAARINPNDSQRINRALEVFYISGKSMTEL-TEQKGEQLPYHILQFAIAPEDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L  RI  RF +M+ESG   E+  L          P ++ +G R +   L+G+ + DE 
Sbjct: 203 AILHRRIEMRFHKMIESGFKQEVERLYHRGDLHIDLPSIRCVGYRQMWEHLRGDYDLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 263 VFRGICATRQLAKRQITWLRGWKYPIQWLD 292


>gi|261367032|ref|ZP_05979915.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Subdoligranulum
           variabile DSM 15176]
 gi|282571150|gb|EFB76685.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Subdoligranulum
           variabile DSM 15176]
          Length = 314

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/204 (30%), Positives = 104/204 (50%), Gaps = 2/204 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
             LP++VGGTGLY  +L   ++  PE    AIR+ ++++ ++ G+  L+D L  +D   A
Sbjct: 97  GHLPLVVGGTGLYITSLLNGITFAPERSDPAIRKTLQQEAEEKGAGELYDRLKKIDPEYA 156

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
            ++HP +  RI RALE+  ++G+ + E  + +     P  S    +   +R  L  RI +
Sbjct: 157 AKVHPHNLPRIIRALELFQITGRRMSEQQQSSRPEIPPYRSLCLCLTCRDRGTLYRRIDQ 216

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           R   MLE G + E + + +          +AIG ++     +G  + +E   R   AT +
Sbjct: 217 RVDTMLEQGILPEAKMVWQHK-GQYQTAAQAIGYKEFFPYFEGTQSLEECTVRLKQATRQ 275

Query: 191 YAKRQKTWLCHQFQADWIRISSID 214
           YAKRQ TW  HQ +A W+     D
Sbjct: 276 YAKRQLTWFRHQNEAVWLYTDEED 299


>gi|302389747|ref|YP_003825568.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermosediminibacter oceani DSM 16646]
 gi|302200375|gb|ADL07945.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermosediminibacter oceani DSM 16646]
          Length = 314

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/206 (31%), Positives = 107/206 (51%), Gaps = 2/206 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             + +  LPI+ GGTGLY  A+    +    E    +R +++ + ++YG+  L+++L  +
Sbjct: 88  DIHARGKLPILSGGTGLYVNAVCYNYAFCDFEKDEELRLQLKSEAEKYGNEFLYEKLKQV 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP++ +RI RALE+ + +G       +       P +     +  P R  L 
Sbjct: 148 DPKAAEKIHPNNLRRIIRALEVYIKTGVPFSYSEELTKQQESPYDLLIFGLTRP-REELY 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI +R   M+E G +DE++ L++M  S DL  M+ +G R II  L+G I  +E +    
Sbjct: 207 ERINKRVLLMIEKGFVDEVKRLLEMGYSEDLNPMQGLGYRQIIDYLQGRITLEEAIYLIS 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS 211
             T +YAKRQ TW        W+ +S
Sbjct: 267 RDTRRYAKRQYTWFRKDKNIIWLDVS 292


>gi|291550402|emb|CBL26664.1| tRNA isopentenyltransferase (miaA) [Ruminococcus torques L2-14]
          Length = 319

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 62/215 (28%), Positives = 106/215 (49%), Gaps = 3/215 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHIL 58
           M  + ++  Y++  +PI+VGGTG Y +AL   +        TA RE++    K  G+  L
Sbjct: 84  MAKEAMEGIYQRGHIPIVVGGTGFYIQALLYDIDFTENNADTAYREELEALAKTQGAEYL 143

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L  +D   A QIH  + +R+ RALE    +GQ I E  +          SA+ ++  
Sbjct: 144 HEMLEKVDPESAEQIHFHNVKRVIRALEYYQQTGQKISEHNEAEREKKSAYNSAYFVLTD 203

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R   M++ G ++E+ +L    L  +   M+ +G +++    +GE   +
Sbjct: 204 -DRKILYDRIDKRVDLMMQEGLLEEVNALRLRGLKRESVAMQGLGYKELFGYFEGEYPLE 262

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E ++     T  +AKRQ TW   +    W+  S I
Sbjct: 263 EAVRIIKRDTRHFAKRQLTWFRRERDVIWLDKSEI 297


>gi|118444282|ref|YP_878180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           novyi NT]
 gi|239977395|sp|A0Q0M8|MIAA_CLONN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|118134738|gb|ABK61782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           novyi NT]
          Length = 314

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 112/214 (52%), Gaps = 2/214 (0%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDE 61
           +       +  LP+IVGGTG Y  +L               RE ++    ++G   +H+ 
Sbjct: 83  NAIKDIASRGKLPMIVGGTGFYIDSLIFNYDFANTYKDEEYREHLKNLASEHGKEYVHEL 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +  ++++P+D +R+ RALE+  ++G++I EF K+     IP    + ++   +R
Sbjct: 143 LKDIDEVSYKKLYPNDLKRVIRALEVFKLTGKTISEFNKEQDIFDIPYNVYYFVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           S L ERI +R   M+E G I+E++SL  M  + D+  MK IG ++I+  L G+++ DE +
Sbjct: 202 SKLYERINKRVDIMMEKGLIEEVKSLQNMGCTPDMQSMKGIGYKEILYYLDGKLSLDEAV 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           +     +  YAKRQ TW     + +WI      D
Sbjct: 262 ELIKKGSRHYAKRQLTWFRKDNRVNWIDKDQYKD 295


>gi|297617262|ref|YP_003702421.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297145099|gb|ADI01856.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 310

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 110/216 (50%), Gaps = 7/216 (3%)

Query: 2   LSKKLQRYK-KRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILH 59
             K +Q    +  LPI+VGGTGLY++A+       P      IR+++ ++  +     L+
Sbjct: 79  AKKVIQDLNNRGKLPILVGGTGLYYQAVVDDYEFSPLLADPDIRQQLEKEADE-SLERLY 137

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           +EL S+D    R I P+D +RI RALE+  ++G+   +F  +       L     + +  
Sbjct: 138 NELESVDPASTRIIKPNDRKRIIRALEVYRLTGRPFSQFQTRNQG----LYQLAVVGLCA 193

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
            R+ L  RI  R   M+ESG ++E+++L      L L  M+A+G + I+  LKG ++ ++
Sbjct: 194 ARTELYRRIEARVDAMIESGFVEEVKTLYAKGYDLPLNSMQALGYKQILQYLKGGMSLEQ 253

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            +      T +YAKRQ TW     +  W+ I+   +
Sbjct: 254 AVAEIKKETRRYAKRQLTWFRKDKRIFWLDITEYKE 289


>gi|212212504|ref|YP_002303440.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212218527|ref|YP_002305314.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuK_Q154]
 gi|239977355|sp|B6J7C0|MIAA_COXB1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|239977356|sp|B6J017|MIAA_COXB2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|212010914|gb|ACJ18295.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212012789|gb|ACJ20169.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii CbuK_Q154]
          Length = 301

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 110/212 (51%), Gaps = 3/212 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K ++   +   P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+
Sbjct: 78  KTIEI--RNRTPLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLN 135

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           ++D   A +I+P+D QRI RA E+   +GQ +  +        +P +  + I+    RS 
Sbjct: 136 AIDPKSAARINPNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINLILAPENRSW 195

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF QML++  ++E+R L          P ++ +G R +   L GE +Y+    
Sbjct: 196 LHQRIEKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRH 255

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + I AT + AKRQ TWL     A W      D
Sbjct: 256 KAIAATRQLAKRQLTWLRRWPDAKWFNSEDKD 287


>gi|295110015|emb|CBL23968.1| tRNA isopentenyltransferase (miaA) [Ruminococcus obeum A2-162]
          Length = 314

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 64/209 (30%), Positives = 103/209 (49%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQYGSHILHDELSSL 65
           + Y K  LPI+VGGTG Y +A+T  +           R ++ +  ++ G+  LH+ L  +
Sbjct: 87  EIYAKGKLPILVGGTGFYIQAVTRDIDFTEAQQENTYRAELEKLAEEKGAEYLHECLREV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE    +G  I E  ++      P   A+ ++  P R  L 
Sbjct: 147 DPASAEAIHANNVKRVIRALEFYHQNGTPISEHNEEQKKQVSPYNLAYFVLNAP-REILY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR  QMLE G + E+  L +      +  M+ +G ++I+A L+GE   +E ++   
Sbjct: 206 ERIDRRVDQMLEEGLVKEVADLRQEGCHRGMVSMQGLGYKEILAYLEGEYPLEEAVRILK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W+     D
Sbjct: 266 RDTRHFAKRQLTWFRRESDVIWVDKEKFD 294


>gi|303328442|ref|ZP_07358879.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. 3_1_syn3]
 gi|302861436|gb|EFL84373.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           sp. 3_1_syn3]
          Length = 319

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/212 (30%), Positives = 110/212 (51%), Gaps = 2/212 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
            +K  +   +   P++VGGTGLYF+AL   ++ +P +  AI  ++  +L   G+  LH E
Sbjct: 90  AAKARELLARGKTPLLVGGTGLYFQALLRGIADIPPLDPAIGARLEARLDAEGAPALHAE 149

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L   D   A +IHP+D QRIARALE++  +G+    + + A     PL     +++  + 
Sbjct: 150 LRKADPAYAARIHPNDRQRIARALEVREGTGRPFSWWHENA--MAAPLCRGPLLVLNADL 207

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L+ R+ RR   ML +GA++E      +      P    IG  + +A L+G I+ +E  
Sbjct: 208 AWLEPRLARRLDLMLAAGALEEAEKARALCDDPAAPGWSGIGAAEALAHLQGRISLEECR 267

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           +  +  T  YAKRQ TW   + +A ++    +
Sbjct: 268 RLWLRNTRAYAKRQLTWFRARPEAIFLPPDDV 299


>gi|223041564|ref|ZP_03611765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor 202]
 gi|223017659|gb|EEF16069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor 202]
          Length = 312

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 120/215 (55%), Gaps = 3/215 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     IR +I ++ +Q G   LH E
Sbjct: 84  LKEMADITASGRIPLLVGGTMLYYKALIEGLSPLPSADPNIRAEIEQRAEQQGWAALHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +I+P+D QRI RALE+  ++G+++ E   +      P +     I   ER
Sbjct: 144 LLKIDPVAGTRINPNDSQRINRALEVFYITGKTMTELTAEQGESL-PYDVLQFAIAPQER 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L ERI +RF +M+  G  +E++ L +  +L +DLP ++ +G R +   L+GEI+ DE 
Sbjct: 203 AVLHERIEQRFHKMIALGFEEEVKKLYERSDLHIDLPSIRCVGYRQMWEYLQGEISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSID 214
           + +GI AT + AKRQ TWL     +  W+   + +
Sbjct: 263 IFKGICATRQLAKRQITWLRSWQSELTWLDSLAPE 297


>gi|325263902|ref|ZP_08130635.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           D5]
 gi|324030940|gb|EGB92222.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium sp.
           D5]
          Length = 319

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 61/208 (29%), Positives = 103/208 (49%), Gaps = 2/208 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLD 66
            Y++  +PIIVGGTG Y +++   +     E  T  RE + +   + G+  LH  L   D
Sbjct: 88  IYERGHIPIIVGGTGFYIQSVLYDIDFTENERDTRYREYLEQLADEQGAACLHKMLREAD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IH ++ +R+ RALE    +G+ I +   +      P    + ++   +R+ L E
Sbjct: 148 PKSADEIHENNVKRVIRALEFYQQTGKRISDHNAEERKKESPYNCVYFVLCD-DRAKLYE 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR   M+E G ++E+++L    L  +   M+ +G ++I+A L  EI  +E + R   
Sbjct: 207 RIDRRVDLMMEEGLVEEVKALKSHGLGRNQVSMQGLGYKEIMAYLDHEITLEEAVYRIKR 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
            T  +AKRQ TW   +    W+     D
Sbjct: 267 DTRHFAKRQITWFKRERDVIWLNKQDFD 294


>gi|241760079|ref|ZP_04758177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           flavescens SK114]
 gi|241319533|gb|EER55963.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           flavescens SK114]
          Length = 313

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 114/211 (54%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +   P IVGGT +YF ALT  L+ +P    A+R +++ +  ++G   L+  L  +D
Sbjct: 88  EIHARGRYPFIVGGTMMYFHALTEGLNDLPSADAAVRAQLQAEKNEHGLAGLYRRLQEVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++  +D QRI RALE+ L++G+ + E + +       L+     +I  +R  L  
Sbjct: 148 PITAGRLKANDSQRIERALEVYLLTGKPLNEHFTEQKQAAPLLDLCTVALIPEDRHLLHR 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           +I +RF  MLE G +DE+  L +    L   +P M+ +G R     L+GE +YD  +++G
Sbjct: 208 QIEKRFLNMLEHGFLDEMHGLRRDYPQLHADMPSMRCVGYRQAWDYLEGETDYDTFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           I+AT + AKRQ TWL     A  +   +  D
Sbjct: 268 IVATRQLAKRQLTWLRKIPLAHTLDPYADSD 298


>gi|225018514|ref|ZP_03707706.1| hypothetical protein CLOSTMETH_02461 [Clostridium methylpentosum
           DSM 5476]
 gi|224948715|gb|EEG29924.1| hypothetical protein CLOSTMETH_02461 [Clostridium methylpentosum
           DSM 5476]
          Length = 319

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 102/214 (47%), Gaps = 4/214 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           + ++ +   + +  +P++VGGTGLY  +L   ++    E    +RE++R +  + G   L
Sbjct: 84  LANQAIDDIHSRGHIPVLVGGTGLYVDSLLENITFTETETDPLLREQLRLRAVEEGGESL 143

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
             EL+  D   A  +HP++  RI R +EI   +G ++ E   ++             +  
Sbjct: 144 LAELAEFDPSYADTLHPNNINRIIRGIEIYRTTGMTMSEHRIRSRQVPSRFAPCLIGLNY 203

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R   M+E G + E +++++   S     ++AIG +++     GE + D
Sbjct: 204 TDRKLLYQRIDQRVDLMVEQGLLQEAQAVLQQ--SDLKTAVQAIGYKELKPYFAGECSLD 261

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
           E L      T +YAKRQ TW     Q  WI    
Sbjct: 262 EALDNLKRQTRRYAKRQLTWFRKNSQIHWIYPDQ 295


>gi|85373931|ref|YP_457993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Erythrobacter
           litoralis HTCC2594]
 gi|122544590|sp|Q2NAU5|MIAA_ERYLH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84787014|gb|ABC63196.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           litoralis HTCC2594]
          Length = 317

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 81/217 (37%), Positives = 116/217 (53%), Gaps = 8/217 (3%)

Query: 2   LSKKLQRYKK----RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHI 57
            S+  +   K      +PI+VGGTGLY R L   ++ +P I  AIRE IR          
Sbjct: 92  ASRAKEEISKAHFTGAVPILVGGTGLYLRTLLEGIAPIPPIDAAIREAIRA----LPQDE 147

Query: 58  LHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIII 117
               L   D   ++++ P+D  R ARALE+   +G+++  + +          + H +I+
Sbjct: 148 ARAALEREDPDASKRLAPADAARTARALEVVRSTGRTLSNWQQHKKGGIGDRVALHPLIM 207

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
           LP+R  L  R  RRF  ML+ GA  E+ +L+  +L   LP+M+AIGVR+I A LKGEI+ 
Sbjct: 208 LPDRKWLYARCDRRFELMLDRGAASEVETLLARDLDPSLPVMRAIGVREIAAWLKGEIDR 267

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
            + +  G  AT  YAKRQ TW  HQ   DW RI + D
Sbjct: 268 PQMIASGQQATRNYAKRQYTWFRHQPPPDWPRIETFD 304


>gi|240948253|ref|ZP_04752639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor NM305]
 gi|240297292|gb|EER47833.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           minor NM305]
          Length = 312

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 73/215 (33%), Positives = 120/215 (55%), Gaps = 3/215 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P    +IR +I ++ +Q G   LH E
Sbjct: 84  LKEMADITASGRIPLLVGGTMLYYKALIEGLSPLPSADPSIRAEIEQRAEQQGWATLHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D +   +I+P+D QRI RALE+  ++G+++ E   +      P +     I   ER
Sbjct: 144 LLKIDPVAGTRINPNDSQRINRALEVFYITGKTMTELTAEQGESL-PYDVLQFAIAPQER 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L ERI +RF +M+  G  +E++ L    +L +DLP ++ +G R +   L+GEI+ DE 
Sbjct: 203 AVLHERIEQRFHKMIALGFEEEVKKLYARSDLHIDLPSIRCVGYRQMWEYLQGEISLDEA 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIRISSID 214
           + +GI AT + AKRQ TWL     +  W+   + +
Sbjct: 263 IFKGICATRQLAKRQITWLRSWQSELTWLDSLAPE 297


>gi|209363987|ref|YP_001424549.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|207081920|gb|ABS77397.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii Dugway 5J108-111]
          Length = 337

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 110/212 (51%), Gaps = 3/212 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K ++   +   P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+
Sbjct: 114 KTIEI--RNRTPLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLN 171

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           ++D   A +I+P+D QRI RA E+   +GQ +  +        +P +  + I+    RS 
Sbjct: 172 AIDPKSAARINPNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINLILAPENRSW 231

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF QML++  ++E+R L          P ++ +G R +   L GE +Y+    
Sbjct: 232 LHQRIEKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRH 291

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + I AT + AKRQ TWL     A W      D
Sbjct: 292 KAIAATRQLAKRQLTWLRRWPDAKWFNSEDKD 323


>gi|29654389|ref|NP_820081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 493]
 gi|164685700|ref|ZP_01946750.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|46576987|sp|Q820W3|MIAA_COXBU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189081950|sp|A9KE31|MIAA_COXBN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|29541656|gb|AAO90595.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 493]
 gi|164601207|gb|EAX32617.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii 'MSU Goat Q177']
          Length = 311

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 68/212 (32%), Positives = 110/212 (51%), Gaps = 3/212 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K ++   +   P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+
Sbjct: 88  KTIEI--RNRTPLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLN 145

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           ++D   A +I+P+D QRI RA E+   +GQ +  +        +P +  + I+    RS 
Sbjct: 146 AIDPKSAARINPNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINLILAPENRSW 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF QML++  ++E+R L          P ++ +G R +   L GE +Y+    
Sbjct: 206 LHQRIEKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRH 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + I AT + AKRQ TWL     A W      D
Sbjct: 266 KAIAATRQLAKRQLTWLRRWPDAKWFNSEDKD 297


>gi|88704497|ref|ZP_01102211.1| tRNA isopentenyltransferase [Congregibacter litoralis KT71]
 gi|88701548|gb|EAQ98653.1| tRNA isopentenyltransferase [Congregibacter litoralis KT71]
          Length = 313

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 70/207 (33%), Positives = 110/207 (53%), Gaps = 2/207 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   PI+VGGT LY+ AL    + MP     +R +I     + G   +H EL+ +D
Sbjct: 73  EIRSRGRRPILVGGTMLYYSALLQGFAAMPPADPDVRAEIAATAAKEGWPAVHRELARVD 132

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
           +  A +IHP+  QR++RALE+  +SG+++ E  +Q  +       A  I    ER  L E
Sbjct: 133 AEAAARIHPNHSQRLSRALEVYRLSGKTMTELHRQTRDSSSEQVLAVAIA-PAERRVLHE 191

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF QM+ +G ++E+R L +        P ++A+G R + A L+GE + +E  + G+
Sbjct: 192 RIATRFAQMMAAGFLEEVRGLRERGDLHRDLPAIRAVGYRQLWAHLEGECSVEEAQELGV 251

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
           +AT + AKRQ TWL       WI    
Sbjct: 252 VATRQLAKRQFTWLRKWPDLQWIHTDD 278


>gi|159185023|ref|NP_355007.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Agrobacterium
           tumefaciens str. C58]
 gi|61228129|sp|P0A3Q5|MIAA_AGRT5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|61228130|sp|P0A3Q6|MIAA_RHIRD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|142240|gb|AAA22091.1| delta-2-isopentenyltransferase transfer RNA [Agrobacterium
           tumefaciens]
 gi|159140297|gb|AAK87792.2| tRNA delta(2)-isopentenylpyrophosphate [Agrobacterium tumefaciens
           str. C58]
          Length = 298

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 94/199 (47%), Positives = 129/199 (64%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
              P+IVGGTGLYF+ALTG LS MP IP  +RE +R +L + G+  LH EL S D  +A+
Sbjct: 98  GRFPVIVGGTGLYFKALTGGLSDMPAIPDDLREGLRARLIEEGAAKLHAELVSRDPSMAQ 157

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            + P DGQRI RALE+   +G+SI +F + +    I  E A K I+LPER  L +RI RR
Sbjct: 158 MLQPGDGQRIVRALEVLEATGKSIRDFQRASGPMIIDPERAQKFIVLPERPVLHDRINRR 217

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  M++SGA++E+++L+ +NL+ D   MKAIGV  I  +L G +   E +++   AT +Y
Sbjct: 218 FEAMMDSGAVEEVQALLALNLAPDATAMKAIGVAQIADMLTGRMGAAEVIEKSAAATRQY 277

Query: 192 AKRQKTWLCHQFQADWIRI 210
           AKRQ TW  +Q   DW RI
Sbjct: 278 AKRQMTWFRNQMGDDWTRI 296


>gi|78223259|ref|YP_385006.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           metallireducens GS-15]
 gi|123571654|sp|Q39TZ3|MIAA_GEOMG RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|78194514|gb|ABB32281.1| tRNA isopentenyltransferase [Geobacter metallireducens GS-15]
          Length = 309

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 106/211 (50%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++    I+VGGTGLY R LT  L   P     IR ++ ++    G   LH  L+++D
Sbjct: 91  DIERRGKRVILVGGTGLYIRILTQGLVASPGGDDNIRRELEDQAHGEGLESLHRRLAAVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A ++HP+DG RI RALE+ L++G+ +  F +       P     K+ I  ER  L  
Sbjct: 151 PVAAARLHPNDGVRIVRALEVFLLTGRPLSAFQEAHRFADEPYRCL-KLGITVERELLYR 209

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           R+  R  +M+  G ++E+R L+       L  M +IG R+I A L GE + DE ++    
Sbjct: 210 RVEERVDRMIAEGLVEEVRGLLSAGYPATLKAMGSIGYREICAHLAGEFSLDEAMRLIKQ 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIR-ISSIDDL 216
            T +YAKRQ TW     +  W+      D +
Sbjct: 270 NTRQYAKRQMTWFRRDSEIIWVEYPGKFDSI 300


>gi|323691985|ref|ZP_08106233.1| hypothetical protein HMPREF9475_01096 [Clostridium symbiosum
           WAL-14673]
 gi|323503908|gb|EGB19722.1| hypothetical protein HMPREF9475_01096 [Clostridium symbiosum
           WAL-14673]
          Length = 317

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 104/221 (47%), Gaps = 7/221 (3%)

Query: 1   MLSKKL-----QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYG 54
           M  KK        Y +  LPII GGTG Y +AL   +     E   A R  +    ++ G
Sbjct: 76  MFQKKAREALEDIYSRGSLPIIAGGTGFYIQALLYDIDFTETEEDNAFRCGMERLAREKG 135

Query: 55  SHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK 114
              LH  L   D   A  IHP++ +R+ RALE    +G+ I +  +       P +  + 
Sbjct: 136 PGFLHAMLKQADPESAAAIHPNNIKRVIRALEYHHQTGEKISDHNEAERQKESPYQFFYY 195

Query: 115 IIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGE 174
           ++   +R+ L ERI RR  QM+  G I+E++SL  M  +  +  M+ +G ++I+  L G 
Sbjct: 196 VV-NTDRAILYERIDRRVDQMIRDGLIEEVKSLRAMGCTRQMVSMQGLGYKEIMDYLDGL 254

Query: 175 INYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +E +      T  +AKRQ TW   +    W+ +   D+
Sbjct: 255 YSLEEAIHILKRDTRHFAKRQLTWFKRERCVRWLNLPDFDN 295


>gi|255067650|ref|ZP_05319505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria sicca
           ATCC 29256]
 gi|255048124|gb|EET43588.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria sicca
           ATCC 29256]
          Length = 313

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 78/206 (37%), Positives = 119/206 (57%), Gaps = 2/206 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP+IVGGT +YF ALT  L+ +PE   A+R +++E+ +QYG   L+  L ++D
Sbjct: 88  EIRARGRLPLIVGGTMMYFHALTEGLNDLPEADAAVRARLQEEKQQYGLVHLYQSLQTID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+ +   + +  +   PL+     +I   R+ L E
Sbjct: 148 PETAGRLKPNDSQRIERALEVYRLTGKPLSAHFAEKADYTPPLDLCTTALIPENRALLHE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLS--LDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I RRFTQMLE G IDE+R+L +       D+P M+ +G R     L+G  +YD  +++G
Sbjct: 208 NIARRFTQMLEQGFIDEMRALRQKYPELTADMPAMRCVGYRQAWDYLEGLTDYDTFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRI 210
           I AT + AKRQ TWL     A  I  
Sbjct: 268 IAATRQLAKRQLTWLRKIPLAHSIDP 293


>gi|299535285|ref|ZP_07048608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lysinibacillus
           fusiformis ZC1]
 gi|298729267|gb|EFI69819.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lysinibacillus
           fusiformis ZC1]
          Length = 300

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 59/211 (27%), Positives = 104/211 (49%), Gaps = 2/211 (0%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDE 61
           +K  +   ++ LPIIVGG+GLY +A+        E +    R+   E+L++ G   +HD+
Sbjct: 89  AKIAEIQSRQKLPIIVGGSGLYVQAVLYDFQFTDEKVDVEARKAYYEELEKLGPEAMHDK 148

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD   A  IHP++ +R+ RALE+  +SG S     +      +       +     R
Sbjct: 149 LKKLDPQTAETIHPNNTRRVIRALEMLELSGVSKAAEAQNRGEVPLYNHVILGLGQNMSR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L +RI RR   M+E+G + E++ L + N+      ++AIG +++   L G+   +E +
Sbjct: 209 DVLYDRINRRVDLMMENGLLQEVKGLWQRNIRGVQS-IQAIGYKELYDYLDGKCTLEEAI 267

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
                 + +YAKRQ T+  ++    +I    
Sbjct: 268 DSLKQNSRRYAKRQLTYFRNKMDVHFITPDD 298


>gi|297544630|ref|YP_003676932.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296842405|gb|ADH60921.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 315

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 119/217 (54%), Gaps = 4/217 (1%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++    +K+  LPIIVGGTGLY  ++   +     +     REK++E    YG+  L+
Sbjct: 81  AKEIIKDIHKRGKLPIIVGGTGLYINSIIYIMHFSDFKGSKEFREKMKELANNYGNQYLY 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIIL 118
           + L S+D   A++IHP+D +RI RALE+   +G+ I  + K +     P  +     +  
Sbjct: 141 ERLKSVDPEAAKKIHPNDIRRIIRALEVYEFTGKPISYYQKMSGMRLNPEYQPIMIGLNF 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L +RI +R  +M+++  ++E+ +L+K+  + D   ++A+G ++I+  LKGEI+ +
Sbjct: 201 RNRQILYDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTALQALGYKEIVEYLKGEISLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +++    T +YAKRQ TW        W  +    +
Sbjct: 261 EAVEKIKKGTRRYAKRQITWFKGYEFIKWFFVDDYKN 297


>gi|168180371|ref|ZP_02615035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum NCTC 2916]
 gi|226949039|ref|YP_002804130.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A2 str. Kyoto]
 gi|254811015|sp|C1FNT7|MIAA_CLOBJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|182668831|gb|EDT80809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum NCTC 2916]
 gi|226841913|gb|ACO84579.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A2 str. Kyoto]
          Length = 311

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 106/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + K  LPIIVGGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKDIWNKGKLPIIVGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  I+
Sbjct: 139 HSLLKDIDEESYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFIL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMSKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|192358868|ref|YP_001983534.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cellvibrio
           japonicus Ueda107]
 gi|239977196|sp|B3PDC2|MIAA_CELJU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|190685033|gb|ACE82711.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Cellvibrio
           japonicus Ueda107]
          Length = 338

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 112/203 (55%), Gaps = 7/203 (3%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            +++  +P++VGGT LYFRAL   L+ MP   T++R +I     Q+G   +H +L+ +D 
Sbjct: 91  IHRQGNIPLLVGGTMLYFRALLDGLAQMPAADTSVRAQIEADAAQFGWPYVHQQLAEVDP 150

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP------NPFIPLESAHKIIILPER 121
            VA  IHP+  QR++RALE+  VSG+++ +  ++                    I   +R
Sbjct: 151 DVAADIHPNHSQRVSRALEVYRVSGKTMTQLRREQQASGDVRAFEDRYCVRQIAISPRDR 210

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF  ML  G ++E+R L +        P ++A+G R +   L  +++YDE 
Sbjct: 211 AILHQRIEQRFHAMLAQGLVEEVRRLYQRGDLHTDLPAIRAVGYRQVWDYLDDKLHYDEM 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQF 203
           + RGIIAT + AKRQ TWL    
Sbjct: 271 VARGIIATRQLAKRQFTWLRGWM 293


>gi|253577910|ref|ZP_04855182.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850228|gb|EES78186.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 314

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 105/209 (50%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +P++VGGTG Y +A+T  +     E     R+++ +   + G+  LH  L ++
Sbjct: 87  EIYAKGKIPVLVGGTGFYIQAITKDIDFTQAEQEDGYRQELEQLAAEKGNEYLHQMLLNV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D + A +IH ++ +R+ RALE    +   I    ++      P   A+ ++ +P R  L 
Sbjct: 147 DPVSAGEIHANNVKRVIRALEFYHQNQSPISAHNQEQKEHETPYNLAYFVLNVP-RELLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R  +ML+ G ++E++ L  M     +  M+ +G ++I+A L GE   +E ++   
Sbjct: 206 KRIDDRIDEMLKEGLLEEVQKLKDMGYHRGMVSMQGLGYKEILAYLDGEYPLEEAVRILK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W+     D
Sbjct: 266 RDTRHFAKRQLTWFRREKDTIWMNKDEFD 294


>gi|78043010|ref|YP_360226.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|123576195|sp|Q3ACA8|MIAA_CARHZ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|77995125|gb|ABB14024.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 311

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 108/213 (50%), Gaps = 5/213 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  +PIIVGGTGLY R++               R K+ +  K+ GS  LH  L  +
Sbjct: 87  EINERGKIPIIVGGTGLYIRSVIDPYDFTDFSFDPVFRGKLEQAAKEKGSSYLHQMLEKI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D + A++IH +D +RI RALE+   +G+  I ++ +      P        +  +R+ L 
Sbjct: 147 DPVAAQKIHSNDLRRIIRALEVYEHTGKP-ISYYWERGKQSKPQYRLLYYGLTMDRALLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R  +M+E G I E++ L++M        M+A+G ++I+  L+G+I  DE +    
Sbjct: 206 QRINERVDKMIEKGLIAEVKRLLQMGFKESTA-MQALGYKEIVQYLEGKITLDEAIYLIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRI--SSIDDL 216
             T ++AKRQ TW     +  W      S++ +
Sbjct: 265 RDTRRFAKRQLTWFRRDPRIKWFDSGKESLEKI 297


>gi|228998475|ref|ZP_04158064.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides Rock3-17]
 gi|228761266|gb|EEM10223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides Rock3-17]
          Length = 316

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 108/210 (51%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H++L  +
Sbjct: 91  EITERGKLPIIVGGTGLYIQSVLYDYQFTDEAGDPVYREELEKLATEHGVEYVHEKLREV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI   +GQ + +  ++  N    L     I +  +R  L 
Sbjct: 151 DPESASRIHMNNVRRVIRALEIFHTTGQKMSDQLEKQENEL--LYDVSLIGLTMDRGMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M++ G + E+++L +  +      ++AIG +++    +G ++ +E + +  
Sbjct: 209 DRINLRVDLMVKQGLLQEVKALYENGVRDCQS-IQAIGYKELYNYFEGHVSLEEAIMQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|307292651|ref|ZP_07572497.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           chlorophenolicum L-1]
 gi|306880717|gb|EFN11933.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingobium
           chlorophenolicum L-1]
          Length = 314

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 84/220 (38%), Positives = 124/220 (56%), Gaps = 10/220 (4%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           S+  + ++   LPI+VGGTGLY R L   ++ +P+I  AIR  IR           H  L
Sbjct: 93  SEIDKAHEAGRLPILVGGTGLYLRTLLDGIAPIPDIDPAIRAVIRAM----PVADAHAAL 148

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
           +  D   A ++ P+D  R+ARALE+   +G+ + ++ +          +   +I+LP R 
Sbjct: 149 AKEDPEAAARLAPADTTRVARALEVVRSTGKPLAQWQQHKSGGIADRIALSPLILLPPRD 208

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L  R   RF QM++SGA+ E+ +L+  NLS DLP+M+AIGV +I A L GEI+ D+ L+
Sbjct: 209 WLTARCDLRFGQMVDSGAVAEVEALIARNLSPDLPVMRAIGVPEIAAWLAGEIDRDKMLE 268

Query: 183 RGIIATNKYAKRQKTWLCHQFQADW------IRISSIDDL 216
           RG IAT +YAKRQ TW   Q   +W      I    +D+L
Sbjct: 269 RGRIATRQYAKRQYTWFSRQPPPEWPRDERQIDAKILDEL 308


>gi|325680311|ref|ZP_08159871.1| tRNA dimethylallyltransferase [Ruminococcus albus 8]
 gi|324108020|gb|EGC02276.1| tRNA dimethylallyltransferase [Ruminococcus albus 8]
          Length = 320

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 62/218 (28%), Positives = 107/218 (49%), Gaps = 4/218 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHIL 58
           + S+K+ +   +  LPII GGTGLY  +L   +         AIR ++ ++ K+ G+H L
Sbjct: 83  LASEKIREVRNRGHLPIICGGTGLYISSLVDNIIFDDTGSDPAIRARLEKQAKEEGAHAL 142

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
             +L  +D   A ++H ++  R+ R LE+  ++G  + E    +     P  +    +  
Sbjct: 143 WLKLCEVDPETAAKVHENNLPRVIRGLEVFELTGTRLSEHKLNSRREPSPYNACIIGLTA 202

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L +RI RR   M E+G ++E R + +          +AIG ++++   +G  + +
Sbjct: 203 ENRQYLYDRIERRVHIMAENGMVEECREVWQKGGLATAG--QAIGYKELVPYFEGSASLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           E L + I+ T  YAKRQ TW        W++I   DDL
Sbjct: 261 ECLDKIILETRHYAKRQLTWFRRVDNISWVKIDIFDDL 298


>gi|229086282|ref|ZP_04218462.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-44]
 gi|228697025|gb|EEL49830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-44]
          Length = 316

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 110/210 (52%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  K+  LPIIVGGTGLY +++        E      R+++ +   ++G   +H +L  +
Sbjct: 91  EITKRGKLPIIVGGTGLYIQSVLYDYQFTNEAGNPEYRKELEQLATEHGVEYVHKKLQEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI  ++G+ +    ++  N    L     I +  +R  L 
Sbjct: 151 DPESANRIHANNVRRVIRALEIFRMTGEKLSNQLEKQENEL--LYDVSLIGLTMDREMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M+E G + E+++L + N   +   ++AIG +++    +G ++ +E + +  
Sbjct: 209 DRINLRVDLMVEQGLLQEVKALYE-NEVKNCQSIQAIGYKELYDYFEGHVSLEEAIVQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++   +W  +++ + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVNWFDVTAGEK 297


>gi|261364638|ref|ZP_05977521.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa ATCC 25996]
 gi|288567234|gb|EFC88794.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa ATCC 25996]
          Length = 313

 Score =  158 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 77/213 (36%), Positives = 121/213 (56%), Gaps = 3/213 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP+IVGGT +YF ALT  L+ +PE   A+R +++E+  +YG   L+  L ++D
Sbjct: 88  EVRARGRLPLIVGGTMMYFHALTEGLNDLPEADAAVRAELQEEKNRYGLAHLYQNLQTID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+ +   + +  +   PL+     +I   R+ L E
Sbjct: 148 PETAGRLKPNDSQRIERALEVYRLTGKPLSAHFAEKADYTPPLDLCTTALIPENRALLHE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLS--LDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I RRFTQMLE G I+E+R+L +       D+P M+ +G R     L+G  +YD  +++G
Sbjct: 208 NIARRFTQMLEQGFINEMRALRQKYPELTADMPSMRCVGYRQAWDYLEGLTDYDTFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRI-SSIDDL 216
           I AT + AKRQ TWL     A  I   +  D +
Sbjct: 268 IAATRQLAKRQLTWLRKIPLAHSIDPYTDGDHI 300


>gi|89094655|ref|ZP_01167592.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanospirillum
           sp. MED92]
 gi|89081125|gb|EAR60360.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oceanospirillum
           sp. MED92]
          Length = 301

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 63/212 (29%), Positives = 113/212 (53%), Gaps = 1/212 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  + +    +PI+ GGT LYF AL   L+ +PE    +RE++ ++ +  G   +H  
Sbjct: 74  LKQIAEIHSAGKVPILTGGTMLYFHALKNGLAQLPEADPVVRERLLKEAEADGWEAIHAR 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+++D   A +++P+D QR+ RALEI  ++G+++ E W +              ++  +R
Sbjct: 134 LATVDPESAARLNPNDSQRLQRALEIYEITGRTMTELWAEQEKQKPAFPIISLAVMPEDR 193

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI+RRF  ML+ G  +E+R L +     + +P ++ +G R +     G  +YD  
Sbjct: 194 AELHDRIQRRFDIMLDQGFEEEVRLLWERGDLDMQMPSVRCVGYRQMWEYFAGTWDYDTM 253

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
             +G++AT + AKRQ TWL       W+    
Sbjct: 254 KFKGVVATRQLAKRQVTWLRSWENLTWMDTHD 285


>gi|258515359|ref|YP_003191581.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257779064|gb|ACV62958.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 326

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 113/214 (52%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSL 65
             + +   PI+VGGTGLY R++T   +    EI    R K+ +     G+  +H+ L ++
Sbjct: 101 DIFNRGSSPILVGGTGLYVRSITDHYNFSRAEINWEYRAKLNQSADLRGNEYIHNLLKTV 160

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D + A +IH +D +RI RALE+   +G+ I  +  +      P    H   ++ ERS L 
Sbjct: 161 DPLAAEKIHCNDRKRIIRALEVFDQTGRPISSYHDR-DTFTKPKYKLHIFGLIMERSQLY 219

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +M+E G + E+R L+    S  L  MK++G +++ A L G ++ +E ++   
Sbjct: 220 RRIEIRIDKMMEQGFLKEVRGLLDRGYSSQLTSMKSLGYKELGAYLNGNMSLEEAVEMLK 279

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
             T ++AKRQ TW     +  W+ IS   ++DD+
Sbjct: 280 RNTRRFAKRQLTWFKRDNKITWLDISRQPAMDDI 313


>gi|331091139|ref|ZP_08339981.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405361|gb|EGG84897.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 317

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 58/209 (27%), Positives = 103/209 (49%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +PI+VGGTG Y +AL   +        TA R ++ E  +  G+  LH+ L ++
Sbjct: 88  EIYAKGKIPIVVGGTGFYIQALLYDIDFTENNEDTAYRRELEEISRTKGAEYLHEMLKAV 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A+ IH ++ +R+ RALE    +GQ I E  ++      P +  + ++    R  L 
Sbjct: 148 DEKSAQSIHANNVKRVIRALEFFRQTGQKISEHNEKEREKESPYQFCYFVLNDV-RGHLY 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R  +M++ G + E+ +L +   + ++  M+ +G ++I   L G  + +E +    
Sbjct: 207 KRIELRIDEMIKEGLVSEVEALKEKGYTREMTSMQGLGYKEIFDYLNGVTSLEEAVYILK 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W+     D
Sbjct: 267 RDTRHFAKRQITWFKREKDVIWVNKDEFD 295


>gi|168211842|ref|ZP_02637467.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens B str. ATCC 3626]
 gi|170710208|gb|EDT22390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           perfringens B str. ATCC 3626]
          Length = 310

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 60/218 (27%), Positives = 111/218 (50%), Gaps = 5/218 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSI-MPEIPTAIREKIREKLKQYGSHILHDE 61
            K      +  LPI+ GGTGLY  ++   ++    +   A RE++ +   ++G+  LH+ 
Sbjct: 83  EKIKDIQSRGKLPILAGGTGLYINSIICNMNFAESDKDEAYREELEKIANEHGNEYLHEM 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D      IH ++ +R+ RALE   ++G+    F  +      P    + ++   +R
Sbjct: 143 LKDIDLESYNSIHFNNRKRVIRALETYKLTGKPFSSFKAKNSIYETPYNIYYYVL-NMDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI +R   M E G ++E+++L  M L+ D+  MK IG ++++  L G+I+ D+ +
Sbjct: 202 AKLYDRINKRVDIMFEKGLLEEVKNLKAMGLTDDMQSMKGIGYKEVLYYLDGKISLDQCI 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
           +     +  YAKRQ TW     +A +I      S +D+
Sbjct: 262 EMIKQGSRNYAKRQLTWFRKDPRAIFIDKDTFASEEDI 299


>gi|229005949|ref|ZP_04163642.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides Rock1-4]
 gi|228755302|gb|EEM04654.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides Rock1-4]
          Length = 316

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 108/210 (51%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H++L  +
Sbjct: 91  EITERGKLPIIVGGTGLYIQSVLYDYQFTDEAGDPVYREELEKLATEHGVEYVHEKLREV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI   +GQ + +  ++  N    L     I +  +R  L 
Sbjct: 151 DPESASRIHMNNVRRVIRALEIFHTTGQKMSDQLEKQENEL--LYDVSLISLTMDRGMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M++ G + E+++L +  +      ++AIG +++    +G ++ +E + +  
Sbjct: 209 DRINLRVDLMVKQGLLQEVKALYENGVRDCQS-IQAIGYKELYNYFEGHVSLEEAIMQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|87200274|ref|YP_497531.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|123488962|sp|Q2G626|MIAA_NOVAD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|87135955|gb|ABD26697.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 281

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 77/208 (37%), Positives = 118/208 (56%), Gaps = 4/208 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +++  LPI+VGGTGLY R L   ++ +PEI   +RE++R           + EL   D  
Sbjct: 67  HQRGALPILVGGTGLYIRTLLDGIAPVPEIDPQVREEVRAM----PLEAAYAELEKSDPE 122

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            AR++ P+D QRI RALE+   +G+ +  + +Q         +   +I+LPER  L  R 
Sbjct: 123 RARKLAPADAQRITRALEVMRSTGRPLAYWQQQLSGGIGNDVALAPLILLPERQWLYRRC 182

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF  M + GA++E+ +L+  +L   LP+M+AIGV +I A L+G+++ D  +  G  AT
Sbjct: 183 DLRFELMWDGGALEEVEALLARDLPDSLPVMRAIGVPEIAAFLRGDLSRDAAIASGQQAT 242

Query: 189 NKYAKRQKTWLCHQFQADWIRISSIDDL 216
             YAKRQ TWL HQ   DW R+   + +
Sbjct: 243 RNYAKRQYTWLRHQNPGDWPRMEYDNSI 270


>gi|317131679|ref|YP_004090993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ethanoligenens
           harbinense YUAN-3]
 gi|315469658|gb|ADU26262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ethanoligenens
           harbinense YUAN-3]
          Length = 317

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/205 (26%), Positives = 102/205 (49%), Gaps = 1/205 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
             + +  +P++ GGTGLY  +L    +        A+R ++R + ++ G   L  +L++ 
Sbjct: 88  DIHARGRVPVVAGGTGLYVDSLLLGRAFEETGRDDALRARLRREAEERGGESLLAKLAAF 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A ++HP +  RI RA+E+    G ++ E  +++     P  +    +   +R+AL 
Sbjct: 148 DPETAERLHPHNIGRIIRAIEVYETDGVTMSELQRRSRLAPSPYCTFRVGLYAADRAALY 207

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            +I  R   M+ +G +DE ++L           M+AIG +++   L+GE   ++ ++   
Sbjct: 208 AKIDARVDGMMAAGLLDEAKALFAREDVRGGTAMQAIGYKELAGYLRGECALEDAVEAVK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRI 210
            AT +YAKRQ TW   +    W+ I
Sbjct: 268 RATRRYAKRQMTWFRREKDILWLEI 292


>gi|228992418|ref|ZP_04152348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           pseudomycoides DSM 12442]
 gi|228767316|gb|EEM15949.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           pseudomycoides DSM 12442]
          Length = 316

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/210 (25%), Positives = 107/210 (50%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H++L  +
Sbjct: 91  EITERGKLPIIVGGTGLYIQSVLYDYQFTDEAGDPVYREELEKLATEHGVEYVHEKLREV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI   +GQ + +  ++  N    L     I +  +R  L 
Sbjct: 151 DPESASRIHMNNVRRVIRALEIFHTTGQKMSDQLEKQENEL--LYDVSLIGLTMDRGMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M++ G + E++ L +  +      ++AIG +++    +G ++ +E + +  
Sbjct: 209 DRINLRVDLMVKQGLLQEVKDLYENGVRDCQS-IQAIGYKELYNYFEGHVSLEEAIMQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|190151317|ref|YP_001969842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|189916448|gb|ACE62700.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 228

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 73/209 (34%), Positives = 114/209 (54%), Gaps = 3/209 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +      +P++VGGT LY++AL   LS +P     IR +I  K +Q G   LH EL ++D
Sbjct: 3   EITASGRIPLLVGGTMLYYKALLEGLSPLPSADPEIRAEIEAKAEQIGWSGLHRELLAID 62

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I  ++I+P+D QRI RALE+  ++G+++ E   Q  +   P       I   +R+ L +
Sbjct: 63  PIAGKRINPNDSQRINRALEVFYITGKTMTELTAQQGDSL-PYNVLQFAIAPQDRAVLHQ 121

Query: 127 RIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF +M+E G   E+  L    +L  DLP ++ +G R +   L G+I+ DE + +GI
Sbjct: 122 RIEQRFYKMMELGFQQEVEKLRARSDLHKDLPSIRCVGYRQMWEYLDGDISLDEAIYKGI 181

Query: 186 IATNKYAKRQKTWLCHQ-FQADWIRISSI 213
            AT + AKRQ TWL     +  W+     
Sbjct: 182 CATRQLAKRQITWLRGWNSEITWLDSLDP 210


>gi|68248619|ref|YP_247731.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 86-028NP]
 gi|81336954|sp|Q4QPH6|MIAA_HAEI8 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|68056818|gb|AAX87071.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 86-028NP]
          Length = 311

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|284006625|emb|CBA71886.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Arsenophonus
           nasoniae]
          Length = 298

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 80/213 (37%), Positives = 115/213 (53%), Gaps = 2/213 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT LYF+AL   LS +P     IR +I  + KQ G   +H  
Sbjct: 74  LAEMEKIVASGRIPLLVGGTMLYFKALLDGLSPLPSADVTIRAEIELQAKQSGWGAIHKR 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A +IHP+D QR++RALE+ LVSG+S+ E   +     +P       I   +R
Sbjct: 134 LQEVDPISAARIHPNDPQRLSRALEVFLVSGKSLTEL-TEIVEAELPYNVLQFAISPQDR 192

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF QML +G  DE+ +L          P ++++G R + + L GEINYDE 
Sbjct: 193 KILHQRIEMRFLQMLNAGFEDEVSALYARGDLHQDLPAIRSVGYRQMWSYLSGEINYDEM 252

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + RGI AT + AKRQ TWL        +    I
Sbjct: 253 VYRGICATRQLAKRQITWLKGWKNVHRLDSDDI 285


>gi|145636726|ref|ZP_01792392.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittHH]
 gi|145270024|gb|EDK09961.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittHH]
          Length = 311

 Score =  157 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPMSAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G  +E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQEEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|110835065|ref|YP_693924.1| tRNA isopentenyltransferase [Alcanivorax borkumensis SK2]
 gi|123050327|sp|Q0VME6|MIAA_ALCBS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|110648176|emb|CAL17652.1| tRNA isopentenyltransferase [Alcanivorax borkumensis SK2]
          Length = 329

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 71/232 (30%), Positives = 110/232 (47%), Gaps = 16/232 (6%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L    Q +    LP++VGGT LYF+AL   L+ +PE    +R +I       G   +H  
Sbjct: 86  LKHIEQIHNNGKLPLLVGGTVLYFKALVEGLAPLPEADPVVRAEIAALADAQGWPAVHQA 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI------------PL 109
           L+ +D + A ++ P+D QR+ RALE+  ++G+ +  F  +                  P 
Sbjct: 146 LAEVDPVTAARLKPTDKQRLQRALEVFRLTGRPLAAFHAEHDKTLTKSRDGLSQFSGLPY 205

Query: 110 ESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDII 168
                 +   +R+ L E+I  RF  ML SG  +E+ +L +        P ++A+G R + 
Sbjct: 206 PVLSTALAPQDRAWLHEQIALRFRAMLNSGLQEEVEALRQQPQLNADLPGIRAVGYRQMW 265

Query: 169 ALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS---IDDLF 217
             L G   YD  ++RGIIAT + AKRQ TWL    +  W   +     D LF
Sbjct: 266 EYLDGMYGYDSMVERGIIATRQLAKRQFTWLRKWPELQWFDSNDRSQRDALF 317


>gi|313903994|ref|ZP_07837374.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Eubacterium
           cellulosolvens 6]
 gi|313471143|gb|EFR66465.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Eubacterium
           cellulosolvens 6]
          Length = 320

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 113/216 (52%), Gaps = 3/216 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHIL 58
           M  + ++  + +  +PII GGTG Y +A+   +        +  RE+  +  ++ G+  L
Sbjct: 83  MAKEAMEKIWSQGKVPIITGGTGFYIQAVLRDIVFSKNDGKSEEREQYEKLAEEKGAEYL 142

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+ L++ D   A QIH ++ +R+ RALE    +G+ I E  ++      P    + ++  
Sbjct: 143 HNLLAARDPAAAEQIHANNIKRVIRALEYFDQTGEKISEHNEEQREKESPYTYLYFVLND 202

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            ERS L ERI RR  +M+  G +DE+RSLM+  L+ D   MK +G +++   L+GE + +
Sbjct: 203 -ERSRLYERIDRRVDEMIGEGLVDEVRSLMERGLTEDHVSMKGLGYKELFPYLRGECSLE 261

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T  +AKRQ TW   + +  WI     D
Sbjct: 262 EAVEIIKRDTRHFAKRQITWFKREGEIIWINKDDFD 297


>gi|21263785|sp|Q9CMC7|MIAA_PASMU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 316

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 77/215 (35%), Positives = 121/215 (56%), Gaps = 3/215 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R +I EK +  G   LH E
Sbjct: 85  LREMADIIAAGKIPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEEKAQLQGWAALHQE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A++I+P+D QRI RALE+  ++G+S+ E   Q     +P +     I   +R
Sbjct: 145 LAKIDPLAAQRINPNDSQRINRALEVFYLTGKSLSEL-SQQKGDSLPYQILQFAIAPKDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L +RI  RF +M+E G   E+     + +L LDLP M+ +G R +   L+G+ ++DE 
Sbjct: 204 SILHDRIALRFQKMIEQGFQQEVEKLYQREDLHLDLPAMRCVGYRQMWEYLRGDYDHDEM 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIRISSID 214
           + RGI AT + AKRQ TWL       +W+   +I+
Sbjct: 264 IFRGICATRQLAKRQITWLRGWKYPIEWLDSLAIE 298


>gi|254447172|ref|ZP_05060639.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HTCC5015]
 gi|198263311|gb|EDY87589.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium HTCC5015]
          Length = 337

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 106/203 (52%), Gaps = 2/203 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
             + +  +PI+ GGT LYFRAL   ++ MPE   A R  +  +L Q G+  LH EL  +D
Sbjct: 113 DVHARGRVPILAGGTMLYFRALLDGMAEMPESDPAARAGLEAELAQRGAQALHQELQQVD 172

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
           S  A +IH +D QR+ RALE+   SG  + E+  +A             +I  +R   + 
Sbjct: 173 SHAAERIHLNDPQRLLRALEVYRSSGVPLSEWHVRAQQSAYAGPVLKLGLIPEDRPRHRA 232

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            +  RF  M+E+G  DE+++L +      D+P ++ +G R +     G+ ++D  +++ I
Sbjct: 233 LVASRFMAMIEAGFADEVQALYRRGDLRLDMPSVRCVGYRQLWQYFNGDWDWDLAVEKAI 292

Query: 186 IATNKYAKRQKTWLCHQFQAD-W 207
            AT + AKRQ TWL  +     W
Sbjct: 293 TATRQLAKRQMTWLRKESDLTAW 315


>gi|145630633|ref|ZP_01786412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
 gi|144983759|gb|EDJ91209.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
          Length = 311

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LCEMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|148825651|ref|YP_001290404.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittEE]
 gi|229846988|ref|ZP_04467094.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 7P49H1]
 gi|166198912|sp|A5UB70|MIAA_HAEIE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148715811|gb|ABQ98021.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittEE]
 gi|229810072|gb|EEP45792.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 7P49H1]
 gi|309972798|gb|ADO95999.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPTase)
           [Haemophilus influenzae R2846]
          Length = 311

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPMSAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G  +E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|257439840|ref|ZP_05615595.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Faecalibacterium prausnitzii A2-165]
 gi|257197749|gb|EEU96033.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Faecalibacterium prausnitzii A2-165]
          Length = 306

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LPI+VGGTGLY ++    +     + P  +RE++  +L + G   ++ EL ++
Sbjct: 83  EISGRGHLPILVGGTGLYVQSFLYGVRFAAEKTPDGLREQLAAELNEKGPEAMYAELQAV 142

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IHP++  R+ RALE    +G+ + E    +  P  P  S    +  PER+ L 
Sbjct: 143 DPEAAAAIHPNNHVRVLRALEHYRATGKKLSEQKADSLPPEKPYRSLILGLDFPERAQLY 202

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R   M+E   ++E + + +   +      +AIG ++      GE      +++  
Sbjct: 203 RRIDLRVDLMMEQDLLNEAKRVWEHRDTYKTA-AQAIGYKEFFPYFAGESALAPCVEKLK 261

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
            A+  YAKRQ TW  H     W+  S+ D
Sbjct: 262 QASRNYAKRQLTWFRHMEGIHWLDASAPD 290


>gi|68536188|ref|YP_250893.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Corynebacterium
           jeikeium K411]
 gi|260578885|ref|ZP_05846790.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Corynebacterium
           jeikeium ATCC 43734]
 gi|123650930|sp|Q4JV82|MIAA_CORJK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|68263787|emb|CAI37275.1| miaA [Corynebacterium jeikeium K411]
 gi|258602975|gb|EEW16247.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Corynebacterium
           jeikeium ATCC 43734]
          Length = 310

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 61/208 (29%), Positives = 104/208 (50%), Gaps = 3/208 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +PIIVGG+ +Y +AL  +    P     +REK + +L   G   +H  L+++D
Sbjct: 91  EILSRGKMPIIVGGSMMYIQALVDEWDF-PPTDPIVREKWQRELDVRGVAAMHQYLATID 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              AR I  +D +R  RALE+  ++G+       Q P    P  +   + +      L  
Sbjct: 150 PEAARIIEDNDPRRTVRALEVIELTGKPFAA--SQPPKNSTPRWNMRLLGLSAPAEWLNP 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R  QM + G ++E+RSL+   L+      +AIG   ++    GE+ ++E + R I 
Sbjct: 208 RIEQRVRQMFDQGLVEEVRSLVADGLARTSTAGQAIGYAQVLDYFAGELTFEEAVDRTIT 267

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
            T +YA+RQ++W     +  WI  +S D
Sbjct: 268 GTRRYARRQRSWFRRDKRIIWIDANSPD 295


>gi|229012887|ref|ZP_04170053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides DSM 2048]
 gi|228748374|gb|EEL98233.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           mycoides DSM 2048]
          Length = 317

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H
Sbjct: 85  VRKCIREITERGKLPIIVGGTGLYIQSVLFDYQFTDEAGDATYREQMEKLALEHGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ +    ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSNQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E++ L +  +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVNLMIEQGLLEEVKGLHERGVRDCQS-IQAIGYKEIYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|20807806|ref|NP_622977.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|254479228|ref|ZP_05092573.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Carboxydibrachium pacificum DSM 12653]
 gi|25008756|sp|Q8R5S5|MIAA_THETN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|20516364|gb|AAM24581.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|214034829|gb|EEB75558.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Carboxydibrachium pacificum DSM 12653]
          Length = 315

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/220 (29%), Positives = 117/220 (53%), Gaps = 9/220 (4%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             +++  LPIIVGGTGLY  ++   +     E     REK+++  + YG+  L+++L  +
Sbjct: 87  DIHERGKLPIIVGGTGLYINSIVYIMHFSDFEGSKEFREKMKKLAETYGTSYLYEKLKEV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILPERSAL 124
           D   AR+IHP+D +RI RALE+   +G+ I  + K +     P  +     +    R  L
Sbjct: 147 DPEAARKIHPNDLRRIIRALEVYEFTGKPISHYQKMSGMRKNPEYDPIMIGLNYKNRQLL 206

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            E+I RR  +M+++  ++E+ +L+K+  +     M+A+G ++I+  L GEI+ +E +++ 
Sbjct: 207 YEKINRRVDEMIKNNLVEEVVNLLKIGYNKYGTSMQALGYKEIVEYLNGEISLEEAVEKI 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
              T +YAKRQ TW        W  +          +++F
Sbjct: 267 KKGTRRYAKRQITWFKAYDFIKWFFVDDYKTYEELRENIF 306


>gi|260462171|ref|ZP_05810415.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259032031|gb|EEW33298.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 321

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 98/215 (45%), Positives = 138/215 (64%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           ++K +        PI VGGTGLYFRAL   +S MP+IP  +R++ R +LK+ GS  LH  
Sbjct: 95  VTKLIDDGALSRRPIFVGGTGLYFRALAEGISEMPDIPQQVRDRWRYELKEQGSVKLHGI 154

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L   DS  A Q+ P+D QRI RALE+   SG+SI+E+  +   P I  ++AH  +I P+R
Sbjct: 155 LLREDSRTAMQLKPTDSQRIVRALEVLDASGRSILEWQAERGRPLIDRQTAHFRVIEPDR 214

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           + L +RI RRF QML+ GA++E+R L  ++L  DLP MKAIGVR++   + G+ ++ E +
Sbjct: 215 AVLVDRIERRFDQMLDKGALEEVRQLAALHLDPDLPAMKAIGVRELQGAMAGQSSFPEAI 274

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +R  IAT +YAKRQ TW  HQ   +W R+   DDL
Sbjct: 275 ERAKIATRQYAKRQATWFRHQLGPEWQRLRPGDDL 309


>gi|304404426|ref|ZP_07386087.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           curdlanolyticus YK9]
 gi|304346233|gb|EFM12066.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           curdlanolyticus YK9]
          Length = 349

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/209 (27%), Positives = 99/209 (47%), Gaps = 3/209 (1%)

Query: 5   KLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELS 63
            L+   +  LP IVGGTGLY  ++             A R ++ +    YG+  LH +L 
Sbjct: 107 ILEITARGKLPFIVGGTGLYVESVCYGFEFAESGSDPAYRAELEQFADDYGAEALHAKLD 166

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
            +D + A ++HP+D +RI RA+EI  ++G+ + E   +             I +  +R  
Sbjct: 167 EVDPVSAERLHPNDRRRIIRAMEIFRLTGEKMSEQLGRQTKTS--PYDLCIIGLHMDRQK 224

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           L ERI  R   M+E G   E   +++  ++ D   M+ +G ++ +  L GE +  E+++ 
Sbjct: 225 LYERINARIDLMMEQGLEAEATRIIETGIAHDAVSMQGLGYKEFLPYLAGECSLSESVEL 284

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISS 212
               T ++AKRQ +W  H     W+    
Sbjct: 285 LKRDTRRFAKRQLSWFRHMKDIVWVESDE 313


>gi|221309612|ref|ZP_03591459.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221313935|ref|ZP_03595740.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. subtilis str. NCIB 3610]
 gi|221318858|ref|ZP_03600152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. subtilis str. JH642]
 gi|221323130|ref|ZP_03604424.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. subtilis str. SMY]
 gi|255767406|ref|NP_389615.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|239938661|sp|O31795|MIAA_BACSU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|225185033|emb|CAB13617.2| tRNA isopentenylpyrophosphate transferase [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 314

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/212 (28%), Positives = 112/212 (52%), Gaps = 4/212 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
           +K  +   +  LP+IVGGTGLY +++    +   E      RE ++   ++ G+  LH +
Sbjct: 86  NKISEIANRGKLPMIVGGTGLYIQSVLYDYTFTEEANDPVFRESMQMAAEREGADFLHAK 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ D   A  IHP++ +R+ RALEI   SG+++ +  K+       L +A  I +  +R
Sbjct: 146 LAAADPEAAAAIHPNNTRRVIRALEILHTSGKTMSQHLKEQKREL--LYNAVLIGLTMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M++SG + E++ L   N+      ++AIG +++ A   G +   + +
Sbjct: 204 DTLYERINQRVDLMMQSGLLPEVKRLYDKNVRDCQS-IQAIGYKELYAYFDGFVTLSDAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           ++    + +YAKRQ TW  ++ Q  W  ++  
Sbjct: 263 EQLKQNSRRYAKRQLTWFRNKMQVTWFDMTPP 294


>gi|145629067|ref|ZP_01784866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.1-21]
 gi|145639643|ref|ZP_01795246.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittII]
 gi|144978570|gb|EDJ88293.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.1-21]
 gi|145271200|gb|EDK11114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittII]
 gi|309750613|gb|ADO80597.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPTase)
           [Haemophilus influenzae R2866]
          Length = 311

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 110/210 (52%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR  + +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRADLEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISATRINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+  Y+E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|225567944|ref|ZP_03776969.1| hypothetical protein CLOHYLEM_04017 [Clostridium hylemonae DSM
           15053]
 gi|225163232|gb|EEG75851.1| hypothetical protein CLOHYLEM_04017 [Clostridium hylemonae DSM
           15053]
          Length = 323

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/203 (31%), Positives = 108/203 (53%), Gaps = 2/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLD 66
            Y+K  +PI+VGGTG Y +AL   +     E  T IR ++    ++YG+  LH+ L+ +D
Sbjct: 88  IYEKGRIPIVVGGTGFYIQALLYDIDFTETEAGTDIRNRLAGYAQRYGADKLHERLAEVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IHP++ +R+ RALE    +G+ I E  ++      P  + + ++   +R  L +
Sbjct: 148 EASAAKIHPNNVKRVIRALEYYEQTGKRISEHNERERMKESPYSAVYFVLTD-DRETLYD 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR  +M+E G + E+R L +M  + +L  M+ +G ++I+  L G    +E +     
Sbjct: 207 RINRRVDKMMEDGLVGEVRRLRQMGYTKELVSMQGLGYKEILDYLDGSCTLEEAVYTIKR 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
            T  +AKRQ TW   +    WI 
Sbjct: 267 DTRHFAKRQITWFKRERDVIWID 289


>gi|291519452|emb|CBK74673.1| tRNA isopentenyltransferase (miaA) [Butyrivibrio fibrisolvens 16/4]
          Length = 312

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/214 (26%), Positives = 107/214 (50%), Gaps = 2/214 (0%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +L+   + Y K  +PII GGTG Y +A+   +     +I    R+ + +   + G+  L 
Sbjct: 80  VLAAMEEIYNKGKIPIICGGTGFYIQAILYDIQFAEQDIDYGYRDSLEKFADENGNEALL 139

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           ++L  +DS  A  I  ++ +R+ RALE    +G+      K+  +   P   A+ ++   
Sbjct: 140 EKLRQVDSESAESIPANNRKRVIRALEYYKQTGEKFSVHNKRERDRISPYNFAYFVLND- 198

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L  RI  R  +M E+G ++E++SL+       +  M  IG ++II+ L G ++ ++
Sbjct: 199 DRELLYNRIDLRVDKMAEAGLVEEVKSLLNEGCKPGMTSMDGIGYKEIISSLNGNMSIED 258

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
            L+     +  YAKRQ TW   + +  W+  + +
Sbjct: 259 ALELIKKNSRNYAKRQLTWFRREKEVVWLDKTEL 292


>gi|291484281|dbj|BAI85356.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. natto BEST195]
          Length = 314

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 112/212 (52%), Gaps = 4/212 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
           +K  +   +  LP+IVGGTGLY +++    +   E      RE ++   ++ G+  LH +
Sbjct: 86  NKISEIANRGKLPMIVGGTGLYIQSVLYDYTFTEEANDPVFRESMQVAAEREGADFLHAK 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ D   A  IHP++ +R+ RALEI   SG+++ +  K+       L +A  I +  +R
Sbjct: 146 LAAADPEAAAAIHPNNTRRVIRALEILHTSGKTMSQHLKEQKREL--LYNAVLIGLTMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M+ESG + E++ L   N+      ++AIG +++ A   G +   + +
Sbjct: 204 DTLYERINQRVDLMMESGLLPEVKRLYDKNVRDCQS-IQAIGYKELYAYFDGFVTLSDAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           ++    + +YAKRQ TW  ++ Q  W  ++  
Sbjct: 263 EQLKQNSRRYAKRQLTWFRNKMQVTWFDMTPP 294


>gi|153814908|ref|ZP_01967576.1| hypothetical protein RUMTOR_01123 [Ruminococcus torques ATCC 27756]
 gi|145847939|gb|EDK24857.1| hypothetical protein RUMTOR_01123 [Ruminococcus torques ATCC 27756]
          Length = 315

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHD 60
           L +  Q Y+K  +P+IVGGTG Y +++   +     + P   R+K+    K+ G+  LH 
Sbjct: 82  LEEMEQIYEKGKIPLIVGGTGFYIQSVLYNIDFTENDSPNDYRKKLEILAKEKGAEYLHT 141

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
            L+ +D   A QIH ++ +R  RALE    +G  I E  +       P + A+ ++   +
Sbjct: 142 MLTEVDPKSALQIHTNNIKRTIRALEFYHQTGMKISEHNEAEREKESPYQYAYFVLTD-D 200

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R+ L ERI RR   M+ESG  +E+R L    +S     M+ +G +++ A + GE + +E 
Sbjct: 201 RAKLYERIDRRVDLMMESGLEEEVRFLKDRGVSSTSTAMQGLGYKELYAYMNGEYSLEEA 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           ++     T  +AKRQ TW   +    WI 
Sbjct: 261 VRIIKRDTRHFAKRQLTWFKREKDVTWID 289


>gi|307267459|ref|ZP_07548946.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917516|gb|EFN47803.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 315

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/217 (31%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++    YK+  LPIIVGGTGLY  ++   +     E     REK++E    YGS  L+
Sbjct: 81  AKEIIKDIYKRGKLPIIVGGTGLYINSIIYIMHFSDFEGSKEFREKMKELANTYGSQYLY 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-PLESAHKIIIL 118
           + L S+D   A++IH +D +RI RALE+   +G+ I  + K +        +     +  
Sbjct: 141 ERLKSVDPEAAKKIHSNDIRRIIRALEVYEFTGKPISYYQKMSGMRLNLEYQPIMIGLNF 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R  +M+++  ++E+ +L+K+  + D   M+A+G ++I+  LKGEI+ +
Sbjct: 201 RDRQILYDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTAMQALGYKEIVEYLKGEISLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +++    T +YAKRQ TW        W  +    +
Sbjct: 261 EAVEKIKKGTRRYAKRQITWFKGYNFIKWFFVDDYKN 297


>gi|301168661|emb|CBW28252.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Haemophilus influenzae 10810]
          Length = 311

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 111/210 (52%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+  Y+E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|321315502|ref|YP_004207789.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis BSn5]
 gi|320021776|gb|ADV96762.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis BSn5]
          Length = 314

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/212 (28%), Positives = 112/212 (52%), Gaps = 4/212 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
           +K  +   +  LP+IVGGTGLY +++    +   E      RE ++   ++ G+  LH +
Sbjct: 86  NKISEIANRGKLPMIVGGTGLYIQSVLYDYTFTEEANDPVFRESMQMAAEREGADFLHAK 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ D   A  IHP++ +R+ RALEI   SG+++ +  K+       L +A  I +  +R
Sbjct: 146 LAAADPEAAAAIHPNNTRRVIRALEILHTSGKTMSQHLKEQKREL--LYNAVLIGLTMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M++SG + E++ L   N+      ++AIG +++ A   G +   + +
Sbjct: 204 DTLYERINQRVDLMMQSGLLPEVKRLYDKNVRDCQS-IQAIGYKELYAYFDGFVTLSDAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           ++    + +YAKRQ TW  ++ Q  W  ++  
Sbjct: 263 EQLKQNSRRYAKRQLTWFRNKMQVTWFDMTPP 294


>gi|152984449|ref|YP_001350993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PA7]
 gi|166215166|sp|A6VD58|MIAA_PSEA7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150959607|gb|ABR81632.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pseudomonas
           aeruginosa PA7]
          Length = 323

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 76/217 (35%), Positives = 115/217 (52%), Gaps = 11/217 (5%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +P++VGGT LY++AL   L+ MP     +R  +  + +  G   LH +L+ +D   A
Sbjct: 93  RGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAALEAEARAEGWEALHRQLAEVDPESA 152

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAP----------NPFIPLESAHKIIILPE 120
            +IHP+D QR+ RALE+  V G S+ E  ++               +P   A   I   +
Sbjct: 153 ARIHPNDPQRLMRALEVYRVGGVSMSELRRRQSAEKADFDASGRNQLPYTVAQLAIAPEQ 212

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           R  L  RI +RF QMLE G I E+ +L    +L   LP ++A+G R +   L G+++Y E
Sbjct: 213 RQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYLDGKLSYAE 272

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
             +RGIIAT + AKRQ TWL       W+   + D+L
Sbjct: 273 MTERGIIATRQLAKRQFTWLRSWSHLHWMDSLAGDNL 309


>gi|291543953|emb|CBL17062.1| tRNA isopentenyltransferase (miaA) [Ruminococcus sp. 18P13]
          Length = 315

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/211 (27%), Positives = 102/211 (48%), Gaps = 5/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTG--QLSIMPEIPTAIREKIREKLKQYGSHILHDELSS 64
             Y +  LP++VGGTGLY  +L    Q + +P    A+R  ++ +  Q G+  L+ +L  
Sbjct: 90  DIYSRGKLPVVVGGTGLYVTSLLEHVQFAQIPR-DDAVRAALQAQAAQEGTAGLYAQLCQ 148

Query: 65  LDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSAL 124
           +D   A  IHP++  R+ RA+E+  ++G+ +  F  ++     P  +    +  P+R  L
Sbjct: 149 VDPDSAACIHPNNVPRLVRAMEVYRLTGKPLSAFKAESRLEPSPYRTLWLGLCYPDRQQL 208

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            +RI RR  QM++ G + E  +                  +++I  L+G+   ++ + R 
Sbjct: 209 YDRIDRRVDQMVQQGLVQEAAAAYAAGGMGTAAAAIGY--KELIPYLEGQGTLEDCIARI 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
              T +YAKRQ TW     Q  WI  +  D+
Sbjct: 267 KQETRRYAKRQMTWFRKNEQIQWISRTEFDE 297


>gi|145642150|ref|ZP_01797719.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae R3021]
 gi|145273141|gb|EDK13018.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 22.4-21]
          Length = 311

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 113/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMAEITTQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HILHERIEQRFHKMIELGFQAEVEKLYARGDLNIHLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|258405794|ref|YP_003198536.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfohalobium
           retbaense DSM 5692]
 gi|257798021|gb|ACV68958.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfohalobium
           retbaense DSM 5692]
          Length = 314

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/213 (30%), Positives = 114/213 (53%), Gaps = 3/213 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           M  + + +      LP++VGGTGLY RAL   L+  P IP +IR+K+   ++  G    H
Sbjct: 87  MAREVIAEVLDNGRLPVLVGGTGLYLRALVHGLAPTPPIPESIRKKVASVVRHRGRQWAH 146

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             LS LD   A ++HP+D QR+ R LE++L +G  + ++ +Q      P  +A  + +  
Sbjct: 147 RVLSRLDPEWAAKVHPNDRQRVTRGLEVRLATGTPLSQWHRQQ--TRTPRYNALTLGLDT 204

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           + +AL  R+  R  +ML++GA DE           D P    IG  +++A+++G+++ +E
Sbjct: 205 DLAALTPRLESRIRRMLDAGAEDEAHRAWARCPDPDAPGWTGIGCAELLAMIRGQLSREE 264

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
             +  +  T  YAKRQ TW   + +  W++  +
Sbjct: 265 ACRLWLQNTRAYAKRQMTWFRKESEVFWVQPDA 297


>gi|322806035|emb|CBZ03602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum H04402 065]
          Length = 310

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 106/216 (49%), Gaps = 3/216 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKNIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  I+
Sbjct: 139 HSLLKDIDEESYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFIL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           DE +      +  YAKRQ TW     ++ WI   + 
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKDNY 294


>gi|145633370|ref|ZP_01789100.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 3655]
 gi|145635253|ref|ZP_01790957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittAA]
 gi|144985933|gb|EDJ92535.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 3655]
 gi|145267532|gb|EDK07532.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae PittAA]
          Length = 311

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPMSAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G  +E+  L          P ++ +G R +   L+G+  Y+E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYAYEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|317500420|ref|ZP_07958644.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|331089573|ref|ZP_08338472.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|316898175|gb|EFV20222.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|330404941|gb|EGG84479.1| tRNA dimethylallyltransferase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 315

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/209 (30%), Positives = 107/209 (51%), Gaps = 2/209 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHD 60
           L +  Q Y+K  +P+IVGGTG Y +++   +     + P   R+K+    K+ G+  LH 
Sbjct: 82  LEEMEQIYEKGKIPLIVGGTGFYIQSVLYNIDFTENDSPNDYRKKLEILAKEKGAEYLHT 141

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
            L+ +D   A QIH ++ +R  RALE    +G  I E  +       P + A+ ++   +
Sbjct: 142 MLTEVDPKSALQIHTNNIKRTIRALEFYHQTGMKISEHNEAEREKESPYQYAYFVLTD-D 200

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R+ L ERI RR   M++SG  +E+R L    +S     M+ +G +++ A + GE + +E 
Sbjct: 201 RAKLYERIDRRVDLMMKSGLEEEVRFLKDRGVSSTSTAMQGLGYKELYAYMNGEYSLEEA 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           ++     T  +AKRQ TW   +    WI 
Sbjct: 261 VRIIKRDTRHFAKRQLTWFKREKDVTWID 289


>gi|194014581|ref|ZP_03053198.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           pumilus ATCC 7061]
 gi|194013607|gb|EDW23172.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           pumilus ATCC 7061]
          Length = 318

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 119/222 (53%), Gaps = 11/222 (4%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDEL 62
           K  +   +   P+IVGGTGLY +++    +   E    A RE++    +Q+GS  LH++L
Sbjct: 87  KIKEIAARGKTPMIVGGTGLYIQSVLYDYTFTDEKSDPAFREEMALFEQQHGSLQLHEKL 146

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
            ++D   A+ IHP++ +R+ RALE+   +GQ + E   Q  +  +PL     I +  +R 
Sbjct: 147 KAVDPDAAKVIHPNNVRRVIRALEVIHTTGQKMSE--MQNGHQEVPLYDTAFIGLKMDRE 204

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L ERI +R   M++ G I+E+ +L +  L     + +AIG +++ A  +G+ + DE +Q
Sbjct: 205 LLYERIHQRIDMMIDEGLIEEVSALYQSGLKDCQSV-QAIGYKELYAYFQGDCSLDEAIQ 263

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
           +    + +YAKRQ TW  ++    W  ++         +++F
Sbjct: 264 QLKQNSRRYAKRQFTWFRNKMDVTWFDMTPPCHFSDKKEEIF 305


>gi|168186345|ref|ZP_02620980.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum C str. Eklund]
 gi|169295785|gb|EDS77918.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum C str. Eklund]
          Length = 315

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/212 (30%), Positives = 113/212 (53%), Gaps = 3/212 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
               +  LP++VGGTG Y  +L               RE ++E   ++G   +H+ L ++
Sbjct: 87  NITSRGKLPMVVGGTGFYIDSLIFNYDFANTYKDEEYREYLKELAYEHGKEYVHELLKNI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D    ++++P+D +R+ RALE+  ++G++I EF K+     IP    + ++   +RS L 
Sbjct: 147 DEKSYKKLYPNDLKRVIRALEVFKLTGKTISEFNKEQDIFDIPYNVYYFVL-NMDRSKLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI +R   M+E G I+E++SL  M  + D+  MK IG ++I+  L G ++ DE ++   
Sbjct: 206 ERINKRVDIMMEKGLIEEVKSLQNMGCTPDMQSMKGIGYKEILYYLDGNLSLDEAIELIK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS-SIDDL 216
             +  YAKRQ TW     +  WI    + +D+
Sbjct: 266 KGSRHYAKRQLTWFRKDKRVIWIDKDQNKNDI 297


>gi|89100692|ref|ZP_01173548.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           NRRL B-14911]
 gi|89084567|gb|EAR63712.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus sp.
           NRRL B-14911]
          Length = 319

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/213 (24%), Positives = 112/213 (52%), Gaps = 5/213 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           ++ K++     +  +P+IVGGTGLY +++             A R ++ ++L+  G+  L
Sbjct: 91  LVRKEIACIASRGKMPMIVGGTGLYIQSVIYDYQFSEAPSDDAFRGELEKRLEAEGAESL 150

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
             EL  +D   A ++HP++ +R+ RALE+   +G+++ ++ +Q       L     I + 
Sbjct: 151 FKELCEIDPASAEKMHPNNTRRVIRALEVYHCTGKTMSQYQEQQVPEL--LYDTSIIGLS 208

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI  R  +M++ G ++E+ +L +  L      ++AIG +++   + G I+ +
Sbjct: 209 MDRKKLYDRINSRVDKMMDDGLLEEVEALHRQGLKDCQS-IQAIGYKEVYEYINGRISLE 267

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             ++     + +YAKRQ TW  ++   +W  ++
Sbjct: 268 GAVENLKQNSRRYAKRQLTWFRNKMNVEWFDMT 300


>gi|268316883|ref|YP_003290602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodothermus
           marinus DSM 4252]
 gi|262334417|gb|ACY48214.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhodothermus
           marinus DSM 4252]
          Length = 307

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/205 (29%), Positives = 113/205 (55%), Gaps = 4/205 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGG+ LY  AL   L+ +P++  A+R ++ E+L+  G   L+ EL  +D
Sbjct: 107 EILSRGHVPLVVGGSTLYLYALQFGLAEIPDVDPAVRRRLNERLRTEGPEALYAELQRVD 166

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+  QR+ RALE+   +G+ I  + +          +   I++  +R  L E
Sbjct: 167 PEAAARLDPTKTQRVIRALEVYHGTGRPITYYHRHHRPS---PYTFRTIVLYRDRPVLYE 223

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR  QMLE+G ++E+R +++   S +L +++ IG  ++I  L+G  + +   +    
Sbjct: 224 RINRRVDQMLEAGLVEEVRGILEAGYSPELDVLRTIGYEEVIGYLQGAYDRETMRRLIQR 283

Query: 187 ATNKYAKRQKTWLCHQFQADWIRIS 211
            T +YAKRQ TW    F  +W+++ 
Sbjct: 284 NTRRYAKRQLTWFRR-FDFEWVKLD 307


>gi|170756578|ref|YP_001781346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum B1 str. Okra]
 gi|229621757|sp|B1IM66|MIAA_CLOBK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169121790|gb|ACA45626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum B1 str. Okra]
          Length = 311

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 106/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G+  +
Sbjct: 79  LAEKSIKDIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGNEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  I+
Sbjct: 139 HSLLKDIDEESYEKLYPNDLKRVVRALEVYKITGKSISEYIKENEKKLYDIPYNVNYFIL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|161830090|ref|YP_001596644.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 331]
 gi|189081951|sp|A9NCK4|MIAA_COXBR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|161761957|gb|ABX77599.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 331]
          Length = 311

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/212 (32%), Positives = 110/212 (51%), Gaps = 3/212 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K ++   +   P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+
Sbjct: 88  KTIEI--RNRTPLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLN 145

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           ++D   A +I+P+D QRI RA EI   +GQ +  +        +P +  + I+    RS 
Sbjct: 146 AIDPKSAARINPNDAQRIQRAFEIYETTGQPLSSYQSLKRFKALPYQFINLILAPENRSW 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF QML++  ++E+R L          P ++ +G R +   L GE +Y+    
Sbjct: 206 LHQRIEKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYEMMRH 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + I AT + AKRQ TWL     A W      D
Sbjct: 266 KAIAATRQLAKRQLTWLRRWPDAKWFNSEDKD 297


>gi|210612719|ref|ZP_03289434.1| hypothetical protein CLONEX_01636 [Clostridium nexile DSM 1787]
 gi|210151412|gb|EEA82420.1| hypothetical protein CLONEX_01636 [Clostridium nexile DSM 1787]
          Length = 318

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 108/216 (50%), Gaps = 3/216 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  + ++  Y    +PI+VGGTG Y +AL   +        ++ RE++    K+ G+  L
Sbjct: 80  MAKQAMEKIYANGHIPIVVGGTGFYIQALLYDIDFTESNEDSSYREELERLAKEKGAQYL 139

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H+EL  +D   A  IH ++ +R+ RALE    +GQ I E  +       P +  + ++  
Sbjct: 140 HEELRKVDEKSAETIHANNVKRVIRALEFFKQTGQKISEHNETERTKESPYDFCYFVLTD 199

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI  R  QM++ G + E++SL +   + D+  M+ +G ++I+  L G+   +
Sbjct: 200 -DRKLLYDRINLRVDQMVQDGLLQEVQSLKERGYTKDMVSMQGLGYKEILDYLDGDCTLE 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E +      T  +AKRQ TW   +    WI  S  D
Sbjct: 259 EAIYILKRDTRHFAKRQLTWFRRERDVIWIDKSQYD 294


>gi|302874908|ref|YP_003843541.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           cellulovorans 743B]
 gi|307690472|ref|ZP_07632918.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           cellulovorans 743B]
 gi|302577765|gb|ADL51777.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           cellulovorans 743B]
          Length = 311

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/211 (28%), Positives = 107/211 (50%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSL 65
               +  +PI+VGGTGLY  +L         +     RE ++   + +G   +H  L  +
Sbjct: 86  DIISRGKMPIVVGGTGLYINSLIYNYDFACTDKDLQYREHLQSLAELHGKEYVHSMLKEV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEF-WKQAPNPFIPLESAHKIIILPERSAL 124
           DS    +++P+D +R+ RALE+  V+G+++ E+  +     +    + H  +I   R  L
Sbjct: 146 DSASYERLYPNDLKRVIRALEVFKVTGKTLNEYNQENQAVLYDIPYNVHYFVINMNREEL 205

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
             RI +R   ML+ G +DE+  L +   + ++  MK IG ++I+  L G+++YDE +   
Sbjct: 206 YRRIDQRVDIMLDYGLVDEVIKLKEKGYTSNMQSMKGIGYKEILDYLDGKMSYDEAVYLI 265

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
              +  YAKRQ TW   + +A W+     +D
Sbjct: 266 KKGSRNYAKRQLTWFRKEERAFWLSKEDFED 296


>gi|295399922|ref|ZP_06809903.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978325|gb|EFG53922.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 315

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 60/219 (27%), Positives = 111/219 (50%), Gaps = 11/219 (5%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++             A R ++R+  +  G   L+D L ++
Sbjct: 87  EISERGRLPIIVGGTGLYIQSVIYDYRFSAAPSDEAYRRQLRQIAEDKGEMALYDMLKAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP + +R+ RALEI   +G+++ E+          L  A  I +  +R  L 
Sbjct: 147 DPESAARIHPHNIRRVIRALEIYYCTGKTMTEWQ--QGQTKKLLYDAAIIGLTMKREQLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +ML  G ++E ++L    +     + +AIG +++ A  +G ++ +E +++  
Sbjct: 205 RRINERVDEMLAEGLLEEAKALYDRGIRNCQSV-QAIGYKELFAYFEGRVSLEEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
             + +YAKRQ TW  +Q    W  ++ +       +++F
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVQWFDMTDMAKFDEKAEEIF 302


>gi|289578353|ref|YP_003476980.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter italicus Ab9]
 gi|289528066|gb|ADD02418.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter italicus Ab9]
          Length = 315

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++    +K+  LPIIVGGTGLY  ++   +     +     REK++E    YG+  L+
Sbjct: 81  AKEIIKDIHKRGKLPIIVGGTGLYINSIIYIMHFSDFKGSKKFREKMKELANTYGNQYLY 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIIL 118
           + L S+D   A++IHP+D +R  RALE+   +G+ I  + K +     P  +     +  
Sbjct: 141 ERLKSVDPEAAKKIHPNDIRRTIRALEVYEFTGKPISYYQKMSGMRLNPEYQPIMIGLNF 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L +RI +R  +M+++  ++E+ +L+K+  + D   ++A+G ++I+  LKGEI+ +
Sbjct: 201 RNRQILYDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTALQALGYKEIVEYLKGEISLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +++    T +YAKRQ TW        W  +    +
Sbjct: 261 EAVEKIKKGTRRYAKRQITWFKGYEFIKWFFVDDYKN 297


>gi|163941396|ref|YP_001646280.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           weihenstephanensis KBAB4]
 gi|229621753|sp|A9VR03|MIAA_BACWK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|163863593|gb|ABY44652.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           weihenstephanensis KBAB4]
          Length = 317

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H
Sbjct: 85  VRKCIREITERGKLPIIVGGTGLYIQSVLFDYQFTDEAGDATYREQMEKLALEHGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ +    ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSNQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E++ L +  +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVNLMIEQGLLEEVKGLHERGVRDCQS-IQAIGYKEIYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVGWFDVTDGEK 297


>gi|255595624|ref|XP_002536358.1| conserved hypothetical protein [Ricinus communis]
 gi|223519989|gb|EEF26025.1| conserved hypothetical protein [Ricinus communis]
          Length = 461

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/206 (32%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF AL   LS +PE    +R ++  + ++ G   +H+EL  +D
Sbjct: 3   EATARGNIPLLVGGTMLYFNALQHGLSNLPEADPTVRAQLIARAEEVGWPAMHEELQRVD 62

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+ LVSG+ + E  ++      P       ++  +R+ L +
Sbjct: 63  PETAARLQPNDAQRIERALEVFLVSGRPMSELLRENKASEFPYRLLKIALLPSDRAVLHQ 122

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  MLE G I+E+++L +    +  +P M+ +G R     L+GEI+     ++GI
Sbjct: 123 RIAQRFDLMLEQGMIEEVQTLRERYALNPSMPSMRCVGYRQTWDYLEGEIDKKSLREQGI 182

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS 211
            +T + AKRQ TWL      + +  +
Sbjct: 183 ASTRQLAKRQLTWLRGMKDIEQLDST 208


>gi|239977336|sp|A8FDI9|MIAA_BACP2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 318

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 117/222 (52%), Gaps = 11/222 (4%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDEL 62
           K  +   +   P+IVGGTGLY +++    +   E    A RE++    +Q+G   LH++L
Sbjct: 87  KIKEIAARGKTPMIVGGTGLYIQSVLYDYTFTDEKSDPAFREEMALFEQQHGPLQLHEKL 146

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
            ++D   A+ IHP++ +R+ RALE+   +GQ + E   Q  +  +PL     I +  +R 
Sbjct: 147 KAVDPDAAKAIHPNNVRRVIRALEVIHTTGQKMSE--MQNGHQEVPLYDTAFIGLKMDRE 204

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L ERI +R   M++ G I+E+ +L +  L     + +AIG +++    +G+ + DE +Q
Sbjct: 205 LLYERIHQRIDMMIDEGLIEEVSALYQSGLKDCQSV-QAIGYKELYTYFQGDCSLDEAIQ 263

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
           +    + +YAKRQ TW  ++    W  ++         +++F
Sbjct: 264 QLKQNSRRYAKRQFTWFRNKMDVTWFDMTPPCHFSDKKEEIF 305


>gi|16272042|ref|NP_438241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae Rd KW20]
 gi|260580628|ref|ZP_05848455.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae RdAW]
 gi|319775011|ref|YP_004137499.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3047]
 gi|319896481|ref|YP_004134674.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3031]
 gi|329123086|ref|ZP_08251656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           aegyptius ATCC 11116]
 gi|1170952|sp|P44495|MIAA_HAEIN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|1573017|gb|AAC21746.1| tRNA delta(2)-isopentenylpyrophosphate transferase (trpX)
           [Haemophilus influenzae Rd KW20]
 gi|260092690|gb|EEW76626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae RdAW]
 gi|317431983|emb|CBY80331.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3031]
 gi|317449602|emb|CBY85807.1| tRNA delta-isopentenylpyrophosphate transferase [Haemophilus
           influenzae F3047]
 gi|327471641|gb|EGF17083.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           aegyptius ATCC 11116]
          Length = 311

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 111/210 (52%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+  Y+E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|229845406|ref|ZP_04465537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 6P18H1]
 gi|229811714|gb|EEP47412.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae 6P18H1]
          Length = 311

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPMSAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G  +E+  L          P ++ +G R +   L+G+  Y+E 
Sbjct: 201 HVLHERIEQRFHKMIELGFQEEVEKLYTRGDLNINLPSIRCVGYRQMWEYLQGDYAYEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|88810491|ref|ZP_01125748.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrococcus
           mobilis Nb-231]
 gi|88792121|gb|EAR23231.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrococcus
           mobilis Nb-231]
          Length = 303

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/205 (32%), Positives = 112/205 (54%), Gaps = 1/205 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            + +  +P++VGG+ LYFRAL G L+ +P     +R  +  + +  G   LH  L+ LD+
Sbjct: 80  IHARGRIPLLVGGSMLYFRALVGGLADLPAADQQLRASLEREAQCAGWPALHGRLARLDA 139

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A ++HP+D QRI RALE+  ++G+++ +  ++  +  +P      ++    R  L  R
Sbjct: 140 KTAARLHPNDAQRIQRALEVYELTGETLSDLTRRHASEQLPFPLIKFVMAPAMREVLHRR 199

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I  RF +ML SG +DE+  L          P M+A+G R I   L+G  +Y+  +  G+ 
Sbjct: 200 IEARFRRMLASGFVDEVAELRGRGDLDLSKPSMRAVGYRQIWRHLEGSYDYNTMIACGVS 259

Query: 187 ATNKYAKRQKTWLCHQFQADWIRIS 211
           AT ++AKRQ TWL  +  A+W   +
Sbjct: 260 ATRQFAKRQLTWLRRERGAEWFDAN 284


>gi|166031822|ref|ZP_02234651.1| hypothetical protein DORFOR_01523 [Dorea formicigenerans ATCC
           27755]
 gi|166028275|gb|EDR47032.1| hypothetical protein DORFOR_01523 [Dorea formicigenerans ATCC
           27755]
          Length = 319

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 104/216 (48%), Gaps = 3/216 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  + +Q  Y    +PI+VGGTG Y +AL   +     +  T++R ++    +++G+  L
Sbjct: 81  MAKEAMQKIYAAGHIPIVVGGTGFYIQALLYDIDFTDNDNDTSLRAELETFAEEHGAEAL 140

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H++L  +D   A  IH ++ +R+ RALE    +G  I E  +       P +  + I+  
Sbjct: 141 HEKLREVDPKSADTIHANNIKRVIRALEFYQKTGMKISEHNETERQKESPYQFVYFILND 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L  RI  R  +M+E G + E+++L        +  M+ +G ++I+  L G    +
Sbjct: 201 -DRKNLYRRIDLRVDKMIEEGLVAEVKALKARGYDRSMVSMQGLGYKEILDYLDGVCTLE 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + + +    T  +AKRQ TW   +    WI     +
Sbjct: 260 DAIYKIKRDTRHFAKRQITWFKREKHVTWINKKDYN 295


>gi|218674370|ref|ZP_03524039.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rhizobium etli
           GR56]
          Length = 298

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 93/199 (46%), Positives = 131/199 (65%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYF+ALTG LS MP IP A+R K+R +L + G   L+ EL ++D  ++ 
Sbjct: 98  GQLPVFVGGTGLYFKALTGGLSDMPAIPEALRGKLRMRLLEEGPEGLYAELDAIDPAMSA 157

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            ++  DGQRI RALE+   +G+SI +F  ++    I  E A KI++LP R+ L  RI  R
Sbjct: 158 SLNRQDGQRIVRALEVIQATGRSIADFQGRSGPVLIDAEKARKIVVLPGRAILHARINGR 217

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F +ML+ GA DE+R+L+ + L  + P+MKAIGV  I A+LKGE+  +E L++G  AT +Y
Sbjct: 218 FEKMLQQGAEDEVRALLALGLPAEAPVMKAIGVSQIAAMLKGEMRREEVLEKGAAATRQY 277

Query: 192 AKRQKTWLCHQFQADWIRI 210
           AKRQ TW  +Q    W R+
Sbjct: 278 AKRQMTWFRNQMDESWERL 296


>gi|33151910|ref|NP_873263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           ducreyi 35000HP]
 gi|46576929|sp|Q7U338|MIAA_HAEDU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33148131|gb|AAP95652.1| tRNA delta-2-isopentylpyrophosphate transferase [Haemophilus
           ducreyi 35000HP]
          Length = 313

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 3/209 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
                  +P++VGGT LY++AL   LS +P     IR +I     QYG   LH +L+ +D
Sbjct: 88  DITASGRIPLLVGGTMLYYKALLEGLSPLPSANEHIRTEIEAHANQYGWASLHQQLTQID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +I+ +D QRI RALE+  ++G+++ E   Q      P +     I   ER+ L +
Sbjct: 148 PLAASRINANDSQRINRALEVFYLTGKNLTELTAQQGECL-PYQVLQFAIAPQERAVLHQ 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF +M+E G + E+  L          P ++ +G R +   L GEI+ DE + +GI
Sbjct: 207 RIEQRFHKMMELGFLTEVEKLYARGDLHPDLPAIRCVGYRQMWQHLAGEISLDEAIYKGI 266

Query: 186 IATNKYAKRQKTWLCHQ-FQADWIRISSI 213
            AT + AKRQ TWL     +  W+     
Sbjct: 267 CATRQLAKRQLTWLRGWRSEITWLDSLDP 295


>gi|157692404|ref|YP_001486866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           pumilus SAFR-032]
 gi|157681162|gb|ABV62306.1| tRNA isopentenyltransferase [Bacillus pumilus SAFR-032]
          Length = 331

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 117/222 (52%), Gaps = 11/222 (4%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDEL 62
           K  +   +   P+IVGGTGLY +++    +   E    A RE++    +Q+G   LH++L
Sbjct: 100 KIKEIAARGKTPMIVGGTGLYIQSVLYDYTFTDEKSDPAFREEMALFEQQHGPLQLHEKL 159

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
            ++D   A+ IHP++ +R+ RALE+   +GQ + E   Q  +  +PL     I +  +R 
Sbjct: 160 KAVDPDAAKAIHPNNVRRVIRALEVIHTTGQKMSE--MQNGHQEVPLYDTAFIGLKMDRE 217

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L ERI +R   M++ G I+E+ +L +  L     + +AIG +++    +G+ + DE +Q
Sbjct: 218 LLYERIHQRIDMMIDEGLIEEVSALYQSGLKDCQSV-QAIGYKELYTYFQGDCSLDEAIQ 276

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
           +    + +YAKRQ TW  ++    W  ++         +++F
Sbjct: 277 QLKQNSRRYAKRQFTWFRNKMDVTWFDMTPPCHFSDKKEEIF 318


>gi|260582014|ref|ZP_05849809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae NT127]
 gi|260094904|gb|EEW78797.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           influenzae NT127]
          Length = 311

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 113/210 (53%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     IR ++ +K  Q G   LH E
Sbjct: 82  LREMAEITTQGKIPLLVGGTMLYYKALIEGLSPLPSADENIRAELEQKAAQQGWATLHTE 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A +I+PSD QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 142 LAKIDPISAARINPSDSQRINRALEVFYITGKSLTEL-TEEKGEALPYDFVQFAIAPQDR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDET 180
             L ERI +RF +M+E G   E+  L          P ++ +G R +   L+G+ +++E 
Sbjct: 201 HILHERIEQRFHKMIELGFQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYDHEEM 260

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 261 IFRGICATRQLAKRQLTWLRGWKTPIQWLD 290


>gi|319638137|ref|ZP_07992900.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa C102]
 gi|317400410|gb|EFV81068.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           mucosa C102]
          Length = 313

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 115/211 (54%), Gaps = 2/211 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +   P+IVGGT +YF ALT  L+ +P    A+R +++ +  ++G   L+  L  +D
Sbjct: 88  EIHARGRYPLIVGGTMMYFHALTEGLNDLPGADAAVRAQLQAEKNEHGLAGLYRRLQEVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++  +D QRI RALE+ L++G+ + + + +       L+     +I  +R  L  
Sbjct: 148 PITAGRLKANDSQRIERALEVYLLTGKPLSKHFTEQKQAAPLLDLCTVALIPEDRHLLHR 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           +I +RF  MLE G +DE+ +L +    L   +P M+ +G R     L GE +Y+  +++G
Sbjct: 208 QIEKRFLNMLEHGFLDEMHTLRRDYPQLHADMPSMRCVGYRQAWDYLVGETDYESFVEKG 267

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           I+AT + AKRQ TWL     A  +   +  D
Sbjct: 268 IVATRQLAKRQLTWLRKIPLAHTLDPYADSD 298


>gi|296330948|ref|ZP_06873423.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305674466|ref|YP_003866138.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|296151953|gb|EFG92827.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. spizizenii ATCC 6633]
 gi|305412710|gb|ADM37829.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 314

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/212 (27%), Positives = 111/212 (52%), Gaps = 4/212 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
           +K  +  K+  LP+IVGGTGLY +++    +   E    A R+ ++    + G+  LH +
Sbjct: 86  NKISEIAKRGKLPMIVGGTGLYIQSVLYDYTFTEEANDPAFRQSLQVAAVREGADFLHAK 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ D   A  IHP++ +R+ RALEI   SG+++ +  ++     +   +A  I +  +R
Sbjct: 146 LAAADPEAAAAIHPNNTRRVIRALEILHTSGKTMSQHLQEQKRELV--YNAVLIGLTMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L  RI +R   M+E+G + E++ L   N+      ++AIG +++ A   G +   + +
Sbjct: 204 DTLYARINQRVDMMMEAGLLPEVKRLYDRNVRDCQS-IQAIGYKELYAYFDGFVTLSDAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
            +    + +YAKRQ TW  ++ Q  W  ++  
Sbjct: 263 DQLKQNSRRYAKRQLTWFRNKMQVAWFDMTPP 294


>gi|15602770|ref|NP_245842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|12721221|gb|AAK02989.1| TrpX [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 357

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 77/215 (35%), Positives = 121/215 (56%), Gaps = 3/215 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R +I EK +  G   LH E
Sbjct: 126 LREMADIIAAGKIPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEEKAQLQGWAALHQE 185

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D + A++I+P+D QRI RALE+  ++G+S+ E   Q     +P +     I   +R
Sbjct: 186 LAKIDPLAAQRINPNDSQRINRALEVFYLTGKSLSEL-SQQKGDSLPYQILQFAIAPKDR 244

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L +RI  RF +M+E G   E+     + +L LDLP M+ +G R +   L+G+ ++DE 
Sbjct: 245 SILHDRIALRFQKMIEQGFQQEVEKLYQREDLHLDLPAMRCVGYRQMWEYLRGDYDHDEM 304

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIRISSID 214
           + RGI AT + AKRQ TWL       +W+   +I+
Sbjct: 305 IFRGICATRQLAKRQITWLRGWKYPIEWLDSLAIE 339


>gi|313888264|ref|ZP_07821935.1| tRNA dimethylallyltransferase [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845667|gb|EFR33057.1| tRNA dimethylallyltransferase [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 307

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 115/215 (53%), Gaps = 8/215 (3%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++  +   +  LP++VGGTGLY  +L   L     E     RE++ + LK+ GS  L+
Sbjct: 79  AKEIISEINSRGGLPLVVGGTGLYINSLVYNLDFTETEADYVYREELYKILKEKGSEFLY 138

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L +L+  +A QIHP++GQRI RALEI     +    F ++         +   I +  
Sbjct: 139 KKLYTLNKDMAEQIHPNNGQRIIRALEISKDGNEKGSNFRQEN-----EEYNLIFIGLNM 193

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L ERI  R  +M+E G ++E++SL+   L  +   +KAIG +++I+ L GEI YDE
Sbjct: 194 DRERLYERINNRVDKMIELGLVEEVKSLLDEGLDKNSQSLKAIGYKEVISYLDGEIEYDE 253

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
            ++     +  YAKRQ TW     +  W    S +
Sbjct: 254 MIELIKKNSRHYAKRQLTWFRRDNRIQWFDRESDN 288


>gi|124004921|ref|ZP_01689764.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Microscilla
           marina ATCC 23134]
 gi|123989599|gb|EAY29145.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Microscilla
           marina ATCC 23134]
          Length = 304

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/210 (27%), Positives = 105/210 (50%), Gaps = 5/210 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
             + ++ + I+ GG+GLY +A+   +  MPE+   IR ++  +L+Q G   L  +L  LD
Sbjct: 90  DIFARKQVAILTGGSGLYIQAVCDGIDEMPEVAPEIRAQLMGRLQQEGLEPLLQQLEQLD 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            +  +Q+  ++  R+ RALE+ L +GQ    F K+         +  KI +  +R  L E
Sbjct: 150 PVYYQQVDQANPHRVVRALEVCLSTGQPYSSFRKKNKVQR--PFNILKIGLERDREELYE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   MLE G ++E+++L           ++ +G ++I   +  + ++DE ++    
Sbjct: 208 RINLRMDLMLEQGLLEEVKALYPYKN---HNALQTVGYKEIFDYMDNKHDWDEAVRLLKR 264

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            + +YAKRQ TW     +  W     +D +
Sbjct: 265 NSRRYAKRQMTWFRRDEEIHWFSPQKVDTI 294


>gi|317153497|ref|YP_004121545.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316943748|gb|ADU62799.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 323

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/203 (32%), Positives = 100/203 (49%), Gaps = 1/203 (0%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
            +  LPI+VGGTGLY R+L   ++ +PEIP  IR  + E+++  G   LH EL   D   
Sbjct: 101 DQGRLPILVGGTGLYLRSLLSGMAPIPEIPADIRRAVLERIRAEGPQRLHAELEQADPDY 160

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +IHP+D QR ARA E+ L +G+++  +   + +   P   A KI +      L+  + 
Sbjct: 161 AARIHPNDTQRNARAAEVLLATGRTMTWWHTSSEHTPAPFA-ALKIGMRLSLDELEPHLA 219

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   ML +GA+DE           + P    IG  +++A L+GE   ++     +  T 
Sbjct: 220 GRVDAMLAAGAVDEATRAHAKCPDPEAPGWTGIGCAEMLAYLRGETTLEQARSLWVRNTR 279

Query: 190 KYAKRQKTWLCHQFQADWIRISS 212
            YAKRQ TW   +    W     
Sbjct: 280 AYAKRQLTWFAKEPGIRWFAPGD 302


>gi|225378110|ref|ZP_03755331.1| hypothetical protein ROSEINA2194_03770 [Roseburia inulinivorans DSM
           16841]
 gi|225210111|gb|EEG92465.1| hypothetical protein ROSEINA2194_03770 [Roseburia inulinivorans DSM
           16841]
          Length = 317

 Score =  156 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 104/209 (49%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y +  +PII GGTG Y +AL   +     E   A R ++ +   + G+H LH+ L  +
Sbjct: 89  EIYAEEKIPIIAGGTGFYIQALLYDIDFTEQECDEAYRAELEQLAAEKGAHYLHNMLREV 148

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE   +SG+ I E  ++      P   A+ ++   ERS L 
Sbjct: 149 DPASADAIHANNIKRVIRALEFYHLSGKRISEHNEKEREKTSPYHFAYFVLTD-ERSHLY 207

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
             I +R   M+E G +DE++ L  M    D+  M+ +G ++I+  L G+   +E +    
Sbjct: 208 ANIDKRVDLMIEQGLVDEVQKLKNMGFHRDMVSMQGLGYKEILDYLDGKTTLEEAIYIIK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   +    W+   + D
Sbjct: 268 RETRHFAKRQLTWFRRERDVIWLDKQAYD 296


>gi|153811374|ref|ZP_01964042.1| hypothetical protein RUMOBE_01766 [Ruminococcus obeum ATCC 29174]
 gi|149832501|gb|EDM87585.1| hypothetical protein RUMOBE_01766 [Ruminococcus obeum ATCC 29174]
          Length = 315

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 62/208 (29%), Positives = 102/208 (49%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQYGSHILHDELSSL 65
           + Y+KR +PI+VGGTG Y +A+T  +           R ++ +  +  G+  LHD L  +
Sbjct: 87  EIYEKRKIPILVGGTGFYIQAVTRDIDFTEAQQENTYRAELEKLAETEGAEYLHDRLKEV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE    +G  I    ++      P   A+ ++  P R  L 
Sbjct: 147 DPASADTIHANNVKRVIRALEFYHQNGTPISAHNEEQKKQTSPYNLAYFVLNAP-RDILY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI +R  QMLE G + E+  L +      +  M+ +G ++I+A L+GE   +E ++   
Sbjct: 206 ERIDKRVDQMLEEGLVKEVEGLKREGCHRGMVSMQGLGYKEILAYLEGEYPLEEAVRILK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             T  +AKRQ TW   +    W+     
Sbjct: 266 RDTRHFAKRQLTWFRRESDVIWVDKDKF 293


>gi|47569238|ref|ZP_00239924.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           G9241]
 gi|47554112|gb|EAL12477.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           G9241]
          Length = 317

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 109/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHTNNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +G ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEGRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|219668757|ref|YP_002459192.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfitobacterium hafniense DCB-2]
 gi|239977367|sp|B8FWE4|MIAA_DESHD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|219539017|gb|ACL20756.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Desulfitobacterium hafniense DCB-2]
          Length = 314

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 106/216 (49%), Gaps = 2/216 (0%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           + ++ +Q    +  +PI+VGGTGLY R+L            +IR      L + G   LH
Sbjct: 79  LANQSIQNIQSRGKVPIVVGGTGLYIRSLIDPFQFAEHGSESIRSFWTAFLSEQGKEALH 138

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL- 118
            EL+  D + A+++HP+D  RI RALE+  ++G+   E        + PL  +   + L 
Sbjct: 139 RELAKRDPLSAQRLHPNDTVRIIRALEMCQLTGKPFSEIRGNQDMNYPPLPPSLLYVGLT 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  + ERI RR  QM+ +G I+E  +L+K   S  L  +++IG R  +  L G++   
Sbjct: 199 APREIIYERINRRCEQMVAAGLIEETHNLIKEGYSPKLKPLQSIGYRHALLYLYGKVTLP 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T  +AKRQ TW     +  W    S +
Sbjct: 259 EMMRIFQRDTRHFAKRQLTWFRRDPRVVWYDTYSGN 294


>gi|94429029|gb|ABF18945.1| delta(2)-isopentenylpyrophosphate adenosine transferase [uncultured
           bacterium pFosLip]
          Length = 303

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 68/211 (32%), Positives = 110/211 (52%), Gaps = 2/211 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++         +P++VGGT LYFRALT  ++ +P     IR KI     + G   LH +
Sbjct: 74  IAEIESILAAGRIPLLVGGTMLYFRALTEGIAELPAADPEIRAKIDANADKIGWEALHQQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-E 120
           L  +D   A +I P D QRI RALE+ L +G ++ E+ K++    +      K+ +LP  
Sbjct: 134 LLDVDPEAAARIKPGDRQRIQRALEVFLSTGTTLSEWQKRSGRGRMIDVEFCKLALLPAT 193

Query: 121 RSALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           RS L ERI  R   M  +G ++E+++   +  L+ + P M+A+G R +   L G ++ +E
Sbjct: 194 RSLLHERIETRLKTMFNNGLLEEVKALYDRPGLTSEHPSMRAVGYRQVWEYLDGRVSVEE 253

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRI 210
              + + AT + AKRQ TWL  +        
Sbjct: 254 ARDKALFATRQLAKRQITWLRSESGVQVFDP 284


>gi|260913833|ref|ZP_05920307.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           dagmatis ATCC 43325]
 gi|260631920|gb|EEX50097.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pasteurella
           dagmatis ATCC 43325]
          Length = 315

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 73/216 (33%), Positives = 118/216 (54%), Gaps = 3/216 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     +R +I EK  + G   LH E
Sbjct: 84  LREMQDITAQGKIPLLVGGTMLYYKALIEGLSPLPSANEKVRSEIEEKAAKLGWATLHQE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A++I+ +D QRI RALE+  ++G+S+ E   +     +P E     I   +R
Sbjct: 144 LAMIDPISAQRINQNDSQRINRALEVFYLTGKSLTEL-TEQKGESLPYEIIQFAITPKDR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI  RF +M+E G   E+     + +L  DLP ++ +G R +   L+G+ +Y+E 
Sbjct: 203 YVLHDRIALRFHKMIELGFQQEVEKLYQRPDLHPDLPSIRCVGYRQMWEYLRGDYDYEEM 262

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIRISSIDD 215
           + RGI AT + AKRQ TWL       +W+   + + 
Sbjct: 263 IFRGICATRQLAKRQITWLRGWKYPIEWLDSLAPEK 298


>gi|229061308|ref|ZP_04198656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH603]
 gi|229168448|ref|ZP_04296171.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH621]
 gi|228614854|gb|EEK71956.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH621]
 gi|228717987|gb|EEL69630.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH603]
          Length = 317

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H
Sbjct: 85  VRKCIREITERGKLPIIVGGTGLYIQSVLFDYQFTDEAGDATYREQMEKLALEHGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ +    ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSNQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E++ L +  +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVNLMIEQGLLEEVKGLHERGVRDCQS-IQAIGYKEIYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVAWFDVTDGEK 297


>gi|89894333|ref|YP_517820.1| hypothetical protein DSY1587 [Desulfitobacterium hafniense Y51]
 gi|122483103|sp|Q24X66|MIAA_DESHY RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|89333781|dbj|BAE83376.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 314

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 106/216 (49%), Gaps = 2/216 (0%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           + ++ +Q    +  +PI+VGGTGLY R+L            +IR      L + G   LH
Sbjct: 79  LANQAIQDIQSRGKVPIVVGGTGLYIRSLIDPFQFAEHGSESIRSFWTAFLSEQGKEALH 138

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL- 118
            EL+  D + A+++HP+D  RI RALE+  ++G+   E        + PL  +   + L 
Sbjct: 139 QELAKRDPLSAQRLHPNDTVRIIRALEMCQLTGKPFSETRGNQDLNYPPLPPSTLYVGLT 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  + ERI RR  QM+ +G I+E  +L+K   S  L  +++IG R  +  L G++   
Sbjct: 199 APREIIYERINRRCEQMVAAGLIEETHNLIKEGYSPKLKPLQSIGYRHALLYLYGKVTLP 258

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T  +AKRQ TW     +  W    S +
Sbjct: 259 EMMRIFQRDTRHFAKRQLTWFRRDPRVVWYDTYSGN 294


>gi|225572117|ref|ZP_03780981.1| hypothetical protein RUMHYD_00411 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040451|gb|EEG50697.1| hypothetical protein RUMHYD_00411 [Blautia hydrogenotrophica DSM
           10507]
          Length = 314

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/208 (29%), Positives = 112/208 (53%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y +  +PI+VGGTG Y +++T  +     +     R ++ E  ++ G+  LH +L  +
Sbjct: 87  EIYHRGKIPILVGGTGFYIQSVTRDIDFTSADQNGEYRRQLEETAREQGAEYLHSQLQKV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A++IH ++ +R+ RALE    +   I E  +Q      P + A+ ++  P R  L 
Sbjct: 147 DPASAQKIHANNVKRVIRALEFYQENHYPISEHNRQEQQKASPYQLAYFVLNAP-RELLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI +R  QM+E G +DE+++L  +     +  M+ +G ++I++ L+GEI+ DE ++   
Sbjct: 206 RRIDQRVDQMMEEGLVDEVKALQALGCHRGMISMQGLGYKEILSYLEGEISLDEAVRILK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             T  +AKRQ TW   + +  WI+  + 
Sbjct: 266 RDTRHFAKRQITWFKREPEVIWIQKENY 293


>gi|261856600|ref|YP_003263883.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Halothiobacillus neapolitanus c2]
 gi|261837069|gb|ACX96836.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Halothiobacillus neapolitanus c2]
          Length = 325

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 3/204 (1%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGT +YF+AL   +S +P    A+R +++ +  + G   LH +L S D  VA 
Sbjct: 104 GKVPLLVGGTMMYFQALLDGISQLPSTDPAVRAEVQAEAARLGWPALHAQLQSFDPQVAA 163

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESA--HKIIILPERSALKERIR 129
           ++HP+D QRI RA+E+   +G+S+  + ++ P     L  A     +    R+  +E + 
Sbjct: 164 RVHPNDPQRIGRAVEVFRSTGRSLSRWQREHPPVSPLLGRAVHRFGLWPASRAHAREAMA 223

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLD-LPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
            RF +ML +G +DE+ +L         +P ++A+G R +   L G ++YDE  QR I AT
Sbjct: 224 HRFDEMLAAGFVDEVAALRARGDLHPGMPSIRAVGYRQVWDYLDGTVDYDEMRQRAITAT 283

Query: 189 NKYAKRQKTWLCHQFQADWIRISS 212
            + AKRQ TW+  Q Q  +     
Sbjct: 284 RQLAKRQVTWMRGQTQTQFYPTEE 307


>gi|154483533|ref|ZP_02025981.1| hypothetical protein EUBVEN_01237 [Eubacterium ventriosum ATCC
           27560]
 gi|149735443|gb|EDM51329.1| hypothetical protein EUBVEN_01237 [Eubacterium ventriosum ATCC
           27560]
          Length = 316

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/216 (27%), Positives = 105/216 (48%), Gaps = 3/216 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIP-TAIREKIREKLKQYGSHIL 58
           +  K + + Y+K   PIIVGGTG Y +++   +           R+ + +  K  G   L
Sbjct: 79  LTKKYINEIYEKGKTPIIVGGTGFYIQSVLYDIDFDETEDNHEYRKTLEQIYKDKGVQYL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           ++ L  +D   A+ IH ++ +R+ RALE    +G+ I +  K+      P    + ++  
Sbjct: 139 YNMLKEVDEESAKAIHYNNVKRVIRALEYNHQTGKKISDHNKEQREHASPYNFKYFVLND 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L  RI +R   M++ G +DE++SL+      +L  M+ IG ++II  L G+I+ D
Sbjct: 199 -KRELLYSRINKRVDFMIKEGLVDEVKSLLDKGYDRNLVSMQGIGYKEIIEYLDGKISLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           E ++     T  +AKRQ TW   +     +     D
Sbjct: 258 EAVELIKKNTRHFAKRQLTWFRREKTVTMVNWDEYD 293


>gi|28210985|ref|NP_781929.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           tetani E88]
 gi|46577022|sp|Q895H4|MIAA_CLOTE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28203424|gb|AAO35866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           tetani E88]
          Length = 314

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 109/215 (50%), Gaps = 2/215 (0%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDE 61
           +K  + Y +  +P++VGGTGLY  ++    S          R+ + +  K+ G   +H  
Sbjct: 82  NKIEEIYNRDNIPMLVGGTGLYINSIIYNYSFTDANKDNDYRDYLEKLAKEKGKEYIHSL 141

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILPE 120
           L  +D      +H ++ +R+ RALE+  V+G+ + ++ K+          S +  ++  +
Sbjct: 142 LKDIDEYSYNNLHYNNLKRVIRALEVYKVTGKPMSQYAKEEKENLFNIPYSIYYFVLYMD 201

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R  L ++I  R  +ML+ G +DE++ L +M  +  +  M+ IG ++++  L GEI+++E 
Sbjct: 202 RDKLYDKINMRVDRMLQEGLLDEVKELKEMGCNETMQSMQGIGYKELLYYLNGEISFNEA 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           +      +  YAKRQ TW     +A WI     ++
Sbjct: 262 VYLIKKGSRNYAKRQLTWFRRDPRAIWINKDEFEN 296


>gi|326389403|ref|ZP_08210970.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325994408|gb|EGD52833.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 315

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 118/217 (54%), Gaps = 4/217 (1%)

Query: 3   SKKL--QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILH 59
           +K++    YK+  LPIIVGGTGLY  ++   +     E     REK++E    YGS  L+
Sbjct: 81  AKEIIKDIYKRGKLPIIVGGTGLYINSIIYIMHFSDFEGSKEFREKMKELANTYGSQYLY 140

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-PLESAHKIIIL 118
           ++L S+D   A++IH +D +RI RALE+   +G+ I  + K +        +     +  
Sbjct: 141 EKLKSVDPEAAKKIHSNDIRRIIRALEVYEFTGKPISYYQKMSGMRLNLKYQPIMIGLNF 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI +R  +M+++  ++E+ +L+K+  + D   M+A+G ++I+  LKGE + +
Sbjct: 201 RDRQILYDRINQRVDEMIKNNLVEEVVNLLKIGYNKDSTAMQALGYKEIVEYLKGESSLE 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +++    T +YAKRQ TW        W  +    +
Sbjct: 261 EAVEKIKKGTRRYAKRQITWFKGYNFIKWFFVDDYKN 297


>gi|148379757|ref|YP_001254298.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153933226|ref|YP_001384055.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153937216|ref|YP_001387596.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. Hall]
 gi|166198900|sp|A7FUK8|MIAA_CLOB1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|166198901|sp|A5I2S0|MIAA_CLOBH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148289241|emb|CAL83337.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152929270|gb|ABS34770.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152933130|gb|ABS38629.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A str. Hall]
          Length = 311

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 105/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKDIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  I+
Sbjct: 139 HSLLKDIDKESYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFIL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|331269500|ref|YP_004395992.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum BKT015925]
 gi|329126050|gb|AEB75995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum BKT015925]
          Length = 313

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/209 (27%), Positives = 105/209 (50%), Gaps = 2/209 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSLD 66
              K  LP+IVGGTG Y  +L               R  ++   ++ G   +H+ L  +D
Sbjct: 88  ISSKGNLPMIVGGTGFYIDSLIFNYDFANTYKDEEYRNHLKNLAEEKGKEYVHELLKDVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
               ++++P+D +R+ RALE+  ++ ++I EF  +     IP    + ++   +R+ L E
Sbjct: 148 EESYKRLYPNDLKRVIRALEVFKLANKTISEFNAEQDKFDIPYNVYYFVL-NMDRAKLYE 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R   M+E G ++E++ L  M  + D+  MK IG ++I+  L G++  ++ ++    
Sbjct: 207 RINKRVDIMIERGLVEEVKMLRSMGCTADMQSMKGIGYKEILYYLDGKMTLEDAIELIKK 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            +  YAKRQ TW     +  WI     ++
Sbjct: 267 GSRNYAKRQLTWFRKDKRVIWIDKDQYEN 295


>gi|94971585|ref|YP_593633.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Koribacter versatilis Ellin345]
 gi|226704714|sp|Q1IHU1|MIAA_ACIBL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|94553635|gb|ABF43559.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Koribacter versatilis Ellin345]
          Length = 307

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 64/203 (31%), Positives = 104/203 (51%), Gaps = 2/203 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  LPI+VGGTGLY RAL   L   PE    +RE +R + ++ G   LH  LS +D
Sbjct: 88  DIASRGKLPIVVGGTGLYLRALLDGLFAGPERSEELREHLRRREQERGPTYLHRILSRMD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IHP+D  ++ RA+E+ L + + + E W Q     +      +I + P+R AL +
Sbjct: 148 RVAAAKIHPNDAAKLIRAIEVCLAARKPMTELW-QQGRDPLTGFRILRIGLDPDRPALYD 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR  +M E G ++E ++L           + ++G R    LL G++  ++ +     
Sbjct: 207 RINRRAAEMFEQGLVEETQAL-LAKYGRIGGPLDSLGYRQAFELLDGKLTREQAVAAAQQ 265

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
               YAKRQ TW   + +  W++
Sbjct: 266 GHRNYAKRQMTWFRREPEVRWLK 288


>gi|196034143|ref|ZP_03101553.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           W]
 gi|195993217|gb|EDX57175.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           W]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           +SK + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VSKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLAIERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D     +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESVERIHANNVRRVIRALEIFHTSGEKMSDQHEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQ-FIQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|330432915|gb|AEC17974.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 310

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 112/210 (53%), Gaps = 3/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   K  +P++VGGT LY++AL   LS +P+    +R +I ++ +Q G   LH +L+ +D
Sbjct: 89  QISAKGKIPLLVGGTMLYYKALLEGLSPLPQANAEVRAQIEKQAQQIGWQGLHQQLAVID 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A++IHP+D QRI RALE+  ++G+S+ E   +     +P       I   ER+ L +
Sbjct: 149 PQSAQRIHPNDPQRINRALEVYYLTGKSLTEL-TEQKGEPLPYRLLQFAIAPQERAVLHQ 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF QML  G   E+  L          P ++ +G R +   L+G+ ++ E   R I
Sbjct: 208 RIELRFQQMLAQGFQQEVEKLFARKDLHLNLPSIRCVGYRQMWEFLQGKYDFAEMEYRSI 267

Query: 186 IATNKYAKRQKTWLCHQ-FQADWIRISSID 214
            AT + AKRQ TWL       +W+   +I+
Sbjct: 268 CATRQLAKRQITWLRGWNSPINWLDSLNIE 297


>gi|229098176|ref|ZP_04229123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-29]
 gi|229104272|ref|ZP_04234942.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-28]
 gi|229117194|ref|ZP_04246572.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock1-3]
 gi|228666094|gb|EEL21558.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock1-3]
 gi|228679139|gb|EEL33346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-28]
 gi|228685074|gb|EEL39005.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-29]
          Length = 317

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 110/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +  ++ G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLAQERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           ++L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 EKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG +++    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEVYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|13471468|ref|NP_103034.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           loti MAFF303099]
 gi|21263781|sp|Q98KJ4|MIAA_RHILO RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|14022210|dbj|BAB48820.1| tRNA isopentenyltransferase [Mesorhizobium loti MAFF303099]
          Length = 321

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 98/204 (48%), Positives = 136/204 (66%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
             P+ VGGTGLYFRAL   +S MP+IP  IR++ R +LK+ G+  LH  L   DS  A Q
Sbjct: 106 RRPVFVGGTGLYFRALAEGISEMPDIPPRIRDRWRYELKEQGAVKLHGLLLREDSRAAMQ 165

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           + P+D QRI RALE+   SG+SI+E+  +   P I  ++A  ++I P+R+AL +RI RRF
Sbjct: 166 LKPTDSQRIVRALEVLDASGRSILEWQAERGRPLIDRQTARFLVIEPDRAALVDRIERRF 225

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QML+ GA++E+R L  + L  DLP MKAIGVRD+ A + G++++ E ++R  IAT +YA
Sbjct: 226 DQMLDKGALEEVRQLAALGLDPDLPAMKAIGVRDLQAAMAGQLSFPEAIERAKIATRQYA 285

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW  HQ   +W R+   DDL
Sbjct: 286 KRQATWFRHQLGPEWQRLRPGDDL 309


>gi|324327606|gb|ADY22866.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 317

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDASDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|295094834|emb|CBK83925.1| tRNA isopentenyltransferase (miaA) [Coprococcus sp. ART55/1]
          Length = 316

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 66/214 (30%), Positives = 105/214 (49%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHD 60
           L      Y +  +PIIVGGTG Y +AL   +     +   + REK++     +G   LHD
Sbjct: 85  LRAMEDIYSRGKIPIIVGGTGFYIQALLYDIDFEENDNDMSYREKLQNLADTHGKTFLHD 144

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
            L+ +D   A +IH ++ +R+ RALE    +G  I E  +       P    + ++   +
Sbjct: 145 MLAEVDPESAEKIHENNVKRVIRALEFYKKTGMKISEHNETESQKKSPYNFEYFVLND-D 203

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R  L +RI RR   MLE+G +DE++ L+    S +L  M+ +G ++II  ++G    DE 
Sbjct: 204 RQKLYDRIDRRIDIMLEAGLLDEVKLLVSEGYSRELVSMQGLGYKEIIDYIQGRCTLDEA 263

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           +      T  +AKRQ TW   +    W+  S  D
Sbjct: 264 VYTLKRDTRHFAKRQITWFKREKHVTWVDKSEYD 297


>gi|229075620|ref|ZP_04208604.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock4-18]
 gi|228707492|gb|EEL59681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock4-18]
          Length = 317

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/216 (26%), Positives = 111/216 (51%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI REK+ +  ++ G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREKMEKLAQERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           ++L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++  N    L     I +  
Sbjct: 145 EKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E++ L    +      ++AIG +++    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVKGLYNRGMRDCQS-IQAIGYKEVYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|317129119|ref|YP_004095401.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474067|gb|ADU30670.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 306

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 58/206 (28%), Positives = 105/206 (50%), Gaps = 5/206 (2%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           K  LP+IVGGTGLY  A+         E  +  R ++    +++G+  LH++L  +D   
Sbjct: 90  KGKLPLIVGGTGLYVNAVIYDYDFSSSEGDSNFRNRLERFAQEHGNEALHEQLKHVDPQS 149

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
            +++HP++ +RI RALEI  V+G++I     +   P     +   + +  ER  L  RI 
Sbjct: 150 FKELHPNNIRRIIRALEIFHVTGKTI---HDRPQQPKQSPYNVVVVGLTMEREKLYSRIN 206

Query: 130 RRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATN 189
            R   M+  G I+E  +L K  +     + +AIG ++I   ++G ++ +E +      + 
Sbjct: 207 ERVDNMVTGGLIEEAEALYKAGVVDCQSV-QAIGYKEIYQYIEGNLSKEEAIDLLKRNSR 265

Query: 190 KYAKRQKTWLCHQFQADWIRISSIDD 215
           +YAKRQ TW  ++    W  +++  +
Sbjct: 266 RYAKRQLTWFRNKMDITWFDMTNEKE 291


>gi|291522253|emb|CBK80546.1| tRNA isopentenyltransferase (miaA) [Coprococcus catus GD/7]
          Length = 319

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 65/208 (31%), Positives = 101/208 (48%), Gaps = 2/208 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYG-SHILHDELSSLD 66
                 +PIIVGGTG Y +A+   +          R ++ E   +      L++ L  +D
Sbjct: 88  IRANGHVPIIVGGTGFYIQAILNDIDFKENEDDGYRTQLEEMAAKEDGPEKLYEMLKKVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IH  + +R+ RALE    +GQ I E  +Q      P   A+ ++  P R  L +
Sbjct: 148 PESAEKIHGHNTKRVIRALEYFHQTGQKISEHNEQEAQKESPYNFAYFVLNRP-REILYD 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R  QM+E G ++E+RSL +      L  M+ +G ++I+A L GEI  +E +     
Sbjct: 207 RIDKRVDQMMEEGLVEEVRSLKEHGYDRSLVSMQGLGYKEILAYLDGEITLEEAVYILKR 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
            T  +AKRQ TW   + +  WI  S  D
Sbjct: 267 DTRHFAKRQLTWFKREREVLWIDQSQYD 294


>gi|301156623|emb|CBW16094.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Haemophilus parainfluenzae T3T1]
          Length = 317

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 119/210 (56%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     +R +I EK ++ G   LH E
Sbjct: 88  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADEKLRLEIEEKAQKLGWPALHQE 147

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A +I+P+D QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 148 LQKIDPISAERINPNDSQRINRALEVFYLTGKSLTEL-TEQKGEELPYQFLQFAIAPEDR 206

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G  +E+     + +L  DLP ++ +G R +   L+G+ +++E 
Sbjct: 207 AVLHQRIEQRFHKMIELGFQEEVEKLYQREDLHPDLPSIRCVGYRQMWEYLRGDYDHEEM 266

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL       +W+ 
Sbjct: 267 VFRGICATRQLAKRQITWLRGWKTPLNWLD 296


>gi|170760598|ref|YP_001787119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|238688734|sp|B1KSA1|MIAA_CLOBM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169407587|gb|ACA55998.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 311

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 105/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKDIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  ++
Sbjct: 139 HSLLKDIDEKSYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFVL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|229134513|ref|ZP_04263324.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST196]
 gi|228648906|gb|EEL04930.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST196]
          Length = 317

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 107/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        E      RE++ +   ++G   +H
Sbjct: 85  VRKYIREITERGKLPIIVGGTGLYIQSVLFDYQFTDEAGDATYREQMEKLALEHGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ +    ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSNQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
            R  L +RI  R   M+E G ++E++ L +  +      ++AIG ++I    +  ++ +E
Sbjct: 203 NREMLYDRINLRVNLMIEQGLLEEVKGLHERGVRDCQS-IQAIGYKEIYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVAWFDVTDGEK 297


>gi|153939563|ref|YP_001391053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum F str. Langeland]
 gi|166198902|sp|A7GE43|MIAA_CLOBL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|152935459|gb|ABS40957.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum F str. Langeland]
 gi|295319103|gb|ADF99480.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum F str. 230613]
          Length = 311

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 103/210 (49%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             + +  LPII GGTGLY  +L         +     RE + +  +  G   +H  L  +
Sbjct: 86  DIWNRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLAEDKGKEYVHSLLKDI 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILPERSAL 124
           D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  I+   R  L
Sbjct: 146 DEESYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFILNMNREVL 205

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ DE +   
Sbjct: 206 YERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISLDEAIYLI 265

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
              +  YAKRQ TW     ++ WI     +
Sbjct: 266 KKGSRNYAKRQLTWFRKDKRSIWIDKDKYN 295


>gi|229031338|ref|ZP_04187342.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1271]
 gi|228729968|gb|EEL80944.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1271]
          Length = 317

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   T  RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDTMYREQMEQLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I       ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMEQGLLEEVEGLYNSGIRDCQS-IQAIGYKEIYDYFANRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|229157291|ref|ZP_04285369.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 4342]
 gi|228626018|gb|EEK82767.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 4342]
          Length = 317

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 53/210 (25%), Positives = 104/210 (49%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H +L  +
Sbjct: 91  EITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  +R  L 
Sbjct: 151 DPESAERIHTNNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTMDREMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M++ G ++E+  L    +      ++AIG ++I    +G ++ +E + +  
Sbjct: 209 DRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEGRVSLEEAVSQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|229020914|ref|ZP_04177608.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1273]
 gi|229025142|ref|ZP_04181567.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1272]
 gi|228736151|gb|EEL86721.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1272]
 gi|228740383|gb|EEL90687.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1273]
          Length = 317

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 104/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K +    K+  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIRDITKRGKLPIIVGGTGLYIQSVLFDYQFTDDAGDATYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +   +  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLGKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDHFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|294507512|ref|YP_003571570.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber M8]
 gi|294343840|emb|CBH24618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber M8]
          Length = 333

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/199 (31%), Positives = 112/199 (56%), Gaps = 4/199 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++   P++VGG  LY  AL   L+ +P++   +R+++ ++L+  G   L++EL  +D   
Sbjct: 107 ERGRRPLVVGGATLYLHALQYGLADIPDVDDEVRDELNQRLESEGQDALYEELQQVDPRQ 166

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +  P+  Q++ RALE+   +G+ +  +++  P    P      +++  +R  L +RI 
Sbjct: 167 AAETDPTKTQKVIRALEVYHGTGKPLSYYYENQPE---PPFDYVTVVLNRDREKLYDRIN 223

Query: 130 RRFTQMLESGAIDEIRSLMK-MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +R  +ML++G +DE+R +M    + LD P +  IG R+ I  LKG+I+YDE ++     T
Sbjct: 224 QRVDRMLDAGLLDEVRDVMDIDGVQLDEPPLSTIGYREPIQHLKGDIDYDEMVRLVKRNT 283

Query: 189 NKYAKRQKTWLCHQFQADW 207
            +YAKRQ TW     +  W
Sbjct: 284 RRYAKRQLTWFRRYDEYHW 302


>gi|83814321|ref|YP_445622.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber DSM 13855]
 gi|123528774|sp|Q2S2F9|MIAA_SALRD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|83755715|gb|ABC43828.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Salinibacter
           ruber DSM 13855]
          Length = 324

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 62/199 (31%), Positives = 112/199 (56%), Gaps = 4/199 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
           ++   P++VGG  LY  AL   L+ +P++   +R+++ ++L+  G   L++EL  +D   
Sbjct: 98  ERGRRPLVVGGATLYLHALQYGLADIPDVDDEVRDELNQRLESEGQDALYEELQQVDPRQ 157

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
           A +  P+  Q++ RALE+   +G+ +  +++  P    P      +++  +R  L +RI 
Sbjct: 158 AAETDPTKTQKVIRALEVYHGTGKPLSYYYENQPE---PPFDYVTVVLNRDREKLYDRIN 214

Query: 130 RRFTQMLESGAIDEIRSLMK-MNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
           +R  +ML++G +DE+R +M    + LD P +  IG R+ I  LKG+I+YDE ++     T
Sbjct: 215 QRVDRMLDAGLLDEVRDVMDIDGVQLDEPPLSTIGYREPIQHLKGDIDYDEMVRLVKRNT 274

Query: 189 NKYAKRQKTWLCHQFQADW 207
            +YAKRQ TW     +  W
Sbjct: 275 RRYAKRQLTWFRRYDEYHW 293


>gi|218904839|ref|YP_002452673.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH820]
 gi|226704716|sp|B7JIE1|MIAA_BACC0 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218534892|gb|ACK87290.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH820]
          Length = 317

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|253996217|ref|YP_003048281.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           mobilis JLW8]
 gi|253982896|gb|ACT47754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           mobilis JLW8]
          Length = 319

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/209 (31%), Positives = 109/209 (52%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LYF+AL   LS +PE   A+R++I ++    G   +H +L+ +D
Sbjct: 91  DITARGKIPVLVGGTMLYFKALEEGLSQLPEADPAVRQQIEQEASALGWPAMHAKLALVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+S+    + +    +P       ++  +R  L  
Sbjct: 151 PESAARLQPNDVQRIERALEVYRITGKSMTALHQASSGDTLPYRLLKIALVPSDRKVLHA 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL--SLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF +ML  G +DE+++L++     + D   M+ +G R  +  L GE +  E   RG
Sbjct: 211 RIALRFEKMLAHGFVDEVKALVRKYPALTSDSTSMRCVGYRQALEYLAGEYDATELRDRG 270

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSI 213
           I AT + AKRQ TWL        +     
Sbjct: 271 IFATRQLAKRQLTWLRSMQDLHQVDCLDP 299


>gi|253999000|ref|YP_003051063.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylovorus
           sp. SIP3-4]
 gi|253985679|gb|ACT50536.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylovorus
           sp. SIP3-4]
          Length = 318

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   L+ +P+    +R+++ E+    G   +H  L++LD
Sbjct: 92  EITARGRIPLLVGGTMLYFKALQEGLNNLPQADADLRQRLDEEAAMVGWPAMHARLAALD 151

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  +SG  +   +        P       ++  +RS L  
Sbjct: 152 PETAARLKPTDSQRIQRALEVCELSGGPMSALFVDDNGSTFPYRLLKLALVPSDRSVLHA 211

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF  ML+ G I E+  L +   +L   LP M+ +G R +   L  +I++    ++G
Sbjct: 212 RIAERFDLMLQQGLIAEVEHLRQKYPALHLGLPSMRCVGYRQVWEYLDQQIDHATMREKG 271

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           I+AT + AKRQ TWL        +   + D
Sbjct: 272 IVATRQLAKRQLTWLRGMQDTVELDCLAPD 301


>gi|313201106|ref|YP_004039764.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylovorus
           sp. MP688]
 gi|312440422|gb|ADQ84528.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylovorus
           sp. MP688]
          Length = 305

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  +P++VGGT LYF+AL   L+ +P+    +R+++ E+    G   +H  L++LD
Sbjct: 79  EITARGRIPLLVGGTMLYFKALQEGLNNLPQADADLRQRLDEEAAVLGWPAMHARLAALD 138

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  +SG  +   +        P       ++  +RS L  
Sbjct: 139 PETAARLKPTDSQRIQRALEVCELSGGPMSALFVDDNGSTFPYRLLKLALVPSDRSVLHA 198

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF  ML+ G I E+  L +   +L   LP M+ +G R +   L  +I++    ++G
Sbjct: 199 RIAERFDLMLQQGLIAEVEHLRQKYPALHLGLPSMRCVGYRQVWEYLDQQIDHATMREKG 258

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           I+AT + AKRQ TWL        +   + D
Sbjct: 259 IVATRQLAKRQLTWLRGMQDTVELDCLAPD 288


>gi|311068257|ref|YP_003973180.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           atrophaeus 1942]
 gi|310868774|gb|ADP32249.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           atrophaeus 1942]
          Length = 314

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 67/212 (31%), Positives = 111/212 (52%), Gaps = 4/212 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDE 61
           SK  +  ++  LP+IVGGTGLY +++    +   E   +A R+K+ E   Q G+  LH  
Sbjct: 86  SKIKEISERGKLPMIVGGTGLYIQSVLYDYTFTEEANDSAFRKKMEEAAVQEGAEALHAR 145

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ DS  A  IHP++ +R+ RALEI   SG+++ +  K+       L  +  I +  +R
Sbjct: 146 LAAADSEAAASIHPNNIRRVIRALEILHTSGKTMSQHLKEQKREQ--LYHSVMIGLTMDR 203

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
            AL ERI  R   M+  G  DE++ L   NL      ++AIG +++ A   G +   E +
Sbjct: 204 EALYERINERVDIMMAEGLADEVKQLYNQNLRDCQS-IQAIGYKELYAYFDGIVTLSEAV 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           ++    + +YAKRQ TW  ++    W  ++  
Sbjct: 263 EQLKQNSRRYAKRQLTWFRNKMHVSWFDMTPP 294


>gi|197301742|ref|ZP_03166812.1| hypothetical protein RUMLAC_00468 [Ruminococcus lactaris ATCC
           29176]
 gi|197299182|gb|EDY33712.1| hypothetical protein RUMLAC_00468 [Ruminococcus lactaris ATCC
           29176]
          Length = 334

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 64/214 (29%), Positives = 103/214 (48%), Gaps = 6/214 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLD 66
            Y++  +PI+VGGTG Y +AL   +     E     R+++ +  ++ G   LH  L   D
Sbjct: 107 IYERGHIPIVVGGTGFYIQALLYDIDFTENETDHTYRKELEQLAEEKGEEYLHKLLQEAD 166

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A QIH  + +R+ RALE    +G  I E  ++         SA+ ++   ER  L E
Sbjct: 167 PESAGQIHCHNVKRVIRALEFYHQTGTKISEHNEKEREKEAAYRSAYFVLTD-ERKRLYE 225

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR  +M+E G  +E+ +L K  L  +   M+ +G +++    +GE  ++E ++    
Sbjct: 226 RIDRRVEKMMEQGLPEEVEALRKRGLKRENVSMQGLGYKELFGYFEGEYPFEEAVRIIQR 285

Query: 187 ATNKYAKRQKTWLCHQFQADWIRIS----SIDDL 216
            T  +AKRQ TW   +    WI  S      D L
Sbjct: 286 DTRHFAKRQLTWFRRERDVIWIDKSIVGRDEDKL 319


>gi|228986851|ref|ZP_04146978.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228772800|gb|EEM21239.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 317

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/210 (25%), Positives = 104/210 (49%), Gaps = 4/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H +L  +
Sbjct: 91  EITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVHKKLQEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  +R  L 
Sbjct: 151 DPESAERIHTNNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTMDREMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M++ G ++E+  L    +      ++AIG ++I    +G ++ +E + +  
Sbjct: 209 DRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEGHVSLEEAVSQLK 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             + +YAKRQ TW  ++    W  ++  + 
Sbjct: 268 TNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|15614929|ref|NP_243232.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           halodurans C-125]
 gi|11386936|sp|Q9KAC3|MIAA_BACHD RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|10174986|dbj|BAB06085.1| tRNA isopentenylpyrophosphate transferase [Bacillus halodurans
           C-125]
          Length = 314

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 107/209 (51%), Gaps = 3/209 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + +++  LP +VGGTGLY  A+  Q ++         R ++   +  YG   LHD+LS +
Sbjct: 87  EIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IHP++ +R+ RALEI  ++G+++ E  +       P       + + ER  L 
Sbjct: 147 DPKAAAAIHPNNYRRVIRALEIIKLTGKTVTEQARHEEETPSPYNLVMIGLTM-ERDVLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI RR  QM+E G IDE + L    +     + +AIG +++   L G +  +E +    
Sbjct: 206 DRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSV-QAIGYKEMYDYLDGNVTLEEAIDTLK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             + +YAKRQ TW  ++    W  ++ +D
Sbjct: 265 RNSRRYAKRQLTWFRNKANVTWFDMTDVD 293


>gi|149278887|ref|ZP_01885022.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pedobacter sp.
           BAL39]
 gi|149230506|gb|EDM35890.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pedobacter sp.
           BAL39]
          Length = 307

 Score =  154 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 55/206 (26%), Positives = 94/206 (45%), Gaps = 5/206 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +K+  L I+VGG+GLY  A+   L  +PE    IRE++ +KL + G   + ++L ++D
Sbjct: 90  KLFKEHQLLIMVGGSGLYIDAVCNGLDDLPETDLQIREQLNKKLAEEGLQAIQEQLKTVD 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
                ++  S+ QR+ R LE  L  GQ +  +            +  KI +  +R  L E
Sbjct: 150 PEYYDKVDQSNPQRMIRGLEFFLSIGQKLSSYLTNTKKER--PFNTIKIGLNMDRDKLYE 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   M+E+G + E+  L           +  +G  ++   L G  +  E + +   
Sbjct: 208 RINHRVDCMMEAGLMQEVERLQPFRQ---YNALNTVGYSELFDYLDGNSSLQEAVAKIKQ 264

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISS 212
            T ++AKRQ TW        W   + 
Sbjct: 265 NTRRFAKRQLTWFRRDNSTAWFEPTD 290


>gi|49474431|ref|YP_032473.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           quintana str. Toulouse]
 gi|61214102|sp|Q6FZ96|MIAA_BARQU RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49239935|emb|CAF26337.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           quintana str. Toulouse]
          Length = 295

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 85/215 (39%), Positives = 131/215 (60%), Gaps = 1/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K L  +  + L I VGGTGLYFRAL   LS +P I  A+R+K R +L + G+  L+ +
Sbjct: 82  VRKLLTTFTSKSL-IFVGGTGLYFRALLEGLSEIPHISDAVRQKWRLRLDKEGAENLYRQ 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D++ A +I   DGQRI RALE+  V+G+ +  + K+   P I    + KI+++P R
Sbjct: 141 LLRIDAVFAEKISSQDGQRIIRALEVYDVTGKKLSWWQKKKTPPLISPNCSEKILLIPPR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M+E GA++E+ ++ K+ LS  LP MKAIG+ +  A   G  ++++ L
Sbjct: 201 QWLYERIHKRLDNMIERGALEEVFAMKKLMLSPFLPAMKAIGMPEFTAYFDGYKSFEDAL 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +     T +YAKRQ TW  +QF  +W  ISS +++
Sbjct: 261 EMAKTQTRRYAKRQMTWFRNQFDEEWTLISSCEEV 295


>gi|83589963|ref|YP_429972.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moorella
           thermoacetica ATCC 39073]
 gi|123524597|sp|Q2RJG0|MIAA_MOOTA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|83572877|gb|ABC19429.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Moorella
           thermoacetica ATCC 39073]
          Length = 324

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 64/212 (30%), Positives = 106/212 (50%), Gaps = 5/212 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSLD 66
             ++  LP++VGGTGLY++A+       PE     +R+++ E   ++G   LH++L  +D
Sbjct: 98  IIRRGHLPLLVGGTGLYYQAVVDPYRFTPEGGDPRVRQELEELAAKFGDAYLHEQLKRVD 157

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A++IHP D +R+ RALE+   +GQ I            P   A   + +P R  L  
Sbjct: 158 PEAAKRIHPHDRRRLVRALEVFKTTGQPISAALAWRRQQESPYHLAAVALSMP-RPLLYR 216

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   M+ +G I+E+  L        LP ++A+G ++I A L+ EI  +E +     
Sbjct: 217 RIEARVDAMIAAGLIEEVSRL-LARYDYRLPALQALGYKEIGAYLRKEIELEEAIAILKR 275

Query: 187 ATNKYAKRQKTWLCHQFQADW--IRISSIDDL 216
            T + AKRQ TW     +  W  +    I+++
Sbjct: 276 NTRRLAKRQLTWFRRDRRLHWWEVDPDKIEEI 307


>gi|291536171|emb|CBL09283.1| tRNA isopentenyltransferase (miaA) [Roseburia intestinalis M50/1]
          Length = 318

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 61/204 (29%), Positives = 103/204 (50%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y    +PII GGTG Y +AL   +    +      R ++ +  +++G+  LH  L  +
Sbjct: 88  EIYADGKIPIIAGGTGFYIQALLYDIDFTEQQCDETYRRQLEDLAREHGAEYLHGILREV 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE   +SG+ I E  +       P   A+ ++   ER+ L 
Sbjct: 148 DPASAEAIHANNIKRVIRALEFYHLSGKKISEHNETERQKQSPYNFAYFVLTD-ERAKLY 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR   M+E+G ++E++ L  M  S ++  M+ +G ++I+A L G    +E +    
Sbjct: 207 ERIDRRVNAMIEAGLVEEVKKLKSMGCSREMVSMQGLGYKEILAYLDGGCTLEEAVYIIK 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
             T  +AKRQ TW   +    W+ 
Sbjct: 267 RETRHFAKRQLTWFKRERDVIWLD 290


>gi|212639349|ref|YP_002315869.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anoxybacillus
           flavithermus WK1]
 gi|226704715|sp|B7GIA2|MIAA_ANOFW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|212560829|gb|ACJ33884.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anoxybacillus
           flavithermus WK1]
          Length = 311

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 61/211 (28%), Positives = 110/211 (52%), Gaps = 7/211 (3%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              K+  LPIIVGGTGLY +++               +  R+ L++     L+++L  +D
Sbjct: 87  DITKRGKLPIIVGGTGLYIQSVIYDYQF---SDAPSNDLYRQSLERCSPDELYEQLKQID 143

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IHP++ +R+ RALEI   +G+++ E+ K+     +   +   I +  ER  L  
Sbjct: 144 PLSAERIHPNNVRRVIRALEIYHCTGKTMTEWLKEQKRQLV--YNVALIGLTMEREKLYA 201

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R  QM++ G I+E++ L +  L      ++AIG +++ A   G +   E +++   
Sbjct: 202 RINQRVDQMIDQGLIEEVKRLYEQGLRDCQA-IQAIGYKELYAYFDGMLTLKEAIEQLKQ 260

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
            + +YAKRQ TW  +Q    W  ++  D +F
Sbjct: 261 NSRRYAKRQFTWFRNQMPVQWFDMTD-DTIF 290


>gi|88798918|ref|ZP_01114500.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Reinekea sp.
           MED297]
 gi|88778398|gb|EAR09591.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Reinekea sp.
           MED297]
          Length = 321

 Score =  154 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/222 (31%), Positives = 115/222 (51%), Gaps = 12/222 (5%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+K  +   +  +P++ GGT LYF++L   +S +P     +R +++ +L++ G   L DE
Sbjct: 85  LAKMAEITAQGRIPLLTGGTMLYFKSLVEPMSDLPPGDDRVRAELQSQLQEQGLTGLLDE 144

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNP-----------FIPLE 110
           LS +D     +I   + QR+ RALE+  ++G+ I  FW +  +              P  
Sbjct: 145 LSRVDPEAYGRIDHQNPQRVLRALEVFKITGRPISSFWAEGVHDGRGRLSAEAASQFPYR 204

Query: 111 SAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIA 169
               I++  +R+ L +RI  RF  MLE G  +E+ +L +        P M+++G R +  
Sbjct: 205 LLQYIVMPQDRTVLHDRIAHRFRGMLELGFQNEVEALYRRGDLHLDLPSMRSVGYRQMWQ 264

Query: 170 LLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
            L G ++YD  ++RGIIAT + AKRQ TWL     A  +  S
Sbjct: 265 YLDGTLDYDNMVERGIIATRQLAKRQLTWLRGWPDATVLDTS 306


>gi|261867645|ref|YP_003255567.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412977|gb|ACX82348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 314

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 117/210 (55%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R +I  K ++ G   LH E
Sbjct: 87  LREMQDITSLGKIPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEAKAERIGWAALHQE 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A++I+P+D QRI RALE+  +SG+++ E   +     +P E     I   +R
Sbjct: 147 LNKIDPISAQRINPNDSQRINRALEVFYLSGKTLTEL-TEQKGDALPYEILQFAIAPEQR 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF +M+E G   E+  L +  +L  +LP ++ +G R +   L+G+ ++DE 
Sbjct: 206 DLLHQRIEQRFHKMIELGFQQEVEKLYRRADLHENLPSIRCVGYRQMWEYLRGDYSHDEM 265

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 266 VFRGICATRQLAKRQITWLRGWKSPIQWLD 295


>gi|253682240|ref|ZP_04863037.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum D str. 1873]
 gi|253561952|gb|EES91404.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum D str. 1873]
          Length = 313

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 106/209 (50%), Gaps = 2/209 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSLD 66
              K  LP+IVGGTG Y  +L               RE ++    + G   +H+ L  +D
Sbjct: 88  IASKGKLPMIVGGTGFYIDSLIFNYDFANTYKDEEYREYLKNLADKKGKEYVHELLKDID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
               ++++P+D +R+ RALE+  ++ ++I EF ++     IP    + ++   +RS L E
Sbjct: 148 EESYKRLYPNDLKRVIRALEVFKLTNKTISEFNEEQDKFDIPYNVYYFVL-NMDRSKLYE 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R   M+E G ++E++ L  M  + D+  MK IG ++I+  L G++  ++ ++    
Sbjct: 207 RINKRVDIMIERGLVEEVKMLRSMGCTADMQSMKGIGYKEILYYLDGKMTLEDAIELIKK 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            +  YAKRQ TW     +  WI     ++
Sbjct: 267 GSRNYAKRQLTWFRKDKRVIWIDKDQYEN 295


>gi|147677679|ref|YP_001211894.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelotomaculum
           thermopropionicum SI]
 gi|239977430|sp|A5D2K7|MIAA_PELTS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|146273776|dbj|BAF59525.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelotomaculum
           thermopropionicum SI]
          Length = 314

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/216 (29%), Positives = 118/216 (54%), Gaps = 7/216 (3%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILH 59
           ++ K L+   +  LPI+VGGTGLY  AL    S         +R+K++++  +    +LH
Sbjct: 89  VIKKVLE---RGNLPIVVGGTGLYIEALIRNYSFGGAGTDKTLRKKLQKEAAE-SPFLLH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
             L+ +D   A Q+HP++ +R+ RALE+  ++G+ I  F  +  +   P  +     +  
Sbjct: 145 QRLAKIDPATASQLHPANTRRVIRALEVYYLTGKPISNF--KRLDEPDPPFNLLMFGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           ER AL  RI +R  +M+  G I+E+++L++   S  L  M+ +G +++I+ L G ++ +E
Sbjct: 203 EREALYRRIEKRVDRMIAMGLIEEVQNLLQRGFSPRLNSMRGLGYKEMISYLNGTLSLEE 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            ++     T ++AKRQ TW     +  W++I +  D
Sbjct: 263 AVEVLKRNTRRFAKRQMTWFRRYKEIRWLKIENFAD 298


>gi|315924591|ref|ZP_07920810.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622121|gb|EFV02083.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 327

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 65/208 (31%), Positives = 104/208 (50%), Gaps = 4/208 (1%)

Query: 8   RYKKRFLPIIVGGTGLYFRALT--GQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
              +  +PI+VGGTGLY  ALT     +  P    A+RE +  +    G+  L+ EL +L
Sbjct: 89  ILSRERVPIVVGGTGLYINALTLPWGFAE-PASDPAVREALEARYDTEGAEALYRELETL 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP + +RI RA+E+  V+G++   +  +A    +P +     I +  RS L 
Sbjct: 148 DPAAAEKIHPHNKKRIVRAMEVYQVTGKTKSAWEARARQIELPYDFVMMGIGMA-RSELY 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  QM+  G +DE+ +L+      +L  M+AIG +++I  ++GE    E +    
Sbjct: 207 ARIDHRVDQMMAGGLLDEVLALLDAGYGPELLSMQAIGYKELIPAVRGEQPLAECVHILK 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             T  +AKRQ TW     +  W   +  
Sbjct: 267 RDTRHFAKRQLTWFRRDRRIRWYDPADY 294


>gi|296283979|ref|ZP_06861977.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Citromicrobium
           bathyomarinum JL354]
          Length = 312

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 78/208 (37%), Positives = 119/208 (57%), Gaps = 4/208 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           +    +    +PI+VGGTGLY R L   ++ +P IP  +R+ +R       +     EL+
Sbjct: 99  EIADIHAHGDVPILVGGTGLYIRTLMEGIAPVPTIPADVRDAVRA----LPTPDAFAELA 154

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           + D     +++P D QRIARALE+   +G ++ E+ ++         +   +I+LPER  
Sbjct: 155 TADPASHARLNPGDTQRIARALEVVRATGLTLGEWQQRKEGGIADRVALSPVILLPEREW 214

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
           L  R   RF+ MLE GA+ E+ +L+  +L  DLP+M+AIGVR+I   L+GE + +E ++ 
Sbjct: 215 LYARCDARFSAMLEQGAVAEVEALLARDLDPDLPVMRAIGVREIAGWLRGECSREEMIET 274

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRIS 211
           G  AT  YAKRQ TWL HQ   DW R+ 
Sbjct: 275 GQRATRNYAKRQYTWLRHQPPQDWPRVE 302


>gi|293392158|ref|ZP_06636492.1| hypothetical protein D7S_2331 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952692|gb|EFE02811.1| hypothetical protein D7S_2331 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 314

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 73/210 (34%), Positives = 116/210 (55%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT LY++AL   LS +P     +R +I  K ++ G   LH E
Sbjct: 87  LREMQDITSLGKIPLLVGGTMLYYKALLEGLSPLPSADEKVRSEIEAKAERIGWAALHQE 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A++I+P+D QRI RALE+  +SG+++ E   +     +P E     I   +R
Sbjct: 147 LDKIDPISAQRINPNDSQRINRALEVFYLSGKTLTEL-TEQKGDVLPYEILQFAIAPEQR 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L +RI +RF +M+E G   E+  L +  +L  +LP ++ +G R +   L+G+ ++DE 
Sbjct: 206 DLLHQRIEQRFHKMIELGFQQEVEKLYRRADLHENLPSIRCVGYRQMWEYLRGDYSHDEM 265

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 266 VFRGICATRQLAKRQITWLRGWKSPIQWLD 295


>gi|229829059|ref|ZP_04455128.1| hypothetical protein GCWU000342_01144 [Shuttleworthia satelles DSM
           14600]
 gi|229792222|gb|EEP28336.1| hypothetical protein GCWU000342_01144 [Shuttleworthia satelles DSM
           14600]
          Length = 316

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 58/208 (27%), Positives = 109/208 (52%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y +  +P+IVGGTG Y +A+T  +     +     R+++    ++ G   LH++L ++
Sbjct: 86  EIYARGRIPMIVGGTGFYIQAITRDIDFTSMQEDVEFRQRMEALAEEEGPEFLHEKLRAV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A QIH ++ +R+ RALE   VSGQ I +   +      P   A+ ++   +R  L 
Sbjct: 146 DPSAADQIHFNNVKRVVRALEFYHVSGQRISDHNAREREKKSPYNLAYFVLT-QDRKTLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI +R  +M++ G +DE+ +L +      +  M+ +G ++I+  L G I+ D+ + +  
Sbjct: 205 QRIDKRVDRMMQEGLLDEVAALKRAGYHQGMVSMQGLGYKEILEYLDGRISLDQAVYQIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             +  +AKRQ TW   +    W+  S+ 
Sbjct: 265 RDSRHFAKRQLTWFRREKDVVWLDKSAF 292


>gi|291559005|emb|CBL37805.1| tRNA isopentenyltransferase (miaA) [butyrate-producing bacterium
           SSC/2]
          Length = 320

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 110/214 (51%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +P+IVGGTG Y ++L   +    E      R+++ EK K+ G+  L++ L  +
Sbjct: 86  EIYAKGKIPLIVGGTGFYIQSLLYDIDFTKEDGDQEYRKQLEEKAKREGNDSLYEMLKQV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D     +IH ++ +R+ RALE   ++G  I E  ++      P   A+ ++   +R  L 
Sbjct: 146 DPKSTEKIHKNNVKRVIRALEFYKLNGYPISEHNEKEAAKTSPYNFAYFVL-NHKRDILY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI RR   M E G IDE++ L +      +  M+ IG R +   L+G ++ ++T+++  
Sbjct: 205 DRINRRVDIMAEQGLIDEVKRLKEEGYEKTMVSMQGIGYRQVFEYLEGNLSLEDTIEQIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
             T  +AKRQ TW   + +   +  S   S D++
Sbjct: 265 KDTRHFAKRQLTWFGREKEVCMVDKSQFGSEDEI 298


>gi|325577873|ref|ZP_08148106.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160303|gb|EGC72430.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 317

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 72/210 (34%), Positives = 120/210 (57%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     +R +I EK +++G  +LH E
Sbjct: 88  LREMADITAQGKIPLLVGGTMLYYKALIEGLSPLPSADENLRLEIEEKAQKFGWPVLHQE 147

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D I A +I+P+D QRI RALE+  ++G+S+ E   +     +P +     I   +R
Sbjct: 148 LQKIDPISAERINPNDSQRINRALEVFYLTGKSLTEL-TEQKGEELPYQFLQFAIAPEDR 206

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G  +E      + +L  DLP ++ +G R +   L+G+ +++E 
Sbjct: 207 AVLHQRIEQRFHKMIELGFQEEAEKLYQREDLHPDLPSIRCVGYRQMWEYLRGDYDHEEM 266

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL       +W+ 
Sbjct: 267 VFRGICATRQLAKRQITWLRGWKTPLNWLD 296


>gi|319782927|ref|YP_004142403.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317168815|gb|ADV12353.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 322

 Score =  154 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 95/204 (46%), Positives = 133/204 (65%)

Query: 13  FLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQ 72
              I VGGTGLYFRAL   +S MP+IP  +R++ R +LK+ G+  LH  L   DS  A  
Sbjct: 107 RTAIFVGGTGLYFRALAEGISEMPDIPQRVRDRWRYELKEQGAVKLHSLLLREDSAAAMM 166

Query: 73  IHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRF 132
           + P+D QRI RALE+   SG+SI+E+  +   P I  +SAH ++I P+R+AL  RI +RF
Sbjct: 167 LKPTDSQRIVRALEVLDASGRSILEWQAERGQPLIDRQSAHFLVIEPDRAALVGRIDKRF 226

Query: 133 TQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYA 192
            QML+ GA+DE++ L  + L  +LP MKAIGVR++ A + G I + E ++R  IAT +Y+
Sbjct: 227 DQMLDKGALDEVKRLAALGLDPELPAMKAIGVRELQAAMAGGIGFPEAIERAKIATRQYS 286

Query: 193 KRQKTWLCHQFQADWIRISSIDDL 216
           KRQ TW  HQ   +W+R+   DDL
Sbjct: 287 KRQTTWFRHQLGPEWLRLHPGDDL 310


>gi|194365248|ref|YP_002027858.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia R551-3]
 gi|238693480|sp|B4SRA4|MIAA_STRM5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|194348052|gb|ACF51175.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Stenotrophomonas maltophilia R551-3]
          Length = 317

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 77/218 (35%), Positives = 113/218 (51%), Gaps = 7/218 (3%)

Query: 6   LQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSL 65
           +    +  +PI+ GGTGLYFRAL   LS MPE   A+R  +  +  + G   LH EL+ +
Sbjct: 90  VDIVARGKMPILAGGTGLYFRALLQGLSPMPEADPAMRAALAAEAAERGWAALHAELAQI 149

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IH +D QRI RALE+  ++G  I E+ ++     +P+ +   I+   +R+ L 
Sbjct: 150 DPAAATRIHATDPQRIQRALEVYRLTGTPITEWQRRPGVAPLPVRTLKLILAPHDRAVLH 209

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDE 179
           +RI  RF  ML  G +DE+R+L  M          DLP ++A+G R     L GE +   
Sbjct: 210 QRIEARFDAMLAQGFLDEVRALRAMPEMAAVEAPLDLPAVRAVGYRQAWEYLDGEGDAAR 269

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRIS-SIDDL 216
              + I AT + AKRQ TWL  +  A W       + L
Sbjct: 270 FRDKAIFATRQLAKRQLTWLRGELDARWFDPHIDQERL 307


>gi|297717900|gb|ADI50093.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Odyssella thessalonicensis L13]
          Length = 286

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 72/196 (36%), Positives = 120/196 (61%), Gaps = 5/196 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q  ++  +PI+VGGTGLY R+LT  +S +PEIP++IRE+ R   +       H+ + + D
Sbjct: 85  QLLERGRVPILVGGTGLYLRSLTSGISPIPEIPSSIREEARRLAQA---PSFHEIVFAFD 141

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            +V  ++  +D QR++RA E+K+ +G+SIIE+ ++            KI ++P RS L  
Sbjct: 142 PMVRGKLKENDRQRLSRAWEVKMATGRSIIEWQQEKSQAL--PYEFQKIALVPARSWLHN 199

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  RF  M+  GA++E+++L    L  D P+++A+GV+++   L G+   ++ ++   I
Sbjct: 200 RINARFDLMMSQGALEEVQALKARPLRPDSPLLRAVGVKELSDYLNGQTTLEQAIELAKI 259

Query: 187 ATNKYAKRQKTWLCHQ 202
           AT +YAKRQ TWL  Q
Sbjct: 260 ATRQYAKRQLTWLRGQ 275


>gi|152979929|ref|YP_001352151.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Janthinobacterium sp. Marseille]
 gi|166198913|sp|A6SV54|MIAA_JANMA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|151280006|gb|ABR88416.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Janthinobacterium sp. Marseille]
          Length = 314

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 106/210 (50%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP++VGGT LYF+ L   L  +P+   A+R ++  +    G   +H +L++LD
Sbjct: 89  EISARGKLPLLVGGTMLYFKGLKDGLDALPQADAALRAELDAEAAAIGYPAMHAKLAALD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I A ++ P+D QRI RALEI  ++GQ +     QAP   +P       +   +RS L  
Sbjct: 149 PITAERLKPNDSQRIQRALEIIALTGQPMSALLAQAPKTELPFTLLPIALEPSDRSVLHT 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF  ML+ GA+ +    ++    L   LP M+ +G R     L G  +  E  +RG
Sbjct: 209 RIATRFDAMLKGGALLDEVKALRARGDLHLGLPSMRCVGYRQSWEYLDGAYSLAELRERG 268

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           I AT + AKRQ TWL        I   + D
Sbjct: 269 IAATRQLAKRQLTWLRSMDDRHIIDCLAPD 298


>gi|307243865|ref|ZP_07525990.1| tRNA dimethylallyltransferase [Peptostreptococcus stomatis DSM
           17678]
 gi|306492687|gb|EFM64715.1| tRNA dimethylallyltransferase [Peptostreptococcus stomatis DSM
           17678]
          Length = 318

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/211 (25%), Positives = 100/211 (47%), Gaps = 4/211 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIM-PEIPTAIREKIREKLKQYGSHILHDELSSL 65
             + +   PII GGTGLY  ++   +     +    IR+++ + L++ G   L+  L  +
Sbjct: 89  DIHSRGKFPIITGGTGLYLNSILFDMDFGQSQADPQIRKELEDILQERGLDYLYSLLEDI 148

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
               A++IH ++ +R+ RA+EI    G                   AH +++  +RS L 
Sbjct: 149 SPETAKRIHKNNAKRVIRAIEIFKSGGSLGDF---SNDLKPNEKYQAHIVVLNRDRSHLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M + G +DE++ L +   + D+  MK IG ++++    G I+ ++      
Sbjct: 206 DRINYRVDLMFDQGLLDEVKDLHERGYTKDMTSMKGIGYKEVLDYFDGLISLEDAKNSIK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            ++ +YAKRQ TW      A W+ +  +  +
Sbjct: 266 QSSRRYAKRQITWFKRYPHALWLNLDEVKSI 296


>gi|163814088|ref|ZP_02205480.1| hypothetical protein COPEUT_00241 [Coprococcus eutactus ATCC 27759]
 gi|158450537|gb|EDP27532.1| hypothetical protein COPEUT_00241 [Coprococcus eutactus ATCC 27759]
          Length = 316

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/214 (28%), Positives = 108/214 (50%), Gaps = 2/214 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHD 60
           L      Y +  +P++VGGTG Y +AL   ++    +   + RE+++    ++G+  +HD
Sbjct: 83  LEAMKDIYSRGKIPVVVGGTGFYIQALLYDINFEDNDNDMSYREELQTLAAEHGNSYIHD 142

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
            L+ +D   A +IH ++ +R+ RALE    +G  I E  +       P    + ++   +
Sbjct: 143 MLAGVDPESAEKIHENNVKRVIRALEFYKKTGTKISEHNEAESQKESPYNFEYFVLND-D 201

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           R  L +RI RR   MLE G +DE++SL+    S DL  M+ +G +++I  ++     DE 
Sbjct: 202 RQKLYDRIDRRIDIMLEDGLLDEVKSLVDEGYSRDLVSMQGLGYKEMIDYIQERYTLDEA 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           +      T  +AKRQ TW   + Q  W+  +  D
Sbjct: 262 VYTLKRDTRHFAKRQVTWFKREKQVTWVNKNEFD 295


>gi|114330407|ref|YP_746629.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           eutropha C91]
 gi|122314569|sp|Q0AJ07|MIAA_NITEC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114307421|gb|ABI58664.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosomonas
           eutropha C91]
          Length = 317

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/203 (33%), Positives = 112/203 (55%), Gaps = 1/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              +  +P++VGGT LYF+ L   L+ +P    A+R+++ +  ++ G   +H  LS LD 
Sbjct: 94  ITARGRIPLLVGGTMLYFKVLQQGLATLPAADEAVRKELEQSAREQGWPAMHTVLSRLDP 153

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           ++A +I P+D QRI RALE+  ++G+ +    KQ  +   P    +  ++  +RS L  R
Sbjct: 154 VIAERIKPNDSQRIQRALEVCYLTGRPMSAVLKQQQSRDFPYRVFNIALLPGDRSVLHAR 213

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSL-DLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF +MLE G +DE+R +        D+P M+ +G R +   L+ EI+  E  +RG+ 
Sbjct: 214 ISQRFDKMLEIGLVDEVRMIRDQFQVTADMPAMRCVGYRQVYMYLENEISLAEMRERGVF 273

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
           AT + AKRQ TWL    +     
Sbjct: 274 ATRQLAKRQLTWLRAMNELHGFD 296


>gi|296188726|ref|ZP_06857113.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           carboxidivorans P7]
 gi|296046653|gb|EFG86100.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           carboxidivorans P7]
          Length = 312

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 63/217 (29%), Positives = 107/217 (49%), Gaps = 3/217 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           M  K+++    +  LP++VGGTGLY  +L               R+ +    +  G   +
Sbjct: 79  MAEKEIECITSENKLPMLVGGTGLYINSLIYNYDFTEASTDYEYRQYLHNLAETKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H  L  +D     +++P+D +R+ RALE+  ++G++I EF  +     IP    + ++  
Sbjct: 139 HSLLKEVDVQSFNRLYPNDLKRVIRALEVYKLTGKTISEFNLENDIYDIPYNVYYFVLT- 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L ERI  R   ML++G I+E++ L +M  S ++  MK IG ++I+  L  +I+ D
Sbjct: 198 MNREKLYERINMRVDIMLKNGLIEEVKKLKEMAYSAEMQSMKGIGYKEILYYLDNKISLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           E +      +  YAKRQ TW     +  WI     +D
Sbjct: 258 EAVYSIKKGSRNYAKRQLTWFRKDKRVIWIDKDKFND 294


>gi|49186561|ref|YP_029813.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Sterne]
 gi|49478337|ref|YP_037779.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|52141773|ref|YP_085055.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           E33L]
 gi|165872766|ref|ZP_02217393.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0488]
 gi|167636071|ref|ZP_02394377.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0442]
 gi|167639803|ref|ZP_02398072.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0193]
 gi|170689300|ref|ZP_02880495.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0465]
 gi|170706857|ref|ZP_02897315.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0389]
 gi|177652115|ref|ZP_02934661.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0174]
 gi|196044474|ref|ZP_03111709.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           03BB108]
 gi|225865688|ref|YP_002751066.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           03BB102]
 gi|227813387|ref|YP_002813396.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. CDC 684]
 gi|228916344|ref|ZP_04079913.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228928761|ref|ZP_04091795.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228935012|ref|ZP_04097842.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228947376|ref|ZP_04109667.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229092743|ref|ZP_04223885.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-42]
 gi|229123229|ref|ZP_04252433.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           95/8201]
 gi|229603470|ref|YP_002867953.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0248]
 gi|254683580|ref|ZP_05147440.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. CNEVA-9066]
 gi|254721138|ref|ZP_05182929.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A1055]
 gi|254735748|ref|ZP_05193454.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Western North America USA6153]
 gi|254739553|ref|ZP_05197248.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Kruger B]
 gi|254751122|ref|ZP_05203161.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Vollum]
 gi|254759439|ref|ZP_05211464.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Australia 94]
 gi|61214005|sp|Q636W2|MIAA_BACCZ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|61214118|sp|Q6HF97|MIAA_BACHK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811012|sp|C3L886|MIAA_BACAC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811013|sp|C1ENE7|MIAA_BACC3 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|259495762|sp|C3P4Y4|MIAA_BACAA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49180488|gb|AAT55864.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Sterne]
 gi|49329893|gb|AAT60539.1| tRNA isopentenylpyrophosphate transferase
           (isopentenyl-diphosphate:tRNA isopentenyltransferase)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|51975242|gb|AAU16792.1| tRNA isopentenylpyrophosphate transferase
           (isopentenyl-diphosphate:tRNA isopentenyltransferase)
           [Bacillus cereus E33L]
 gi|164711444|gb|EDR16994.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0488]
 gi|167512204|gb|EDR87581.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0193]
 gi|167528583|gb|EDR91345.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0442]
 gi|170128275|gb|EDS97144.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0389]
 gi|170666758|gb|EDT17526.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0465]
 gi|172082484|gb|EDT67549.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0174]
 gi|196024509|gb|EDX63181.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           03BB108]
 gi|225789291|gb|ACO29508.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           03BB102]
 gi|227007718|gb|ACP17461.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. CDC 684]
 gi|228660005|gb|EEL15641.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           95/8201]
 gi|228690632|gb|EEL44411.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock3-42]
 gi|228812229|gb|EEM58559.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228824582|gb|EEM70384.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228830846|gb|EEM76449.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228843254|gb|EEM88333.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229267878|gb|ACQ49515.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. A0248]
          Length = 317

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|229185941|ref|ZP_04313112.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BGSC 6E1]
 gi|228597493|gb|EEK55142.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BGSC 6E1]
          Length = 317

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|326202166|ref|ZP_08192036.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           papyrosolvens DSM 2782]
 gi|325987961|gb|EGD48787.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           papyrosolvens DSM 2782]
          Length = 308

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/226 (24%), Positives = 112/226 (49%), Gaps = 10/226 (4%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +    +    PI+ GGTGLY  +L   ++    E    +RE ++++ +++G   L
Sbjct: 79  LAEKYIDNILENGKQPIVAGGTGLYISSLINNINFSESESDWELREALKKEAEEFGPEYL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H +L  +D   A  IHP++ +R+ RALE+   + +  I +  +      P      + + 
Sbjct: 139 HKKLQEVDPNSALSIHPNNIKRVIRALEVYYQTQKP-ISYHNEISRSIPPKYQFVLVGLN 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L ERI +R   M+++G +DE++ L+ +  +  +  M+ IG ++I+  L+  I  +
Sbjct: 198 MDRQVLYERINKRVDIMIQNGLVDEVKRLVDLGYADSIISMQGIGYKEILEFLRNNITLE 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS-------IDDLF 217
           + +      T +YAKRQ TW       +W  + +       I++++
Sbjct: 258 QAIDNIKQGTRRYAKRQITWFKRIHGINWFNVDNCGNNINVINEIY 303


>gi|222097169|ref|YP_002531226.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Q1]
 gi|229197821|ref|ZP_04324537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           m1293]
 gi|239977198|sp|B9IUM7|MIAA_BACCQ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|221241227|gb|ACM13937.1| tRNA isopentenylpyrophosphate transferase
           (isopentenyl-diphosphate:tRNA isopentenyltransferase)
           [Bacillus cereus Q1]
 gi|228585539|gb|EEK43641.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           m1293]
          Length = 317

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|261406196|ref|YP_003242437.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. Y412MC10]
 gi|261282659|gb|ACX64630.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. Y412MC10]
          Length = 315

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/207 (29%), Positives = 103/207 (49%), Gaps = 3/207 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LP IVGGTGLY  ++               RE+      +YG+  LH +L+ +
Sbjct: 91  EITERGKLPFIVGGTGLYVESVCYGYQFSETGADEVFREEQFRYANEYGAEALHQKLAEV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A ++HP+D +R+ RALE+  V+G  +      AP           + +  +R  L 
Sbjct: 151 DPETAERLHPNDLRRVVRALEVFHVTGVPLSAQL--APQTKQSPYDLCLVGLTMDRQMLY 208

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R   ML  G +DE+ +LM    +  L  M+ +G ++I++ LKGE +Y+E +    
Sbjct: 209 NRIEERIDLMLSQGLVDEVAALMDKGFAPGLVSMQGLGYKEIVSYLKGEFSYEEAVVLLK 268

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
             T ++AKRQ +W  H    +W+ ++ 
Sbjct: 269 RDTRRFAKRQLSWFRHMKDIEWVDVTD 295


>gi|167771417|ref|ZP_02443470.1| hypothetical protein ANACOL_02783 [Anaerotruncus colihominis DSM
           17241]
 gi|167666057|gb|EDS10187.1| hypothetical protein ANACOL_02783 [Anaerotruncus colihominis DSM
           17241]
          Length = 317

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/211 (25%), Positives = 103/211 (48%), Gaps = 4/211 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
               +  +PI+ GGTGLY  A+   +         ++R ++  + + +G+  + + L ++
Sbjct: 93  DIAARGRVPILAGGTGLYIDAVIDNIDFSNIRSDESVRAELYAQAEAHGNEHMLEMLRAV 152

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D  +A  +HP++  RI RALE+  V+G  + E  +++       +     +   +R+ L 
Sbjct: 153 DPELAAALHPNNLGRILRALEVYRVTGVPMSEHQRRSRQTPERYDVCMIGLNFTDRAMLY 212

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +R+ RR   M+E G IDE R++           ++AIG +++I  L      +E + R  
Sbjct: 213 DRVNRRVDLMIERGLIDEARAVSA---VCRGTALQAIGYKELIPYLDAGAPLEECINRLK 269

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            +T +YAKRQ +W     +  W+ +   + L
Sbjct: 270 QSTRRYAKRQLSWFRRDARIVWLMVDKSESL 300


>gi|291563255|emb|CBL42071.1| tRNA isopentenyltransferase (miaA) [butyrate-producing bacterium
           SS3/4]
          Length = 325

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 101/209 (48%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y    +PII GGTG Y +AL   +     +     RE++     + G+  LHD L  +
Sbjct: 87  EIYAAGHIPIIAGGTGFYIQALVNDIDFTENDSDAGYREELECLAAEKGASCLHDMLKEV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE    +G  I E  +       P   A+ ++   +R  L 
Sbjct: 147 DPESAEAIHENNVKRVIRALEFYKKTGTKISEHNEAERQKESPYNFAYYVL-NMDRERLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI  R   M+++G + E+  L +M  + D+  M+ +G ++I+  L G I+ DE +    
Sbjct: 206 QRIDLRVDLMMKNGLLAEVEKLKEMGCTRDMVSMQGLGYKEILDALDGTISLDEAVYIIK 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T  +AKRQ TW   + +  W+   + D
Sbjct: 266 RDTRHFAKRQLTWFKREKEVTWVDQGNFD 294


>gi|331001791|ref|ZP_08325313.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           oral taxon 107 str. F0167]
 gi|330412765|gb|EGG92148.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           oral taxon 107 str. F0167]
          Length = 316

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/217 (29%), Positives = 114/217 (52%), Gaps = 3/217 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIP-TAIREKIREKLKQYGSHIL 58
           M+   + +  K+  LPIIVGGTG Y +++   +    E   T+IRE++  + +  G+  +
Sbjct: 81  MVKTAIKEITKRGHLPIIVGGTGFYIQSIIYDIDFDNEEDNTSIREELEREYESLGADYM 140

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           ++ L  +DSI A+ IH ++ +RI RA+E  +++   I    +   N   P       ++ 
Sbjct: 141 YERLKKIDSISAQNIHKNNKKRIIRAIEYFMINNAPISSHNEAQRNKISPY-DFRFFVLN 199

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
           P R  L ERI +R   M+E G + E++SL +M LS     M+ IG ++II  L+G+++ +
Sbjct: 200 PPRDILYERINQRVDIMVEKGLLKEVKSLKQMGLSKHNISMQGIGYKEIIEYLEGDVSLE 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             ++     T   AKRQ TW   +    +I   S ++
Sbjct: 260 TAIENIKQNTRHMAKRQVTWFKREKDVIYIDPYSFEN 296


>gi|169830747|ref|YP_001716729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|239977365|sp|B1I295|MIAA_DESAP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|169637591|gb|ACA59097.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 310

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/205 (29%), Positives = 102/205 (49%), Gaps = 2/205 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              ++ +P++VGGTGLY R++             +R +++E  + YG   LH  L+ +D 
Sbjct: 90  ILGRKRVPLLVGGTGLYIRSVVEDYRFPVRADRRLRNRLQEAAELYGCARLHRHLAVVDP 149

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + AR++HP+D +RI RALE+   SG     +  +      P        +  ER  L  R
Sbjct: 150 VTARRLHPNDQRRIIRALEVYYQSGIPFSRYPDR--RDRAPKYLPVMFGLNMERGRLYRR 207

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I  R   M+ +G + E++SL++     +L  MK +G ++I A L+G +  +E +      
Sbjct: 208 IEDRVDAMIRAGLVREVQSLLEKGYGPELVAMKGLGYKEIAAHLRGSLTLEEAIHILKRN 267

Query: 188 TNKYAKRQKTWLCHQFQADWIRISS 212
           T ++AKRQ TW     Q  W+ +  
Sbjct: 268 TRRFAKRQLTWFRRDEQIRWLDVEE 292


>gi|311695391|gb|ADP98264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine
           bacterium HP15]
          Length = 397

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 118/241 (48%), Gaps = 29/241 (12%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +      +P++VGGT +YF+AL   +S +P     +R  + ++ ++ G   LH+E
Sbjct: 83  LTAMAEITAAGRIPLLVGGTMMYFKALLHGMSGLPSASPDVRRALEQEAEERGWEALHEE 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-------------- 107
           L + D + A +IHP++ QR+ RALE+  ++G+ I EFW+                     
Sbjct: 143 LRASDPVAAERIHPNNRQRLMRALEVLRLTGKPISEFWRADQGACEQTTAVAQVGDIEDY 202

Query: 108 --------------PLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLS 153
                         P       +  PER  L ERIR RF +MLESG +DE+R+LM  +  
Sbjct: 203 TYFTRWQADETSLLPYTVIQLAMTPPERRVLHERIRLRFLKMLESGFVDEVRALMIRDDL 262

Query: 154 LDL-PIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
               P M+ +G R   + L GE +Y+  + +G+ AT + AKRQ TWL      DW+    
Sbjct: 263 HPDLPSMRCVGYRQAWSYLSGEDDYETFVSKGVAATRQLAKRQLTWLRKWSDVDWLDSGD 322

Query: 213 I 213
            
Sbjct: 323 K 323


>gi|118478937|ref|YP_896088.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis str. Al Hakam]
 gi|239977197|sp|A0RH88|MIAA_BACAH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|118418162|gb|ABK86581.1| tRNA isopentenylpyrophosphate transferase
           (isopentenyl-diphosphate:tRNA isopentenyltransferase)
           [Bacillus thuringiensis str. Al Hakam]
          Length = 320

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 88  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 147

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 148 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 205

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 206 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 264

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 265 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 300


>gi|39935099|ref|NP_947375.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris CGA009]
 gi|61214141|sp|Q6N874|MIAA_RHOPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|39648950|emb|CAE27471.1| tRNA isopentenyltransferase [Rhodopseudomonas palustris CGA009]
          Length = 321

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 84/204 (41%), Positives = 120/204 (58%), Gaps = 1/204 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LPI++GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH EL+  D   A 
Sbjct: 107 GRLPILIGGTGLYFKALTRGLSAVPPVPAEVRDAVRLRLDRDGVQALHAELARQDPEAAA 166

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           ++ P+D  RIARALE+ L +G+ + ++ +Q   P +P +    + + P+R AL  RI  R
Sbjct: 167 RLAPADRTRIARALEVVLATGRPLADWHQQTSPPLLPPDDVVAVFLAPDREALYARIDSR 226

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML+ GA+DE+ +L +  L   LP MKA GV  +I  L+GEI  +E    G   T  Y
Sbjct: 227 FAAMLQGGALDEVAALAERQLDPLLPAMKAHGVPALIRHLRGEITLEEAASIGAADTRHY 286

Query: 192 AKRQKTWLCHQ-FQADWIRISSID 214
           AKRQ TW  HQ  +  W+R    D
Sbjct: 287 AKRQFTWFRHQLPEFKWVRPEEAD 310


>gi|294500852|ref|YP_003564552.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           megaterium QM B1551]
 gi|294350789|gb|ADE71118.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           megaterium QM B1551]
          Length = 316

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 114/213 (53%), Gaps = 5/213 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           ++ K++   + +  +P+IVGGTGLY +++              +RE++   +K +G   L
Sbjct: 83  IVRKQIDDIHARGKMPMIVGGTGLYIQSVIYDYQFTETPSDEKVRERMEVFIKAHGIDPL 142

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           +++L  +D   A  IH ++ +R+ RALE+  V+G+   ++ K+       L     I + 
Sbjct: 143 YEKLKEIDPDSAAAIHKNNHRRVIRALEVYEVTGKKFSDYTKEQSQEL--LYDVSIIGLT 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L ERI  R   M+++G +DE++SL +     D+  ++AIG +++ A  +G    +
Sbjct: 201 MDRDVLYERINHRVDMMMQAGLLDEVKSLYESG-LHDVQSIQAIGYKELYAYFEGRCTLE 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           E +++    + +YAKRQ TW  ++    WI++ 
Sbjct: 260 EAVEQLKQNSRRYAKRQLTWFRNKMPVKWIKME 292


>gi|65321039|ref|ZP_00393998.1| COG0324: tRNA delta(2)-isopentenylpyrophosphate transferase
           [Bacillus anthracis str. A2012]
          Length = 434

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 88  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 147

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 148 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 205

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 206 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 264

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 265 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 300


>gi|217961138|ref|YP_002339706.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH187]
 gi|229140357|ref|ZP_04268912.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST26]
 gi|226704719|sp|B7HKR9|MIAA_BACC7 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|217065155|gb|ACJ79405.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH187]
 gi|228642918|gb|EEK99194.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST26]
          Length = 317

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|42782791|ref|NP_980038.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 10987]
 gi|61214193|sp|Q733B9|MIAA_BACC1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|42738718|gb|AAS42646.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 10987]
          Length = 317

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 105/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE + +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREHMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|51892885|ref|YP_075576.1| tRNA isopentenylpyrophosphate transferase [Symbiobacterium
           thermophilum IAM 14863]
 gi|61214050|sp|Q67NL1|MIAA_SYMTH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|51856574|dbj|BAD40732.1| tRNA isopentenylpyrophosphate transferase [Symbiobacterium
           thermophilum IAM 14863]
          Length = 319

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 63/209 (30%), Positives = 109/209 (52%), Gaps = 4/209 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           Q   +  LP++VGGTGLY RA+  + +  P E    +R ++R++ +++G   LH  L  +
Sbjct: 87  QICARGRLPMLVGGTGLYVRAVVEKYTFTPMEADHELRARLRQEEERHGPGYLHARLREV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A ++HP+D  RI RALE+   +G  I     Q      P      I +  +R+ L 
Sbjct: 147 DPASAARLHPNDLLRIVRALEVYEQTGVPISA--TQTAAFSEPRYDDLMIGLTMDRAQLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R   ML +G +DE+R L  +     +  M+A+G R+++  L+G + ++E +    
Sbjct: 205 ARIDERVDAMLAAGWLDEVRGL-LVRYPPHVRAMQALGYRELVLYLRGLLTWEEAVALIK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             T ++AKRQ TW   + +  W+ ++  +
Sbjct: 264 RNTRRFAKRQFTWFRKERRLTWLDLTGPE 292


>gi|30263717|ref|NP_846094.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Ames]
 gi|47778220|ref|YP_020479.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|46576980|sp|Q81JG8|MIAA_BACAN RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|30258361|gb|AAP27580.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. Ames]
 gi|47551925|gb|AAT32954.2| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis str. 'Ames Ancestor']
          Length = 314

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 82  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 141

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 142 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 199

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 200 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 258

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 259 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 294


>gi|317056653|ref|YP_004105120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruminococcus
           albus 7]
 gi|315448922|gb|ADU22486.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ruminococcus
           albus 7]
          Length = 315

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 104/217 (47%), Gaps = 4/217 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHIL 58
           +  K + +   +  LPI+ GGTGLY  +L   +          IR ++ +++K+ G+H L
Sbjct: 83  LAGKVIREVTSRGKLPIVCGGTGLYISSLVDNIIFDDTGSDPVIRARLEKQVKEDGAHAL 142

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
             +L  +D   A ++H ++  R+ RA+E+  ++G  + E    +     P  S    +  
Sbjct: 143 WLKLKEIDPETAEKVHENNLPRVIRAIEVFELTGIKLSEHKINSRREASPYHSCIIGLTA 202

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             R  L +RI +R   M+++G ++E R              +AIG ++++   +G+    
Sbjct: 203 ENRQYLYDRIEKRVHIMVDNGMVEECREAWLKGGLATAG--QAIGYKELVPYFEGKAELG 260

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
           + + + II T  YAKRQ TW        W++I + D+
Sbjct: 261 DCIDKIIIETRHYAKRQLTWFRRVDSISWVKIDNFDE 297


>gi|323705360|ref|ZP_08116935.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535262|gb|EGB25038.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 316

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/215 (27%), Positives = 105/215 (48%), Gaps = 5/215 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
             +K+R LPI+VGGTGLY  +L   ++    I     R  ++      G+  L + L  +
Sbjct: 87  DIFKRRKLPIVVGGTGLYVDSLIYIMNFSEYIGNDDFRSALKNIASVLGNEYLFERLKMI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWK-QAPNPFIPLESAHKIIILPERSAL 124
           D     ++HP+D +R+ RALE+   +G  I  + +           +    +    R  L
Sbjct: 147 DPKTYSKLHPNDLRRVIRALEVYQFTGIPISVYQELSNKRINPDYNTVMIGLNYRNRETL 206

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            ++I  R   M+++  IDE+ +L+K+  +     M+A+G ++I+  L+G+++ +E +   
Sbjct: 207 YKKIDDRVDAMIKNNLIDEVVNLLKIGYNKYGTSMQALGYKEIVEYLEGKVSLEEAIADL 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWI---RISSIDDL 216
              T +YAKRQ TW       +W      SS +DL
Sbjct: 267 KTKTRRYAKRQITWFKSYETINWFYVDDYSSFEDL 301


>gi|144899624|emb|CAM76488.1| tRNA isopentenyltransferase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 312

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/198 (35%), Positives = 108/198 (54%), Gaps = 1/198 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +++  LP++VGGTGLY R L   +S  P IP  IR   R  L + G+   H EL+  D
Sbjct: 87  EAWEQGRLPVVVGGTGLYIRTLMHGISPAPPIPDEIRAHTRALLAEMGNAAFHAELAKRD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            ++A ++ P++ QR+ARA E+   SGQS+  +        +P       +  P R+ L  
Sbjct: 147 PVMAARLDPANSQRLARAWEVLEASGQSLAHWQSLPMEGAVPARWLTLAL-DPPRNILYA 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
               RF  M+  GA+DE+R+L+ ++L   LP MKA+GV ++  L  G +   + ++    
Sbjct: 206 HCDHRFRAMMAQGALDEVRALLDLHLDPALPAMKALGVPELARLAGGTMTEIQAVEAAQR 265

Query: 187 ATNKYAKRQKTWLCHQFQ 204
           AT  YAKRQ TW  HQ +
Sbjct: 266 ATRNYAKRQLTWFRHQLE 283


>gi|120555681|ref|YP_960032.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           aquaeolei VT8]
 gi|239977409|sp|A1U4C6|MIAA_MARAV RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|120325530|gb|ABM19845.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           aquaeolei VT8]
          Length = 347

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 74/237 (31%), Positives = 116/237 (48%), Gaps = 25/237 (10%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   +   +  +P++VGGT +YF+AL   +S +P    A+R +I  + ++ G   LH+E
Sbjct: 92  LAAMSEISGRGRIPLLVGGTMMYFKALLHGMSNLPSANQALRAEIEREAERDGWGALHEE 151

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-------------- 107
           L+  D   AR IHP++ QR+ RA+E+  ++ + I  FW+                     
Sbjct: 152 LAEKDPDAARLIHPNNRQRLMRAIEVIRLTDKPISSFWQSESGTSGQHPQSGIEDYTYFT 211

Query: 108 ----------PLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDL 156
                     P       +   ERS L  RI++RF  MLE+G +DE+R+LM     S DL
Sbjct: 212 SWQADESAGLPYTVFQFALAPAERSVLHSRIQKRFLAMLEAGFLDEVRALMARGDLSPDL 271

Query: 157 PIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           P M+ +G R     L G  +YD  + +G+ AT + AKRQ TWL       W+  +  
Sbjct: 272 PSMRCVGYRQAWDYLSGNEDYDSFVAKGVAATRQLAKRQLTWLRKWRDVHWLDSADP 328


>gi|157964546|ref|YP_001499370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           massiliae MTU5]
 gi|239977444|sp|A8F1N7|MIAA_RICM5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|157844322|gb|ABV84823.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Rickettsia
           massiliae MTU5]
          Length = 363

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/200 (33%), Positives = 106/200 (53%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
            K  +   +  LPI++GGTGLY  +L    + +P+I   +RE++R    + G+  L  +L
Sbjct: 138 EKIKEITDRGKLPILIGGTGLYINSLVFGYNNIPDISEDLREQVRNLHAKIGNIELWGKL 197

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
             LD + A +I+ +D QR+ RA E+ + + +SI  F        +P  +   I + PER 
Sbjct: 198 EKLDPLAASKINQNDTQRLIRAYEVFMQTNKSIFSFQTLPKEQILPDFNFKIIFLNPERK 257

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L +    R  ++ + GAIDEI  + K     D    KA+G+++I+A L G +  DE L 
Sbjct: 258 FLYKTCDERLDKIFKEGAIDEIALIKKQFAPKDYTNWKAVGIKEILAYLNGNLTLDEALN 317

Query: 183 RGIIATNKYAKRQKTWLCHQ 202
              I T +YAKRQ TW  +Q
Sbjct: 318 AAQIRTRQYAKRQVTWFKNQ 337


>gi|160892636|ref|ZP_02073426.1| hypothetical protein CLOL250_00166 [Clostridium sp. L2-50]
 gi|156865677|gb|EDO59108.1| hypothetical protein CLOL250_00166 [Clostridium sp. L2-50]
          Length = 313

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/215 (28%), Positives = 104/215 (48%), Gaps = 3/215 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQYGSHIL 58
           + +K +   Y +  +P+IVGGTG Y +A+   +           R  + +  +++G+  L
Sbjct: 79  LATKAMDDIYARGRIPVIVGGTGFYIQAVLYDIHFDENDDDKSYRTYLEQLAEKHGNLCL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H  L  +D   A  IH ++ +R+ RALE    +G  I E  ++      P    + ++  
Sbjct: 139 HQMLEKVDPASAATIHYNNRKRVIRALEFYKETGIPISEHNEKESKRISPYNFEYFVLND 198

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
             RS L +RI RR   M+E G I+E+++L     + DL  M+ +G ++I+  L G  + D
Sbjct: 199 A-RSKLYDRIDRRIDIMVEQGLIEEVKALKDQGYTKDLISMQGLGYKEILDYLDGVTSLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E L      T  +AKRQ TW   + +  W+  S  
Sbjct: 258 EALYILKRDTRHFAKRQITWFKREKEVTWVDKSEF 292


>gi|237795207|ref|YP_002862759.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum Ba4 str. 657]
 gi|259495763|sp|C3KX33|MIAA_CLOB6 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229261775|gb|ACQ52808.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum Ba4 str. 657]
          Length = 311

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 105/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKDIWSRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLSEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  ++
Sbjct: 139 HSLLKDIDEKSYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFVL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|312111555|ref|YP_003989871.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y4.1MC1]
 gi|311216656|gb|ADP75260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           Y4.1MC1]
          Length = 315

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/219 (26%), Positives = 111/219 (50%), Gaps = 11/219 (5%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +  ++  LP+IVGGTGLY +++             A R ++R+  +  G   L+D L ++
Sbjct: 87  EISERGRLPMIVGGTGLYIQSVIYDYRFSAAPSDEAYRRQLRQIAEDKGEMALYDMLKAV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP + +R+ RALEI   +G+++ E+          L  A  I +  +R  L 
Sbjct: 147 DPESAARIHPHNIRRVIRALEIYYCTGKTMTEWQ--QGQTKKLLYDAAIIGLTMKREQLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  +ML  G ++E ++L    +     + +AIG +++ A  +G ++ +E +++  
Sbjct: 205 RRINERVDKMLAEGLLEEAKALYDRGIRNCQSV-QAIGYKELFAYFEGRVSLEEAIEQLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI-------DDLF 217
             + +YAKRQ TW  +Q    W  ++ +       +++F
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVQWFDMTDMAKFDEKAEEIF 302


>gi|239623994|ref|ZP_04667025.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522025|gb|EEQ61891.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 319

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 101/218 (46%), Gaps = 6/218 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQY---GS 55
           M  + L+  Y    +PII GGTG Y +AL   +        + +R ++ E   +      
Sbjct: 80  MAKEALEEIYSHHRIPIIAGGTGFYIQALLYDIDFKENDDESLVRRELEELAAREGEAAP 139

Query: 56  HILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI 115
            +LH  L  +D   A +IH ++ +R+ RA+E   ++G+ I    ++      P    + +
Sbjct: 140 AVLHAMLEEIDPESAARIHANNVKRVIRAIEYYRLTGERISVHNQEERVKESPYNFLYYV 199

Query: 116 IILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEI 175
           +   +R  L  RI RR  QM+E+G ++E+++L  M        M+ +G ++I+  L G  
Sbjct: 200 V-NTQRPVLYGRIDRRVDQMMENGLVEEVQALKAMGCHRGQTSMQGLGYKEILDYLDGRC 258

Query: 176 NYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
             DE +      T  +AKRQ TW   +    W+ +   
Sbjct: 259 TLDEAVYILKRDTRHFAKRQLTWFKRERDVRWLNLPDF 296


>gi|301055203|ref|YP_003793414.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           anthracis CI]
 gi|300377372|gb|ADK06276.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           biovar anthracis str. CI]
          Length = 317

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGNAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|153954201|ref|YP_001394966.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           kluyveri DSM 555]
 gi|219854809|ref|YP_002471931.1| hypothetical protein CKR_1466 [Clostridium kluyveri NBRC 12016]
 gi|189081948|sp|A5N8I7|MIAA_CLOK5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|254811016|sp|B9E1Z2|MIAA_CLOK1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|146347082|gb|EDK33618.1| MiaA [Clostridium kluyveri DSM 555]
 gi|219568533|dbj|BAH06517.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 309

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 111/215 (51%), Gaps = 3/215 (1%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K ++  Y +   P++VGGTGLY  +L         ++    R  +    K  G   +
Sbjct: 79  LAEKTIEDIYSRNKFPMLVGGTGLYINSLICNYDFTDAKVDVNYRNYLENLAKVQGREYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H  L  +D++   +++P+D +R+ RALE+  ++G++I EF  +     IP +  + ++  
Sbjct: 139 HSLLKDIDAVSYERLYPNDLKRVVRALEVHKLTGKTIGEFNSKDSLYDIPYKIYYFVL-N 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L ERI +R   M+E G IDE+++L  M  + D+  MK IG +++I  L+G+I+ D
Sbjct: 198 MDRVKLYERINKRVDLMIEQGLIDEVKNLRSMGYTKDMQSMKGIGYKELIRYLEGDISLD 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           E +      +  YAKRQ TW     +  W+     
Sbjct: 258 EAVYLIKKGSRNYAKRQLTWFRKDERVIWVNKDEF 292


>gi|300310167|ref|YP_003774259.1| tRNA delta2-isopentenylpyrophosphate transferase [Herbaspirillum
           seropedicae SmR1]
 gi|300072952|gb|ADJ62351.1| tRNA delta2-isopentenylpyrophosphate transferase protein
           [Herbaspirillum seropedicae SmR1]
          Length = 315

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP++VGGT LYF+ L   L  +P+   A+R ++ E+  + G   +H  L+ LD
Sbjct: 91  EIIARGRLPLLVGGTMLYFKVLRDGLDELPQADPALRAQLDEEAARVGMPAMHARLAELD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A ++ P+D QRI RALEI L++GQ +     Q P   +P+      +   ER+ L +
Sbjct: 151 PVTAARLKPNDSQRIQRALEISLLTGQPMSALLAQKPAEPLPMRLLPLALEPSERAILHD 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLD--LPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF  ML  G ++     ++    L   LP M+ +G R +   L G I+     ++G
Sbjct: 211 RIALRFDLMLRDGGLEREVRALRARGDLHLGLPSMRCVGYRQMWEYLDGSIDAAAMREKG 270

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           I AT + AKRQ TWL    +   I  +  +
Sbjct: 271 IAATRQLAKRQLTWLRSMPERISIDCNRPE 300


>gi|315634030|ref|ZP_07889319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           segnis ATCC 33393]
 gi|315477280|gb|EFU68023.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Aggregatibacter
           segnis ATCC 33393]
          Length = 314

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/210 (33%), Positives = 116/210 (55%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +   +  +P++VGGT LY++AL   LS +P     +R +I  K    G   LH E
Sbjct: 87  LREMQEISAQGKIPLLVGGTMLYYKALLEGLSPLPSADDKVRSEIEAKAALIGWGGLHQE 146

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D I A++I+P+D QRI RALE+  ++G+++ +   Q     +P +     I   +R
Sbjct: 147 LSKIDPISAQRINPNDSQRINRALEVFYLTGKTLTQLTAQ-KGEALPYDILQFAIAPEQR 205

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L  RI +RF +M+E G   E+     + +L+ +LP ++ +G R +   L+G+ ++DE 
Sbjct: 206 EVLHLRIEQRFHKMIELGFQQEVEKLYRRPDLNENLPSIRCVGYRQMWEYLRGDYDHDEM 265

Query: 181 LQRGIIATNKYAKRQKTWLCHQ-FQADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 266 VFRGICATRQLAKRQITWLRGWTSPIQWLD 295


>gi|295706198|ref|YP_003599273.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           megaterium DSM 319]
 gi|294803857|gb|ADF40923.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           megaterium DSM 319]
          Length = 316

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/213 (26%), Positives = 113/213 (53%), Gaps = 5/213 (2%)

Query: 1   MLSKKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           ++ K++   + +  +P+IVGGTGLY +++              +RE++   +K +G   L
Sbjct: 83  IVRKQIDDIHARGKMPMIVGGTGLYIQSVIYDYQFTETPSDEKVRERMEVFIKAHGIDPL 142

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           +++L  +D   A  IH ++ +R+ RALE+  V+G+   ++ K+       L     I + 
Sbjct: 143 YEKLKEIDPDSAAAIHKNNHRRVIRALEVYEVTGKKFSDYTKEQSQEL--LYDVSIIGLT 200

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L +RI  R   M+++G +DE++SL +     D+  ++AIG +++ A  +G    +
Sbjct: 201 MDRDVLYDRINHRVDMMMQAGLVDEVKSLYESG-LHDVQSIQAIGYKELYAYFEGRCTLE 259

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           E +++    + +YAKRQ TW  ++    WI + 
Sbjct: 260 EAVEQLKQNSRRYAKRQLTWFRNKMPVKWIEME 292


>gi|240146294|ref|ZP_04744895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseburia
           intestinalis L1-82]
 gi|257201598|gb|EEU99882.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Roseburia
           intestinalis L1-82]
          Length = 318

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/204 (29%), Positives = 102/204 (50%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y    +PII GGTG Y +AL   +    +      R ++ +  +++G+  LH  L  +
Sbjct: 88  EIYADGKIPIIAGGTGFYIQALLYDIDFTEQQCDETYRRQLEDLAREHGAEYLHGILREV 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE   +SG+ I E  +       P   A+ ++   ER+ L 
Sbjct: 148 DPASAEAIHANNIKRVIRALEFYQLSGKKISEHNETERQKQSPYNFAYFVLTD-ERAKLY 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR   M+E+G ++E++ L     S ++  M+ +G ++I+A L G    +E +    
Sbjct: 207 ERIDRRVDAMIEAGLVEEVKKLKSKGCSREMVSMQGLGYKEILAYLDGGCTLEEAVYIIK 266

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
             T  +AKRQ TW   +    W+ 
Sbjct: 267 RETRHFAKRQLTWFKRERDVIWLD 290


>gi|251796618|ref|YP_003011349.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. JDR-2]
 gi|247544244|gb|ACT01263.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. JDR-2]
          Length = 335

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/205 (28%), Positives = 103/205 (50%), Gaps = 3/205 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
               +  LP IVGGTGLY  ++             A R++     +++G+  LH  L+ +
Sbjct: 95  DISARGKLPFIVGGTGLYVESVCYGFEFNENGSDPAFRDEQERYAEEHGAEALHARLAEV 154

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A ++HP+D +RI RALEI  +SG+ +    ++             I +  +R  L 
Sbjct: 155 DPKSAERLHPNDQRRIIRALEIFHLSGEMMSAQLERQKKES--PYELCIIGLTMDRKVLY 212

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI +R  QMLE G ++E+R L+   ++ D   M+ +G ++I+  L+G+   +  ++   
Sbjct: 213 SRIEQRVDQMLEDGLVEEVRGLLDRGVTEDSLAMQGLGYKEIVMYLRGDCTLEAAVELLK 272

Query: 186 IATNKYAKRQKTWLCHQFQADWIRI 210
             T ++AKRQ +W  H    +WI +
Sbjct: 273 RDTRRFAKRQLSWFRHMKDIEWIDM 297


>gi|319407473|emb|CBI81123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella sp.
           1-1C]
          Length = 291

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 76/206 (36%), Positives = 125/206 (60%), Gaps = 1/206 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K L     + L I VGGTGLYFRAL   +S +P+IP   ++K R +L++ G   L+ +
Sbjct: 82  VEKLLNIVTSKSL-IFVGGTGLYFRALLEGISEIPDIPDVCQQKWRHRLQEEGVENLYRQ 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D+ ++++I   DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R
Sbjct: 141 LLQVDAELSKRICAQDGQRIIRALEVYDVTGKTLSWWQKQETKSLIAKDCSEKILLIPPR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L E I +R  +M+E G ++E+  + ++ LS  LP MKAIG+ + IA L G ++++  +
Sbjct: 201 QQLYENINKRLDRMVEQGVLEEVLIIKQLMLSPLLPAMKAIGLPEFIAYLDGYLSFENAI 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADW 207
           +     T +YAKRQ TW  +Q   +W
Sbjct: 261 ETAKTKTRRYAKRQMTWFRNQLNEEW 286


>gi|297538673|ref|YP_003674442.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           sp. 301]
 gi|297258020|gb|ADI29865.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylotenera
           sp. 301]
          Length = 313

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/200 (32%), Positives = 110/200 (55%), Gaps = 2/200 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +P++VGGT LYF+AL   LS +PE    +R ++ ++    G   +H++L+ +D
Sbjct: 89  DITARGKIPLLVGGTMLYFKALQEGLSGLPEANQEVRARLDKRAAFIGWPAMHEKLALVD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A ++ P+D QRI RALE+  ++G+++   + +  +  +P +     ++  +R  L E
Sbjct: 149 PVTAARLEPNDTQRIQRALEVFELTGEAMSALYAKQTSEVLPYKLLKIALVPSDRKVLHE 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNL--SLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
           RI  RF QML+ G +DE++ L+      + +   M+ +G R  +  L GE +  E   RG
Sbjct: 209 RIAIRFDQMLKDGFVDEVKVLIAKYPSLTPESTSMRCVGYRQALEHLAGEYDLAELRDRG 268

Query: 185 IIATNKYAKRQKTWLCHQFQ 204
           I AT + AKRQ TWL     
Sbjct: 269 IFATRQLAKRQLTWLRGMDD 288


>gi|304316823|ref|YP_003851968.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778325|gb|ADL68884.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 308

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 104/209 (49%), Gaps = 2/209 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
             YK+  LPI+VGGTGLY  +L   ++    I     R  ++   +  G+  L + L  +
Sbjct: 87  DIYKRGRLPIVVGGTGLYIDSLIYIMNFSDYIGNDDFRSALKNIAEVLGNDYLFNRLKVV 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSAL 124
           D  +  ++HP+D +RI RALE+   +G+ I  + + +     P      I +   +R+ L
Sbjct: 147 DPKMFDKLHPNDLRRIIRALEVYQFTGKPISVYQELSSKRMNPEYDVIMIGLNFRDRNKL 206

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            +RI  R   ML++  ++E+ +L+K+  +     M+A+G ++I   L G + +DE +   
Sbjct: 207 YKRIDDRVDIMLKNNLVNEVVNLLKIGYNKYDTSMQALGYKEIAEYLDGNVTFDEAISNL 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSI 213
              T +YAKRQ TW       +W  +   
Sbjct: 267 KKRTRRYAKRQITWFKSYKIINWFYVDDY 295


>gi|23015778|ref|ZP_00055545.1| COG0324: tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 317

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 116/206 (56%), Gaps = 2/206 (0%)

Query: 1   MLSKKLQR-YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
           M + ++Q  + +  LPI+ GGTGLY +A+   LS +P+IP +IR + R  L + G+   H
Sbjct: 85  MATGEIQAAWNEGKLPILTGGTGLYLKAVMEGLSPIPDIPESIRAEARALLAEMGNAAFH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           + L+  D ++A ++   + QR+ARA E+ + +G+S+ E+  +     +       ++  P
Sbjct: 145 NRLAKHDPLMAERLDSGNSQRLARAWEVIMATGRSLAEWQDEPRQGAVAARWFTMVL-DP 203

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
            R  L  +   RF  M+ +GA+DE+R+   + L+ DLPI KA+G R++ A L GE   D 
Sbjct: 204 PRPRLYAQCESRFRAMVAAGALDEVRAFEALGLAHDLPIQKALGRRELAAHLAGETGLDA 263

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQA 205
            +     AT  YAKRQ TW  HQ  A
Sbjct: 264 AIADACQATRNYAKRQGTWFRHQMMA 289


>gi|310658534|ref|YP_003936255.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Clostridium sticklandii DSM 519]
 gi|308825312|emb|CBH21350.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Clostridium sticklandii]
          Length = 308

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/213 (28%), Positives = 97/213 (45%), Gaps = 4/213 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQYGSHILHDE 61
            K      +  +PIIVGGTGLY  ++  ++      P   IR +    L + G   L+  
Sbjct: 84  EKIEDILSRGKVPIIVGGTGLYINSIVFEMDFNNSAPDTGIRNQYNTILLEQGPEYLYSI 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+  +   A  IHP++ +R+ RAL    +          +          +   I+  ER
Sbjct: 144 LAKKNPEAANSIHPNNTKRVIRAL---EILDSKDDFSNFENAQNKYSKYDSKIYILSLER 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
           S L  RI  R   M+ +G +DE++ L+   L+     MKAIG R II+ L  +++ D+ +
Sbjct: 201 SILYNRINSRVDTMINNGLVDEVKDLLSKGLTNQHQSMKAIGYRQIISYLTNDLSLDDAV 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSID 214
                 + +YAKRQ TW      A W+ + S D
Sbjct: 261 DLIKRDSRRYAKRQFTWFKKYKDAKWLDVESQD 293


>gi|229915864|ref|YP_002884510.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium
           sp. AT1b]
 gi|259495766|sp|C4L1B9|MIAA_EXISA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|229467293|gb|ACQ69065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Exiguobacterium
           sp. AT1b]
          Length = 311

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/205 (29%), Positives = 99/205 (48%), Gaps = 8/205 (3%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
             Y +  LPIIVGGTGLY R++      +   +  A+RE++    +  G   LH  L  L
Sbjct: 88  DIYARGKLPIIVGGTGLYIRSILYDYEFVERPVDEALREELERLAEVEGREALHQRLVQL 147

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IHP++ +R+ RALE+ +              +           ++  +R  L 
Sbjct: 148 DPERAATIHPNNVRRVVRALEVAMQGDTQT------TDSAPSEHYDYRLFVLHADREILY 201

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI +R   M+E+G ++E+  L+          M+AIG ++II  ++G+I+ D       
Sbjct: 202 DRINQRVDAMMEAGLVEEVERLLAQGYRDTQA-MRAIGYKEIIPYVEGKISKDRATDLLK 260

Query: 186 IATNKYAKRQKTWLCHQFQADWIRI 210
             T ++AKRQ TW  HQF   W+ +
Sbjct: 261 QHTRQFAKRQLTWFRHQFDGIWVDM 285


>gi|218885281|ref|YP_002434602.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|239977369|sp|B8DNS7|MIAA_DESVM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218756235|gb|ACL07134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfovibrio
           vulgaris str. 'Miyazaki F']
          Length = 337

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/203 (31%), Positives = 101/203 (49%), Gaps = 2/203 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGTGLY + L   ++ +P +  AI  ++  +    G+  LH  L+S+D   A 
Sbjct: 121 GLVPLLVGGTGLYLKTLLDGIADIPRVDPAIGARLERECDALGAPALHARLASIDPDYAA 180

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           +IHP+D QR  RALE+   +G ++  +  +      P  +A +I +      L  R+ RR
Sbjct: 181 RIHPNDRQRAVRALEVHEGTGHALSWWHAR--PVPRPRYAALRIGMDMSLDELTPRLDRR 238

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
              MLE+GA+DE R+   +      P    IG  ++   L GE+ + E     +  T  Y
Sbjct: 239 IDLMLEAGALDEARAARTVCDDPAAPGWSGIGCAELYRYLTGELPWAEARLLWLRNTRAY 298

Query: 192 AKRQKTWLCHQFQADWIRISSID 214
           AKRQ TW     +  W+R   +D
Sbjct: 299 AKRQLTWFRADKRIHWVRPDDLD 321


>gi|295135072|ref|YP_003585748.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zunongwangia
           profunda SM-A87]
 gi|294983087|gb|ADF53552.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Zunongwangia
           profunda SM-A87]
          Length = 306

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 93/213 (43%), Gaps = 5/213 (2%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           +K  + +KK  + ++VGG+G+Y +++   L   PEI   IRE + E L Q G   L ++L
Sbjct: 84  AKISELFKKHEIVVMVGGSGMYVKSILEGLDDFPEIDPQIREHLNESLAQNGLQSLQEQL 143

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
             LD     +    +  R+ RALEI + +G+    F  +            +I +  +R 
Sbjct: 144 KKLDPEYYEKADMENPHRVIRALEICIGTGKKFSSFLNKKKQQR--NFDIIEIGLTADRQ 201

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            + +RI  R   M++ G + E + L           M  +G +++      EI  +  + 
Sbjct: 202 KIYDRINLRVDLMMQEGLLAEAKQLYPKRQL---NAMNTVGYKELFRYFDQEIELEFAIS 258

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
                T ++AKRQ TW        W   ++  +
Sbjct: 259 EIKKNTRRFAKRQLTWFRKNNNIHWFDYTTKPE 291


>gi|212703402|ref|ZP_03311530.1| hypothetical protein DESPIG_01445 [Desulfovibrio piger ATCC 29098]
 gi|212673147|gb|EEB33630.1| hypothetical protein DESPIG_01445 [Desulfovibrio piger ATCC 29098]
          Length = 304

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 113/215 (52%), Gaps = 2/215 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +++      +  +P++VGGTGLYF+ L   ++ +P I  AI   +  +L + G   LH E
Sbjct: 84  VAEAKAVLARGHVPLLVGGTGLYFQGLLHGIAEIPAIDPAITAALTARLAEEGPAALHAE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L++ D   A +IHP+D QRI RALE+   +G +   + +       P  +   +++  E 
Sbjct: 144 LAASDPAYAARIHPNDRQRIVRALEVLAGTGHTFSWWHEH--GMPEPPCAGPLLVLDMEL 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
            AL  R+ RR   MLE GA+DE R+  +       P    IG  +++A L+GE++ +E  
Sbjct: 202 DALTPRLARRIDLMLEQGALDEARAARQRCDDAAAPGWSGIGCAEVLAHLRGELSLEECR 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +  +  T  YAKRQ+TW   + +A +     +D L
Sbjct: 262 RLWLHNTRAYAKRQRTWFRARGEARFFAPQDLDGL 296


>gi|329924176|ref|ZP_08279376.1| tRNA dimethylallyltransferase [Paenibacillus sp. HGF5]
 gi|328940826|gb|EGG37138.1| tRNA dimethylallyltransferase [Paenibacillus sp. HGF5]
          Length = 315

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/213 (28%), Positives = 105/213 (49%), Gaps = 6/213 (2%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILH 59
           +++K  +   +  LP IVGGTGLY  ++               RE+      ++G+  LH
Sbjct: 88  LIAKITE---RGKLPFIVGGTGLYVESVCYGYQFSETGADEVFREEQFRYANEHGAEALH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L+  D   A ++HP+D +R+ RALE+  V+G  +      AP           + +  
Sbjct: 145 QKLAEADPETAERLHPNDLRRVVRALEVFHVTGVPLSAQL--APQTKQSPYDLCLVGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L  RI  R   ML  G +DE+ +LM    +  L  M+ +G ++I++ LKGE +Y+E
Sbjct: 203 DRQMLYNRIEERIDLMLSQGLVDEVAALMDKGFAPGLVSMQGLGYKEIVSYLKGEFSYEE 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISS 212
            +      T ++AKRQ +W  H    +W+ ++ 
Sbjct: 263 AVVLLKRDTRRFAKRQLSWFRHMKDIEWVDVTD 295


>gi|239826717|ref|YP_002949341.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           WCH70]
 gi|239807010|gb|ACS24075.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus sp.
           WCH70]
          Length = 315

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 58/219 (26%), Positives = 108/219 (49%), Gaps = 11/219 (5%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LP+IVGGTGLY +++             A R  +R+  +  G  +L++ LS++
Sbjct: 87  EISGRGRLPMIVGGTGLYIQSVIYDYRFSDAPSDEAYRRHLRQIAEDKGEMVLYEMLSAI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A +IHP + +R+ RALEI   +G+++ E+ +        L     I +  +R  L 
Sbjct: 147 DPESAARIHPRNIRRVIRALEIYHCTGKTMTEWQRGQTKKL--LYDVAIIGLTMKREQLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  QM+  G ++E ++L    +     + +AIG +++     G ++ +E ++R  
Sbjct: 205 RRINERVDQMIAEGLLEEAKALYDRGIRDCQSV-QAIGYKELYDYFDGHVSLEEAIERLK 263

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS-------IDDLF 217
             + +YAKRQ TW  +Q    W  ++         +++F
Sbjct: 264 QNSRRYAKRQLTWFRNQMPVQWFDMTDAAKFDEKAEEIF 302


>gi|319408799|emb|CBI82456.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           schoenbuchensis R1]
          Length = 291

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 84/197 (42%), Positives = 125/197 (63%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P IP AIREK R +L + G+  L+ EL  +D+++  +I P
Sbjct: 95  IFVGGTGLYFRALLEGISKIPSIPDAIREKWRMRLYKEGAESLYRELLQVDAVLCEKIAP 154

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+   +G+ +  + K+     I  + + KI+++P R  L ERI  RF  M
Sbjct: 155 QDGQRIVRALEVYESTGKRLSWWQKKKTKSLIAQDCSEKILLIPPRQLLYERINERFNHM 214

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+ ++ K+ LS  LP MKAIGVR+++A L G  ++++ ++   + T +YAKRQ
Sbjct: 215 VERGVLEEVIAMKKLMLSPLLPAMKAIGVRELMAYLDGYKSFEDAIEEAKMQTRRYAKRQ 274

Query: 196 KTWLCHQFQADWIRISS 212
            TW  +QF   W  I S
Sbjct: 275 MTWFNNQFDDKWNLIYS 291


>gi|226312956|ref|YP_002772850.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus
           brevis NBRC 100599]
 gi|226095904|dbj|BAH44346.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus
           brevis NBRC 100599]
          Length = 319

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/207 (29%), Positives = 104/207 (50%), Gaps = 4/207 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
              ++  LP IVGGTGLY  ++T +           +R++++      G   LH  L+ +
Sbjct: 91  DINQRGRLPFIVGGTGLYIESVTHRFQFSTTSQDPELRDRLQRLADSEGVEALHARLADV 150

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D I A ++HP+D +R+ RALEI   SG  + +F  +A +    L     I +  +R+ L 
Sbjct: 151 DPITAERLHPNDVKRVIRALEIYESSGYKMSDFQLRAKHSPYDLVM---IGLTMDRAKLY 207

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI  R   M+E+G ++E+R L+       L  M+ +G +++I  L GEI  ++ +    
Sbjct: 208 ERINHRVELMIEAGLVEEVRGLLDAGYDASLVSMQGLGYKELIPYLYGEITLEKAVNDIQ 267

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISS 212
             T  +AKRQ +W     +  W  ++ 
Sbjct: 268 QRTRHFAKRQLSWFRRMEEIHWFDMTD 294


>gi|225419750|ref|ZP_03762053.1| hypothetical protein CLOSTASPAR_06088 [Clostridium asparagiforme
           DSM 15981]
 gi|225041617|gb|EEG51863.1| hypothetical protein CLOSTASPAR_06088 [Clostridium asparagiforme
           DSM 15981]
          Length = 316

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/209 (27%), Positives = 101/209 (48%), Gaps = 2/209 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLD 66
            Y +  +PI+ GGTG Y +AL   +     E  +AIR ++    +  G+  +H  L  +D
Sbjct: 88  IYSRGNIPIVAGGTGFYIQALLYDIDFKENEEGSAIRAELEALARSAGNLRVHAMLQEID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A QIHP++ +R+ RA+E    +G+ I    +       P    +  +   +RS L +
Sbjct: 148 PKAAGQIHPNNIKRVIRAIEYFRQTGEQISVHNEAERGKQSPYHFLYYAVT-TDRSLLYQ 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R  QM+E+G ++E+R L +      L  M+ +G ++I+  L G    +E +     
Sbjct: 207 RIDSRVDQMMENGLVEEVRRLKERGCHRGLTSMQGLGYKEILDYLNGACTLEEAVYVLKR 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            T  +AKRQ TW   +    ++ +   ++
Sbjct: 267 DTRHFAKRQLTWFKRERDVRFLNLPDFEN 295


>gi|196038384|ref|ZP_03105693.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           NVH0597-99]
 gi|196030792|gb|EDX69390.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           NVH0597-99]
          Length = 317

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 108/216 (50%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVGYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + +  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSDQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M++ G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DRKMLYDRINLRVDIMMDQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|160938813|ref|ZP_02086164.1| hypothetical protein CLOBOL_03707 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437776|gb|EDP15536.1| hypothetical protein CLOBOL_03707 [Clostridium bolteae ATCC
           BAA-613]
          Length = 319

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/218 (25%), Positives = 103/218 (47%), Gaps = 6/218 (2%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTA-IREKIREKLKQY---GS 55
           M  + L + Y    +P+I GGTG Y +AL   +       ++ +R ++    ++      
Sbjct: 80  MAKEALREIYSHGRIPVIAGGTGFYIQALLYDIDFKENEDSSPVRRELEALAEREGERAP 139

Query: 56  HILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI 115
            +LH  L  +D   A QIH ++ +R+ RA+E    +G+ I    +Q      P    + +
Sbjct: 140 QLLHAMLRQVDPEAAAQIHANNIKRVIRAIEYFRQTGEKISLHNQQEREKESPYNFLYYV 199

Query: 116 IILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEI 175
           +   +R+ L ERI RR   M+E G ++E+++L  M        M+ +G ++I+  L+G  
Sbjct: 200 L-NTDRALLYERIDRRVDLMMEQGLVEEVKALKDMGCRRGHTSMQGLGYKEILDYLEGRC 258

Query: 176 NYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           + DE +      T  +AKRQ TW   +    ++ +   
Sbjct: 259 SLDEAVYILKRDTRHFAKRQLTWFKRERDVRFLNLPDF 296


>gi|148553532|ref|YP_001261114.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           wittichii RW1]
 gi|148498722|gb|ABQ66976.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sphingomonas
           wittichii RW1]
          Length = 290

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 103/202 (50%), Gaps = 5/202 (2%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LPI+VGGTGLY R L   ++ +PEI  AIR ++R                + +     
Sbjct: 74  GKLPILVGGTGLYLRTLIFGIAPVPEIDPAIRAEVRA-----LPVEAAHAALAAEDPAMG 128

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            + P D  RIARALE+   +G+S+  +  +         +    I+LP R  L+ R   R
Sbjct: 129 HLRPQDATRIARALEVIRSTGRSLSHWQAELTGGIGGEIAVAAAIVLPPRDWLRARCDAR 188

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML+ GA++E++ L    L   LP M+AIGVR+I A   G I+ +  + +   AT +Y
Sbjct: 189 FEAMLDQGAVEEVKKLRARGLDPMLPAMQAIGVREIAAWQDGLIDRETMVAKAQAATRQY 248

Query: 192 AKRQKTWLCHQFQADWIRISSI 213
           AKRQ TW  HQ  A W RI + 
Sbjct: 249 AKRQYTWFRHQPPAAWQRIDTQ 270


>gi|223939700|ref|ZP_03631573.1| tRNA delta(2)-isopentenylpyrophosphate transferase [bacterium
           Ellin514]
 gi|223891657|gb|EEF58145.1| tRNA delta(2)-isopentenylpyrophosphate transferase [bacterium
           Ellin514]
          Length = 309

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 5/209 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  +PI  GGTGLYF+A    L   P    A+R +    L++     L  EL+ LD
Sbjct: 89  DIQGRGQIPIFCGGTGLYFKAYLEGLGEAPPADDALRAE----LEKTPLPELLKELAGLD 144

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP-ERSALK 125
            +   +I   + +R+ RA+E+  ++G+           P  P   A     L  E   L 
Sbjct: 145 PVTYDKIDCQNPRRVIRAVEVIRLTGKPFSAQRAAWAPPTTPHSQAPPFFALSRENQDLH 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  QM + G + E+++LM   L+ +   M+AIG R ++  L+GE +  ET++   
Sbjct: 205 SRINVRVDQMFQRGLVAEVKNLMSHGLAENKNAMQAIGYRQVVEHLRGEHSLPETIELVK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
           I T ++AKRQ TW   Q QA WI +++ +
Sbjct: 265 IRTRQFAKRQMTWFRRQAQAKWISVTTTN 293


>gi|192290632|ref|YP_001991237.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris TIE-1]
 gi|239977476|sp|B3QCV7|MIAA_RHOPT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|192284381|gb|ACF00762.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 301

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 83/204 (40%), Positives = 120/204 (58%), Gaps = 1/204 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LPI++GGTGLYF+ALT  LS +P +P  +R+ +R +L + G   LH EL+  D   A 
Sbjct: 87  GRLPILIGGTGLYFKALTRGLSAVPPVPAEVRDAVRLRLDRDGVQALHAELAGHDPEAAA 146

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           ++ P+D  RIARALE+ L +G+ + ++ +Q   P +P +    + + P+R AL  RI  R
Sbjct: 147 RLAPADRTRIARALEVVLATGRPLADWHQQTSPPLLPPDDVVAVFLAPDREALYARIDSR 206

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML+ GA++E+ +L +  L   LP MKA GV  +I  L+GEI  +E    G   T  Y
Sbjct: 207 FAAMLQGGALNEVAALAERQLDPLLPAMKAHGVPALIRHLRGEITLEEAASIGAADTRHY 266

Query: 192 AKRQKTWLCHQ-FQADWIRISSID 214
           AKRQ TW  HQ  +  W+R    D
Sbjct: 267 AKRQFTWFRHQLPEFKWVRPQEAD 290


>gi|114319733|ref|YP_741416.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122312369|sp|Q0AB61|MIAA_ALHEH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|114226127|gb|ABI55926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 317

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 76/213 (35%), Positives = 116/213 (54%), Gaps = 3/213 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L+   + +    +P++ GGT LYFRAL   LS +PE   A+R ++  +   +G   LHD 
Sbjct: 90  LAAIHEIHAAGRVPLLAGGTMLYFRALEHGLSELPEADPALRRRLEGEAAAHGWGALHDR 149

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+++D   A +IHP D QRI RALE+  ++GQS+ E   +A    +P      +++   R
Sbjct: 150 LAAVDPEAAARIHPHDAQRIQRALEVWELTGQSLSELQ-RAGRQRLPWPIGKWVLMPESR 208

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
             L  RI RRF QML  G IDE+ +   + +L   LP M+++G R +   L G  + +  
Sbjct: 209 GELHRRIARRFDQMLAQGFIDEVAALRQRPDLHRALPAMRSVGYRQVWDYLDGCYDRETL 268

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQAD-WIRISS 212
            +RGI AT ++AKRQ TWL  +     W+    
Sbjct: 269 RERGIAATRQFAKRQITWLRRERGVTAWLTPEQ 301


>gi|152978662|ref|YP_001344291.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           succinogenes 130Z]
 gi|239977180|sp|A6VN09|MIAA_ACTSZ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|150840385|gb|ABR74356.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Actinobacillus
           succinogenes 130Z]
          Length = 318

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 115/210 (54%), Gaps = 3/210 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +      +  +P++VGGT LY++AL   LS +P     IR +I  + +Q G  +LH E
Sbjct: 88  LREMTDITAQGKIPLLVGGTMLYYKALIEGLSPLPNADEKIRSEIEARAQQTGWAVLHQE 147

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D   A +I+P+D QRI RALE+  ++G+S+ E   Q     +P       I   +R
Sbjct: 148 LAKIDPASAARINPNDSQRINRALEVFYLTGKSLTELTAQ-KGDALPYNVLQFAIAPEDR 206

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKM-NLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           S L ERI  RF +M+E G   E+  L    +LS DLP ++ +G R +   L+G+  +DE 
Sbjct: 207 SILHERIELRFKKMVELGFKAEVEKLYARSDLSPDLPSIRCVGYRQMWEHLRGDYGFDEA 266

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIR 209
           + RGI AT + AKRQ TWL        W+ 
Sbjct: 267 IYRGICATRQLAKRQITWLRGWKTPIRWLN 296


>gi|293376442|ref|ZP_06622674.1| tRNA isopentenyltransferase [Turicibacter sanguinis PC909]
 gi|325845040|ref|ZP_08168356.1| tRNA dimethylallyltransferase [Turicibacter sp. HGF1]
 gi|292644951|gb|EFF63029.1| tRNA isopentenyltransferase [Turicibacter sanguinis PC909]
 gi|325488916|gb|EGC91309.1| tRNA dimethylallyltransferase [Turicibacter sp. HGF1]
          Length = 306

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 102/209 (48%), Gaps = 4/209 (1%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           +K  Q   +  +PIIVGGTGLY +++        E     +E   EK K + +  LH +L
Sbjct: 81  AKIDQIKSRGNMPIIVGGTGLYIKSVLYDYEFAGES--ETKEVDDEKYKDFDNESLHQKL 138

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
           + +D   A+ IHP++ +R+ RALEI   SG    E           +     I +  +R 
Sbjct: 139 AEVDEEAAKTIHPNNRKRVIRALEIFETSGVKKSE--MIQTQQHELIYDVALIGLTDDRD 196

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L +RI +R   M E+G ++E+R+L +  +      ++AIG +++     G  + +E  +
Sbjct: 197 VLYDRINKRVDVMFETGLVEEVRALFEAGIPQTAQSIRAIGYKELYDYFNGLTSLEECKE 256

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRIS 211
                + +YAKRQ TW  +Q    W ++ 
Sbjct: 257 LIKRNSRRYAKRQYTWFNNQMDVKWFKVD 285


>gi|239977569|sp|A5V3W0|MIAA_SPHWW RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 314

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/202 (35%), Positives = 103/202 (50%), Gaps = 5/202 (2%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LPI+VGGTGLY R L   ++ +PEI  AIR ++R                + +     
Sbjct: 98  GKLPILVGGTGLYLRTLIFGIAPVPEIDPAIRAEVRA-----LPVEAAHAALAAEDPAMG 152

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
            + P D  RIARALE+   +G+S+  +  +         +    I+LP R  L+ R   R
Sbjct: 153 HLRPQDATRIARALEVIRSTGRSLSHWQAELTGGIGGEIAVAAAIVLPPRDWLRARCDAR 212

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  ML+ GA++E++ L    L   LP M+AIGVR+I A   G I+ +  + +   AT +Y
Sbjct: 213 FEAMLDQGAVEEVKKLRARGLDPMLPAMQAIGVREIAAWQDGLIDRETMVAKAQAATRQY 272

Query: 192 AKRQKTWLCHQFQADWIRISSI 213
           AKRQ TW  HQ  A W RI + 
Sbjct: 273 AKRQYTWFRHQPPAAWQRIDTQ 294


>gi|331005122|ref|ZP_08328525.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC1989]
 gi|330421091|gb|EGG95354.1| tRNA delta(2)-isopentenylpyrophosphate transferase [gamma
           proteobacterium IMCC1989]
          Length = 323

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/211 (34%), Positives = 112/211 (53%), Gaps = 8/211 (3%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++    P++VGGT +YF AL   L+ MP    A R  I E+    G  +LH+EL+++D  
Sbjct: 92  HQAGRTPVLVGGTMMYFNALLKGLADMPATDLATRAAIEEEALVKGWSLLHEELAAVDPE 151

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA-------PNPFIPLESAHKIIILPER 121
            A QIHP+  QRIARAL +  +SG+ +  +  +         +     +     +I  ER
Sbjct: 152 SAAQIHPNHSQRIARALAVYRMSGKPMSVYRAEQLQQSPVDTHFSERYDVTQFALIPQER 211

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI RR+  MLE G  +E+  L +    SLDLP M+A+G R +   +    +YDE 
Sbjct: 212 ALLHQRIARRYEMMLEDGFEEEVTQLYQRGDLSLDLPSMRAVGYRQMWEYINKVYSYDEM 271

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           +++G+ AT + AKRQ TWL        + + 
Sbjct: 272 IEKGLAATRQLAKRQLTWLRGWEGLHRLEVD 302


>gi|51245782|ref|YP_065666.1| tRNA delta-2-isopentenylpyrophosphate transferase (TrpX)
           [Desulfotalea psychrophila LSv54]
 gi|61214074|sp|Q6ALW6|MIAA_DESPS RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|50876819|emb|CAG36659.1| probable tRNA delta-2-isopentenylpyrophosphate transferase (TrpX)
           [Desulfotalea psychrophila LSv54]
          Length = 314

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 106/210 (50%), Gaps = 1/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +  +P++ GGTGLY ++LT      P   +A+RE+++E+L   G   +H  L  LD
Sbjct: 90  EIHARGHIPLVTGGTGLYLQSLTKGFFEGPPSDSAVRERLQEELDNLGPEEMHARLEQLD 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A+++HP+D  R+ RALEI  ++G+   +   Q              +   +R  L +
Sbjct: 150 PLSAQRLHPNDSYRVMRALEIFAITGKPWSQLLSQHKPENQFANMLQIGLT-CDRPLLYD 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   ML++G  +E+R L+ M  S +L  M +IG + +   + G+  ++E       
Sbjct: 209 RINMRTQIMLDAGLEEEVRGLLDMGYSRELRSMGSIGYKHMANFIFGDWEFEEMKTLLAR 268

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T +YAKRQ TW        W +  S  ++
Sbjct: 269 DTRRYAKRQYTWFNKDEDLHWYQKESKAEI 298


>gi|295696241|ref|YP_003589479.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           tusciae DSM 2912]
 gi|295411843|gb|ADG06335.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           tusciae DSM 2912]
          Length = 311

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/202 (33%), Positives = 107/202 (52%), Gaps = 5/202 (2%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           ++    I+VGGTGLY ++LT  L   P       R+++R +  + G  +LH  L+ +D  
Sbjct: 89  QRGRWAIVVGGTGLYVKSLTHGLDFSPAGEDPGYRQELRARAAREGPEVLHRLLAEVDPE 148

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            AR++HP D +RI RALEI  ++G  +     +A      L       +  ER AL  RI
Sbjct: 149 TARRLHPHDVRRIIRALEIHHLTGLPMS----RAAGRRGSLIPFLMFGLTMEREALYRRI 204

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             R  QM++ G I E++ L++   S +L  M+AIG +++   L GE+  DE ++R    T
Sbjct: 205 NDRVIQMIKQGWIQEVQRLLERGYSRNLTSMQAIGYKELGDYLAGEMALDEAIERIQRGT 264

Query: 189 NKYAKRQKTWLCHQFQADWIRI 210
            +YAKRQ +W   Q    W+ +
Sbjct: 265 RRYAKRQWSWFRAQPVHQWLDV 286


>gi|167745629|ref|ZP_02417756.1| hypothetical protein ANACAC_00321 [Anaerostipes caccae DSM 14662]
 gi|317472768|ref|ZP_07932080.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerostipes
           sp. 3_2_56FAA]
 gi|167654941|gb|EDR99070.1| hypothetical protein ANACAC_00321 [Anaerostipes caccae DSM 14662]
 gi|316899760|gb|EFV21762.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerostipes
           sp. 3_2_56FAA]
          Length = 320

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/204 (29%), Positives = 106/204 (51%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
           + Y+K  +PI+VGGTG Y +AL   +    E      R+++++  ++ G+  LH  L+ +
Sbjct: 86  KIYEKGKIPIVVGGTGFYIQALLYDIDFSEEDADRGYRDRLKKLAEEKGNGYLHRMLAEV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A+ +H ++ +R+ RALE    +G  I    +Q           + ++   ER  L 
Sbjct: 146 DPESAQAVHENNIKRVIRALEFYEKTGTKISMHNEQERTKESRYNFVYFVLTH-ERKILY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI +R  +M+E+G IDE+R L     + D+  M+ IG +++   L+G+ +  ET +R  
Sbjct: 205 DRINQRVDRMIEAGLIDEVRQLACEGYTKDMVSMQGIGYKEVFDYLEGKQDLAETAERIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
             T  +AKRQ TW   + +   I 
Sbjct: 265 KDTRHFAKRQLTWFRREKEVTMIN 288


>gi|300113237|ref|YP_003759812.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           watsonii C-113]
 gi|299539174|gb|ADJ27491.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           watsonii C-113]
          Length = 314

 Score =  152 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 69/210 (32%), Positives = 112/210 (53%), Gaps = 1/210 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             K+  +P++VGGT LYF ALT  +S +P     +R  I  + +  G   LH  L+ LD 
Sbjct: 90  ISKRERIPLLVGGTMLYFHALTYGISPLPPADPEVRAAIDREAEMRGWKALHRRLAKLDP 149

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A++IH  D QRI RALE+  ++G+ + E    +    +P      I+   ER+ L  R
Sbjct: 150 MAAQRIHHHDPQRIQRALEVFQLTGRPLSELIANSREMVLPYRVIRLILAPAERTVLHSR 209

Query: 128 IRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML++G ++E++   M+ +LSL+   ++A+G R     L+G  +     ++ I 
Sbjct: 210 IEQRFRAMLKAGFLEEVKGLFMRPDLSLECASIRAVGYRQAWLYLQGRFSLPTMAEQAIS 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           AT + AKRQ TWL  +  A  +     D +
Sbjct: 270 ATRQMAKRQLTWLRREGNAIHVDPEEKDHV 299


>gi|197117369|ref|YP_002137796.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter
           bemidjiensis Bem]
 gi|239977141|sp|B5EGD5|MIAA1_GEOBB RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|197086729|gb|ACH38000.1| tRNA (N6-dimethylallyl-A37)-dimethylallyltransferase [Geobacter
           bemidjiensis Bem]
          Length = 306

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 62/203 (30%), Positives = 95/203 (46%), Gaps = 5/203 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++    I+VGGTGLY RAL   L   P     +R     +        L   LS +D
Sbjct: 92  DIERRGKRAIVVGGTGLYIRALLYGLVDSPTGDPELR----RQFDDVPGEELLRRLSLVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++HP+D  R+ RALE+   +G+ +  F  +     +  +     I   ER  L  
Sbjct: 148 PETAARLHPNDRVRLIRALEVYTQTGRPVSAFRSEHAFSDVHYQVLKMAIR-VERQELYR 206

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R  +MLE G ++E+R L+      +L  +++IG ++I A L GE+  DE +     
Sbjct: 207 RIDLRVEKMLEDGLVEEVRLLLAAGYGHELKALRSIGYKEITAYLAGEMTLDEAVTLIKR 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
            T +YAKRQ TW   +    W+ 
Sbjct: 267 DTRRYAKRQMTWFGKENDIYWLE 289


>gi|327439603|dbj|BAK15968.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Solibacillus
           silvestris StLB046]
          Length = 302

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 6/217 (2%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDEL 62
           K  +   +  +PIIVGGTGLY +++         E+    RE    +L+  G   +H +L
Sbjct: 86  KIEEIQARGKMPIIVGGTGLYVQSVLYDFQFAKQEVDETARENYYRELEVLGPEAMHAKL 145

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
             +D   A  IHP++ +R+ RA+E+  ++G S  E      +   PL +   I +  +R 
Sbjct: 146 VQMDPAAAASIHPNNTRRVIRAMEMAELAGVSRAEEQFNRGDI--PLYNHVIIGLDMDRE 203

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L ERI  R   M+E+G ++E+R+L +  +      +KAIG +++ A   G ++ +E ++
Sbjct: 204 KLYERINLRVDLMMEAGLVEEVRALYEGGIRDVQA-IKAIGYKELYAHFDGLVSLEEAVE 262

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWI--RISSIDDLF 217
           +    + +YAKRQ T+  ++ +  WI    + I  LF
Sbjct: 263 QIKQNSRRYAKRQLTYFRNKMEIAWIGNDWNKIKSLF 299


>gi|86144203|ref|ZP_01062539.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Leeuwenhoekiella blandensis MED217]
 gi|85829333|gb|EAQ47799.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Leeuwenhoekiella blandensis MED217]
          Length = 315

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/216 (25%), Positives = 98/216 (45%), Gaps = 6/216 (2%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K  Q +KK  + I+VGG+GLY  A+   L   P++   IR  +  +L+  G   L  +
Sbjct: 99  IQKLEQLFKKHDVVIMVGGSGLYVDAVINGLDKFPDVDPEIRTSLLAQLEADGIEALQRQ 158

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L +LD     +I   + QR+ RALEI + +G+    F   A N         KI +  +R
Sbjct: 159 LQTLDPEHYEKIDLHNKQRLVRALEICIGTGKPYSSFL--AKNTIKRPFQTLKIGLQADR 216

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             + +RI RR   M++ G I E  +L           ++ +G R++ +    + + +  +
Sbjct: 217 QLIYDRINRRVDLMIKKGLIAEAEALYPKKEL---NALQTVGYRELFSYFAEDFDLETAI 273

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS-SIDDL 216
           +     T ++AKRQ TW        W       +++
Sbjct: 274 EEIKKNTRRFAKRQLTWYRKDESIVWFEYDTPFEEI 309


>gi|168184855|ref|ZP_02619519.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum Bf]
 gi|182672045|gb|EDT84006.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           botulinum Bf]
          Length = 311

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/212 (28%), Positives = 105/212 (49%), Gaps = 3/212 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE + +  +  G   +
Sbjct: 79  LAEKSIKDIWSRGKLPIIAGGTGLYINSLIYNYDFTDADRDEKYREYLTKLSEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+          + +  ++
Sbjct: 139 HSLLKDIDEKSYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYDIPYNVNYFVL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++++  L G+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMGKGLIEEVKKLESMGYTPDMQSMKGIGYKEVLFYLNGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIR 209
           DE +      +  YAKRQ TW     ++ WI 
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWID 290


>gi|74317530|ref|YP_315270.1| tRNA isopentenyltransferase [Thiobacillus denitrificans ATCC 25259]
 gi|123731795|sp|Q3SIR0|MIAA_THIDA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|74057025|gb|AAZ97465.1| tRNA isopentenyltransferase [Thiobacillus denitrificans ATCC 25259]
          Length = 313

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 72/208 (34%), Positives = 116/208 (55%), Gaps = 2/208 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              +  +P++VGGT LYFRAL   L  +P    A+R+++ +   + G   LH EL++LD 
Sbjct: 92  ITARGRVPLLVGGTMLYFRALLQGLDDLPRADAALRKRLEQDAAERGWPALHAELAALDP 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A ++ P+D QRI RALEI  ++G+ +     Q P   +P +     ++  +R+AL  R
Sbjct: 152 ATAARLAPNDSQRIGRALEIVELTGRPMSAQLAQTPR-ALPYDVLQLALVPSDRAALHRR 210

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I  RF  MLE+G +DE+  L + ++    +P M+A+G R   A L G+I+ +   ++G+ 
Sbjct: 211 IGERFDAMLEAGLVDEVEMLRRNHVLDSTMPAMRAVGYRQAWAYLDGDIDLEALREQGVA 270

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
           AT + AKRQ TWL     A  +   + D
Sbjct: 271 ATRQLAKRQLTWLRSWPGAVTLDCLADD 298


>gi|71082713|ref|YP_265432.1| tRNA isopentenyltransferase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|123647562|sp|Q4FPN1|MIAA_PELUB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71061826|gb|AAZ20829.1| tRNA isopentenyltransferase [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 313

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 2/212 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K     KK+ +PI+VGGTGLYF++L   L  +PEIP   R K+R   K+ G    + +
Sbjct: 84  IKKIENIQKKKKIPILVGGTGLYFQSLINGLVKIPEIPLKFRNKVRLMSKKEGQKKFYKK 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  LD  +  +  P+D QR  RA EIK  +  S+ ++  +  + F       K+ I  +R
Sbjct: 144 LLKLDPKIKDKFDPNDTQRSIRAYEIKSYTNISMYDWLAKTKSEFND-SDFLKLHIDTKR 202

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L E+I  R + ML +GAI E++  +K+ +  D  + K IG+ ++   L  EI  DE  
Sbjct: 203 EKLVEKINLRTSSMLNNGAISEVKKFLKLKIKKDQSVNKVIGIAELTQYLNDEITLDEAE 262

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           +   I T +YAKRQ TW   +  + WI++  I
Sbjct: 263 ELISIKTRQYAKRQATWARTRMTS-WIKVDPI 293


>gi|33591484|ref|NP_879128.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           pertussis Tohama I]
 gi|33603033|ref|NP_890593.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           bronchiseptica RB50]
 gi|46576931|sp|Q7U366|MIAA_BORPE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|46576933|sp|Q7U383|MIAA_BORBR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33568664|emb|CAE34422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           bronchiseptica RB50]
 gi|33571126|emb|CAE40623.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           pertussis Tohama I]
          Length = 313

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 3/211 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +  +P++ GGT LY++AL   L  +P+   A+R ++  +  + G   LH EL+ LD
Sbjct: 88  EIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIILPERSAL 124
              A ++ P+D QRI RALEI  ++GQ +    +  +  +   P       +   ER+AL
Sbjct: 148 PATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAAL 207

Query: 125 KERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
             RI +RF  ML +G ++E+R L  + +L   LP ++ +G R + + L G+I+ D   ++
Sbjct: 208 HARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQ 267

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           G+ AT + AKRQ TWL  Q +   I   + D
Sbjct: 268 GVAATRQLAKRQLTWLRAQPERVIIDCLAGD 298


>gi|33598140|ref|NP_885783.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           parapertussis 12822]
 gi|46576932|sp|Q7U372|MIAA_BORPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|33566698|emb|CAE38908.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bordetella
           parapertussis]
          Length = 313

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 69/211 (32%), Positives = 116/211 (54%), Gaps = 3/211 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + + +  +P++ GGT LY++AL   L  +P+   A+R ++  +  + G   LH EL+ LD
Sbjct: 88  EIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWK--QAPNPFIPLESAHKIIILPERSAL 124
              A ++ P+D QRI RALEI  ++GQ +    +  +  +   P       +   ER+AL
Sbjct: 148 PATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAAL 207

Query: 125 KERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQR 183
             RI +RF  ML +G ++E+R L  + +L   LP ++ +G R + + L G+I+ D   ++
Sbjct: 208 HARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQ 267

Query: 184 GIIATNKYAKRQKTWLCHQFQADWIRISSID 214
           G+ AT + AKRQ TWL  Q +   I   + D
Sbjct: 268 GVAATRQLAKRQLTWLRAQPERVIIDCLAGD 298


>gi|296108343|ref|YP_003620044.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|295650245|gb|ADG26092.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 305

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD
Sbjct: 79  EIIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLD 138

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L E
Sbjct: 139 PVTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHEQPDYYFVNLALFPEQRSWLHE 197

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI
Sbjct: 198 RIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPAMRCVGYRQILEYLAGHYDYETMREKGI 257

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL H   A +  
Sbjct: 258 AATRQLAKRQLTWLRHWEGALFYD 281


>gi|320105514|ref|YP_004181104.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Terriglobus
           saanensis SP1PR4]
 gi|319924035|gb|ADV81110.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Terriglobus
           saanensis SP1PR4]
          Length = 306

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 59/203 (29%), Positives = 102/203 (50%), Gaps = 1/203 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
             + +   PI+ GGTGLY RAL   LS +P     +R+++R  ++++G   LH  LS +D
Sbjct: 88  DLHSRGKTPIVAGGTGLYLRALLDGLSPVPPRDEELRKRLRHSVQRHGDAHLHSLLSRID 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IH +D  ++ RA+EI L+  + +   +  AP   +      KI + P R+ L +
Sbjct: 148 PKAAARIHANDQSKLLRAVEISLLERRPLSAQFHAAPPEPLKEFRIVKIGLTPPRAILYQ 207

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           R+  R  +M  +G ++E RSL+      D   + ++G    +A + G + +++ +     
Sbjct: 208 RLDTRAAEMFTNGLVEETRSLIA-RYGKDCRALTSLGYTQAVAEINGTLTHEQAVASAQQ 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
               YAKRQ TW   +    WI 
Sbjct: 267 GHRNYAKRQLTWFRAEPDIHWIE 289


>gi|229162646|ref|ZP_04290605.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           R309803]
 gi|228620818|gb|EEK77685.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           R309803]
          Length = 317

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R+ L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DRAMLYDRINLRVDLMMEQGLLEEVEGLYNRGVRDCQS-IQAIGYKEIYDYFENRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVMWFDVTDGEK 297


>gi|61213984|sp|Q5ZS23|MIAA_LEGPH RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 313

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD
Sbjct: 87  EIIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L E
Sbjct: 147 PVTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHERPDYYFVNLALFPEQRSWLHE 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI
Sbjct: 206 RIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILQHLAGHYDYETMREKGI 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL H   A +  
Sbjct: 266 AATRQLAKRQLTWLRHWEGALFYD 289


>gi|56963949|ref|YP_175680.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           clausii KSM-K16]
 gi|61213965|sp|Q5WFY6|MIAA_BACSK RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|56910192|dbj|BAD64719.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           clausii KSM-K16]
          Length = 310

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 65/214 (30%), Positives = 111/214 (51%), Gaps = 9/214 (4%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSLD 66
              +   P++VGGTGLY +ALT +LS       ++ RE++     ++G+  LH +L+  D
Sbjct: 89  IRSRGKWPLLVGGTGLYVQALTHELSFGDAPSDSSFREEMELYASRFGNAALHGKLAKAD 148

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  IH ++ +R+ RALE+  ++G+    F +Q      P      I +  ER AL E
Sbjct: 149 PNAAEAIHANNVRRVIRALEVIHLTGKP---FSEQENGLARPRFDNVLIGLEMERQALYE 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI RR   M+E+G ++E+  L +  +      ++AIG +++ A   G+  YDE ++    
Sbjct: 206 RINRRVDAMMEAGLLEEVHRLYQRGIQG--QAIQAIGYKELYAYFDGKCTYDEAIEALKT 263

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID---DLF 217
            + +YAKRQ TW  ++  A W  +   +    +F
Sbjct: 264 NSRRYAKRQLTWFKNRSDAVWFHLEEPEAKAKIF 297


>gi|54298687|ref|YP_125056.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Paris]
 gi|61213970|sp|Q5X1J2|MIAA_LEGPA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53752472|emb|CAH13904.1| hypothetical protein lpp2751 [Legionella pneumophila str. Paris]
          Length = 313

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD
Sbjct: 87  EIIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L E
Sbjct: 147 PVTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHVQPDYYFVNLALFPEQRSWLHE 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI
Sbjct: 206 RIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILEYLAGHYDYETMREKGI 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL H   A +  
Sbjct: 266 AATRQLAKRQLTWLRHWEGALFYD 289


>gi|148358567|ref|YP_001249774.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Corby]
 gi|166215132|sp|A5IAM8|MIAA_LEGPC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|148280340|gb|ABQ54428.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila str. Corby]
          Length = 313

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD
Sbjct: 87  EIIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L E
Sbjct: 147 PVTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHEQPDYYFVNLALFPEQRSWLHE 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI
Sbjct: 206 RIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPAMRCVGYRQILEYLAGHYDYETMREKGI 265

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL H   A +  
Sbjct: 266 AATRQLAKRQLTWLRHWEGALFYD 289


>gi|317498490|ref|ZP_07956784.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           bacterium 5_1_63FAA]
 gi|316894183|gb|EFV16371.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae
           bacterium 5_1_63FAA]
          Length = 320

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 61/214 (28%), Positives = 110/214 (51%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +P+IVGGTG Y ++L   +    E      R+++ EK K+ G+  L++ L  +
Sbjct: 86  EIYAKGKIPLIVGGTGFYIQSLLYDIDFTKEDGDQEYRKQLEEKAKREGNDSLYEMLKQV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D     +IH ++ +R+ RALE   ++G  I E  ++      P   A+ ++   +R  L 
Sbjct: 146 DPKSTEKIHKNNVKRVIRALEFYKLNGYPISEHNEKEAAKTSPYNFAYFVL-NHKRDILY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI RR   M+E G IDE++ L +      +  M+ IG R +   L+  ++ ++T+++  
Sbjct: 205 DRINRRVDIMVEQGLIDEVKRLKEEGYEKTMVSMQGIGYRQVFEYLEANLSLEDTIEQIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
             T  +AKRQ TW   + +   +  S   S D++
Sbjct: 265 KDTRHFAKRQLTWFGREKEVCMVDKSQFGSEDEI 298


>gi|218898811|ref|YP_002447222.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           G9842]
 gi|228902214|ref|ZP_04066375.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis IBL 4222]
 gi|226704717|sp|B7ISQ9|MIAA_BACC2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218544875|gb|ACK97269.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           G9842]
 gi|228857414|gb|EEN01913.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis IBL 4222]
          Length = 317

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 104/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|170750921|ref|YP_001757181.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|226704733|sp|B1M537|MIAA_METRJ RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|170657443|gb|ACB26498.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 308

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 78/201 (38%), Positives = 111/201 (55%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             LP+ VGGTGLYFRAL    S +P +P  +R ++R+  +   +  LH +L+  D   A 
Sbjct: 99  GRLPVFVGGTGLYFRALEQGFSELPPVPDTVRARVRDAAEGRPTEALHADLARHDPEGAA 158

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           ++ PSD  R+ RALEI L +G+ I  F+       +      +I + P+R+AL+ERI  R
Sbjct: 159 RLRPSDRMRVMRALEIFLATGRPIASFYGDPVPGPLAGRDLRRIFLAPDRAALRERIDAR 218

Query: 132 FTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKY 191
           F  M+  GA+DE+  L    L   LP+M+A GV  +IA L G ++ DE + RG   T  Y
Sbjct: 219 FRTMIAEGALDEVARLRARRLDPMLPVMRAHGVPGLIAHLDGALSLDEAIARGQADTRAY 278

Query: 192 AKRQKTWLCHQFQADWIRISS 212
           AKRQ TW  HQ    W  +  
Sbjct: 279 AKRQLTWFRHQMGEAWRWVDP 299


>gi|126666950|ref|ZP_01737926.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           sp. ELB17]
 gi|126628666|gb|EAZ99287.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           sp. ELB17]
          Length = 352

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 117/241 (48%), Gaps = 28/241 (11%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L++  +      +P++VGGT +YF+AL   +S +P     +R+++ ++ +  G   LH E
Sbjct: 95  LAEMAKITAAGRIPLLVGGTMMYFKALLHGMSDLPSANPRVRKQLVQEAQLQGWDALHQE 154

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFI-------------- 107
           L++ D + AR IHP++ QR+ RALE+  ++GQ I  FW+  P                  
Sbjct: 155 LAAADPVAARLIHPNNRQRLIRALEVLRLTGQPISSFWQAPPAVIANTPDTKPADNENYT 214

Query: 108 -------------PLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNL-S 153
                        P   +  ++   +R  L +RI +RF  ML++G + E+  LM      
Sbjct: 215 YFTGWQADAGSSLPYTISQLVVAPLQRQILHDRIYQRFLAMLDAGLLSEVEGLMARGDLE 274

Query: 154 LDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
             +P M+ +G R     L G+ ++   + +G+ AT + AKRQ TWL     A W+   + 
Sbjct: 275 PSMPSMRCVGYRQAWEYLSGQCDHTAFVDKGVAATRQLAKRQLTWLRKWPDALWLDSDNK 334

Query: 214 D 214
           D
Sbjct: 335 D 335


>gi|229191836|ref|ZP_04318807.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 10876]
 gi|228591598|gb|EEK49446.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 10876]
          Length = 317

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRVSLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  +++ + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEK 297


>gi|213962503|ref|ZP_03390765.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Capnocytophaga
           sputigena Capno]
 gi|213954829|gb|EEB66149.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Capnocytophaga
           sputigena Capno]
          Length = 303

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 56/210 (26%), Positives = 98/210 (46%), Gaps = 5/210 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +++  + I+VGG+GLY  A+   L   PE+   IR  + +  ++ G   L   L  LD
Sbjct: 91  ELFQRNDVVIMVGGSGLYADAVLYGLDDFPEVSPEIRNGLNKLYQKQGITYLQTRLKDLD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            I   Q+   + QR+ RALE+ + SG+    F  +         +   I +  ER  +  
Sbjct: 151 PIQYTQMDVQNPQRMMRALEVCIASGKPYSSFLNKKETLR--DFTNITIGLTAEREVVYN 208

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   MLE+G + E ++L           ++ +G R++    +G+ + D  ++    
Sbjct: 209 RINERVELMLENGLLIEAQTLFPHKKL---NALQTVGYRELFNFFEGKTSLDFAIEEIKK 265

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T ++AKRQ TW       +W  I+ +D L
Sbjct: 266 NTRRFAKRQYTWFHKNKDINWFEINQLDKL 295


>gi|330427270|gb|AEC18604.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pusillimonas
           sp. T7-7]
          Length = 310

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 68/210 (32%), Positives = 109/210 (51%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LP+I GGT LY++AL   L+ +P     +R  I  + +  G   LH +LS  D
Sbjct: 87  QIQDRGNLPLICGGTMLYYKALREGLNNLPTADPVVRAAIDSEARACGWPELHRQLSEFD 146

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKI-IILPERSALK 125
              A ++ P+D QR+ RA+EI  VSG+ + ++   A            + +   +R AL 
Sbjct: 147 PDTAARLAPNDSQRLQRAIEIYRVSGRPMSDWLADARPEQDSSHQFVTLSLEPSDRLALH 206

Query: 126 ERIRRRFTQMLESGAIDEIRSLM-KMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            RI  R+  M+  G +DE+R L  + +L  DLP ++ +G R +   L G I+ D+ +++ 
Sbjct: 207 ARIAARYHAMIREGLLDEVRGLHARPDLHTDLPSVRCVGYRQLWDYLDGRISMDQAIEQA 266

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSID 214
           + AT + AKRQ TWL  Q +   I   + D
Sbjct: 267 VAATRQLAKRQLTWLRSQPERQVIDCLAPD 296


>gi|228922426|ref|ZP_04085729.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228837225|gb|EEM82563.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 317

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 104/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNARRVIRALEIFHTTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|229174373|ref|ZP_04301905.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           MM3]
 gi|228608933|gb|EEK66223.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           MM3]
          Length = 317

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 57/212 (26%), Positives = 107/212 (50%), Gaps = 5/212 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAI-REKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +   AI RE++ +   + G   +H
Sbjct: 85  VRKHIREIAERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDAIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++  N    L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQLEKQENEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ +E
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFEDRVSLEE 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
            + +    + +YAKRQ TW  ++    W  ++
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVT 293


>gi|238897716|ref|YP_002923395.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465473|gb|ACQ67247.1| delta(2)-isopentenylpyrophosphate tRNA-adenosine transferase
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 313

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 74/204 (36%), Positives = 121/204 (59%), Gaps = 2/204 (0%)

Query: 12  RFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVAR 71
             +P++VGGT LYF+AL   LS +P     IR+ I+ +  +YG+  L+++LS +D + A 
Sbjct: 99  GRIPLLVGGTMLYFKALLQGLSPLPSSDPNIRQDIQNQALKYGNTFLYEQLSVIDPVAAE 158

Query: 72  QIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRR 131
           +IH +D QR+ RALE+  +SG+++ E   +     +P +     +I   R+ L  RI RR
Sbjct: 159 RIHFNDIQRVIRALEVFFISGKTLTEL-TKISGSRLPYKVYPFGLIPSSRAQLHHRIERR 217

Query: 132 FTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           F +M+ +G ++E+ SL   +  S DLP ++A+G R + + L GEI+Y+E + RG+ AT +
Sbjct: 218 FQKMISAGFLEEVSSLFIRDDLSADLPSIRAVGYRQMWSYLSGEIDYNEMIYRGVCATRQ 277

Query: 191 YAKRQKTWLCHQFQADWIRISSID 214
            AKRQ TWL       W+     +
Sbjct: 278 LAKRQMTWLRQWKNLYWLDSDQPE 301


>gi|258592121|emb|CBE68426.1| tRNA delta(2)-isopentenylpyrophosphate transferase (IPP
           transferase) (Isopentenyl-diphosphate:tRNA
           isopentenyltransferase) (IPTase) (IPPT) [NC10 bacterium
           'Dutch sediment']
          Length = 314

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 69/210 (32%), Positives = 102/210 (48%), Gaps = 1/210 (0%)

Query: 3   SKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           +  +    +  LPIIVGGTGLY RAL   L   P   T +RE + ++ ++ GS  LH  L
Sbjct: 81  AAIIDIRARGRLPIIVGGTGLYVRALFRGLVDGPGEMTLLRETLYQEAERVGSATLHRRL 140

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIP-LESAHKIIILPER 121
              D   A  IHP+D  R+ RALE+  VSG  +     +      P      +  +   R
Sbjct: 141 EITDPEAAATIHPNDLFRVVRALEVAAVSGHLLSALRVEGRRNHKPVPGPVLRFGLERNR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L  RI  R   M+  G + E++ L+       L  ++AIG R +I  LKG+I  D+ +
Sbjct: 201 QELYRRIEARVEAMMTQGLLREVQDLLDRGYGPVLKPLRAIGYRHMIGHLKGQIRLDDAV 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
                 T +YAKRQ TW  H+ + +W+ + 
Sbjct: 261 ASLKRDTRRYAKRQLTWFRHEDEIEWLPVE 290


>gi|229047392|ref|ZP_04192988.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH676]
 gi|229128990|ref|ZP_04257963.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-Cer4]
 gi|229146283|ref|ZP_04274656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST24]
 gi|296504217|ref|YP_003665917.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis BMB171]
 gi|228637181|gb|EEK93638.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-ST24]
 gi|228654227|gb|EEL10092.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           BDRD-Cer4]
 gi|228723957|gb|EEL75306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH676]
 gi|296325269|gb|ADH08197.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis BMB171]
          Length = 317

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 105/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           ++L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++       L     I +  
Sbjct: 145 EKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|253577131|ref|ZP_04854452.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. oral taxon 786 str. D14]
 gi|251843513|gb|EES71540.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Paenibacillus
           sp. oral taxon 786 str. D14]
          Length = 324

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 58/216 (26%), Positives = 106/216 (49%), Gaps = 4/216 (1%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILH 59
             K + +  ++  LP IVGGTGLY  ++  +            R + +   + +G   LH
Sbjct: 85  CRKLIPEITERGHLPFIVGGTGLYIESVCYEFQFTEAGADEEFRAQQQAFAETHGVEALH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L+ +D   A ++HP+D +R+ RALEI  ++G+++    ++             I +  
Sbjct: 145 AKLAEVDPKSAERLHPNDVRRVIRALEIFHITGETLSSQLEKQQKQS--PYELCLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L  RI RR  +ML  G +DE+R L++   S D   M+ +G ++I+  L   +  D 
Sbjct: 203 DRQMLYNRIERRIDEMLRLGLVDEVRGLLQKGYSRDSVSMQGLGYKEIVEHLVDGVPLDA 262

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            +++    T ++AKRQ +W  H     WI +   ++
Sbjct: 263 AVEKLKRDTRRFAKRQLSWFRHMKDIQWIDVGDGEN 298


>gi|291538966|emb|CBL12077.1| tRNA isopentenyltransferase (miaA) [Roseburia intestinalis XB6B4]
          Length = 281

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 61/204 (29%), Positives = 103/204 (50%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y    +PII GGTG Y +AL   +    +      R ++ +  +++G+  LH  L  +
Sbjct: 51  EIYADGKIPIIAGGTGFYIQALLYDIDFTEQQCDETYRRQLEDLAREHGAEYLHGILREV 110

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IH ++ +R+ RALE   +SG+ I E  +       P   A+ ++   ER+ L 
Sbjct: 111 DPASAEAIHANNIKRVIRALEFYHLSGKKISEHNETERQKQSPYNFAYFVLTD-ERAKLY 169

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI RR   M+E+G ++E++ L  M  S ++  M+ +G ++I+A L G    +E +    
Sbjct: 170 ERIDRRVNAMIEAGLVEEVKKLKSMGCSREMVSMQGLGYKEILAYLDGGCTLEEAVYIIK 229

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
             T  +AKRQ TW   +    W+ 
Sbjct: 230 RETRHFAKRQLTWFKRERDVIWLD 253


>gi|315302937|ref|ZP_07873667.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           ivanovii FSL F6-596]
 gi|313628695|gb|EFR97098.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           ivanovii FSL F6-596]
          Length = 305

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 91/204 (44%), Gaps = 6/204 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            + +  LPIIVGGTGLY +++                  R +L+Q  +  L   L+ LD 
Sbjct: 89  IHNRGKLPIIVGGTGLYIQSIFYDYDFGQTAGDK---AYRVELEQLDNDALWQMLNQLDP 145

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A  IH ++ +R+ RALE+   +G+   E+                + +   R +L ER
Sbjct: 146 KSATLIHKNNKRRVIRALEVMRATGKPFSEYQVHHEPN--NRYKPLFLGLDLARDSLYER 203

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I  R   M + G ++E    +      D+P ++ IG +++    +G  + +E  +     
Sbjct: 204 INERVNNMFQQGLVEEA-KTLYDRDLTDVPAIQGIGYKELFTYFEGNSSLEEAKELIQKN 262

Query: 188 TNKYAKRQKTWLCHQFQADWIRIS 211
           +  YAKRQ TW  ++   +WI+  
Sbjct: 263 SRHYAKRQLTWFRNRMDINWIQAD 286


>gi|52842902|ref|YP_096701.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52630013|gb|AAU28754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 321

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/204 (34%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +  K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD
Sbjct: 95  EIIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLD 154

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L E
Sbjct: 155 PVTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHERPDYYFVNLALFPEQRSWLHE 213

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI
Sbjct: 214 RIAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILQHLAGHYDYETMREKGI 273

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
            AT + AKRQ TWL H   A +  
Sbjct: 274 AATRQLAKRQLTWLRHWEGALFYD 297


>gi|149377525|ref|ZP_01895266.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           algicola DG893]
 gi|149358217|gb|EDM46698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Marinobacter
           algicola DG893]
          Length = 331

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 108/240 (45%), Gaps = 28/240 (11%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +         +P++VGGT +YF+AL   +S +P     +RE + ++ ++ G   LH E
Sbjct: 74  LREMDDIVSAGRIPLLVGGTMMYFKALLHGMSDLPSADPGVRESLAQEARERGWGALHQE 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQS--------------------------- 94
           L   D + AR IH ++ QR+ RALE+  ++G+                            
Sbjct: 134 LERQDPVAARLIHQNNRQRLIRALEVIRLTGRPISSIWQDKASSVQAEGRQNSDGIEDYT 193

Query: 95  IIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSL 154
               W+   +P +P       +   ER  L ERI  RF  ML +G +DE+R L       
Sbjct: 194 YFTQWQADESPSLPYTVVQLAMAPAERRVLHERIALRFNAMLNAGFLDEVRVLKARGDLN 253

Query: 155 DL-PIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
              P M+ +G R   A L G+ +YD  + +G+ AT + AKRQ TWL      DW+     
Sbjct: 254 AGLPSMRCVGYRQGWAHLAGDYDYDTMVDKGVAATRQLAKRQLTWLRKWSDVDWLDSGDK 313


>gi|239977568|sp|Q5GYM0|MIAA_XANOR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
          Length = 327

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 105/211 (49%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A R  I  +  Q G   LH EL+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAAQIGWAGLHSELARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P   +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGLRLPVRVLKVVLAPRERAVLHG 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI RR   ML  G + E+  +  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIERRLDAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|188575914|ref|YP_001912843.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|238689559|sp|B2SUC1|MIAA_XANOP RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|188520366|gb|ACD58311.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 327

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 106/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A R  I  + +Q G   LH EL+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAEQIGWAGLHSELARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P   +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGLRLPVRVLKVVLAPRERAVLHG 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI RR   ML  G + E+  +  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIERRLDAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|319405979|emb|CBI79611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella sp.
           AR 15-3]
          Length = 284

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 79/206 (38%), Positives = 124/206 (60%), Gaps = 1/206 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           + K L     + L I VGGTGLYFRAL   +S +P IP   REK R +L++ G+  L+ +
Sbjct: 75  VEKLLNVITSKSL-IFVGGTGLYFRALLEGISEIPYIPDVCREKWRRRLQEEGAENLYRQ 133

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +DS ++++I   DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R
Sbjct: 134 LLQVDSALSKRICAQDGQRIIRALEVYDVTGKTLSWWQKQKTTSLIAKDCSEKILLIPPR 193

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L E I +R   M+E G ++E+  + ++ LS  LP MKAIG+ + IA L G ++++  +
Sbjct: 194 QQLYENINKRLDHMVEQGVLEEVFIIKQLMLSPLLPAMKAIGLSEFIAYLDGYLSFENAI 253

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADW 207
           +     T +YAKRQ TW  +Q   +W
Sbjct: 254 ETVKTKTRRYAKRQMTWFRNQLNEEW 279


>gi|187779609|ref|ZP_02996082.1| hypothetical protein CLOSPO_03205 [Clostridium sporogenes ATCC
           15579]
 gi|187773234|gb|EDU37036.1| hypothetical protein CLOSPO_03205 [Clostridium sporogenes ATCC
           15579]
          Length = 311

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 106/214 (49%), Gaps = 3/214 (1%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K +   + +  LPII GGTGLY  +L         +     RE +    +  G   +
Sbjct: 79  LAEKCIKDIWSRGKLPIIAGGTGLYINSLIYNYDFTDADRDEDYREYLIRLSEDKGKEYV 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQA-PNPFIPLESAHKIII 117
           H  L  +D     +++P+D +R+ RALE+  ++G+SI E+ K+     +    + +  ++
Sbjct: 139 HSLLKDIDGKSYEKLYPNDLKRVVRALEVYKITGKSISEYTKENEKKLYNIPYNINYFVL 198

Query: 118 LPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINY 177
              R  L ERI +R   M+  G I+E++ L  M  + D+  MK IG ++I+  LKG+I+ 
Sbjct: 199 NMNREVLYERINKRVDIMMNKGLIEEVKKLESMGYTPDMQSMKGIGYKEILFYLKGDISL 258

Query: 178 DETLQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           DE +      +  YAKRQ TW     ++ WI   
Sbjct: 259 DEAIYLIKKGSRNYAKRQLTWFRKDKRSIWIDKD 292


>gi|84624456|ref|YP_451828.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|123521584|sp|Q2P1M3|MIAA_XANOM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|84368396|dbj|BAE69554.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
          Length = 327

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 106/211 (50%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A R  I  + +Q G   LH EL+ +D
Sbjct: 91  QIVARGKLPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAEQIGWAGLHSELARVD 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P   +P+     ++   ER+ L  
Sbjct: 151 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGLRLPVRVLKVVLAPRERAVLHG 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI RR   ML  G + E+  +  +          DLP ++A+G R     L G  +  E 
Sbjct: 211 RIERRLDAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEF 270

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 271 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 301


>gi|54295537|ref|YP_127952.1| hypothetical protein lpl2624 [Legionella pneumophila str. Lens]
 gi|61213968|sp|Q5WTA1|MIAA_LEGPL RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53755369|emb|CAH16865.1| hypothetical protein lpl2624 [Legionella pneumophila str. Lens]
          Length = 313

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/203 (34%), Positives = 109/203 (53%), Gaps = 2/203 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             K+  +P++VGGT +YF AL   L+ +PE   A+R+++ E+    G   L+ +LS LD 
Sbjct: 88  IIKRGNIPLLVGGTMMYFNALQKGLATLPEADEAVRKRLEEEALSQGWDFLYQKLSQLDP 147

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A +IH  D QRI RALE+  ++G ++  +    P+        +  +   +RS L ER
Sbjct: 148 VTAARIHAHDTQRIQRALEVYYLTGSTLSTYLT-GPHEQPDYCFVNLALFPEQRSWLHER 206

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  ML  G I+E++ L          P M+ +G R I+  L G  +Y+   ++GI 
Sbjct: 207 IAQRFDAMLSEGFIEEVQQLQAKWPIQINLPSMRCVGYRQILEYLAGHYDYETMREKGIA 266

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
           AT + AKRQ TWL H   A +  
Sbjct: 267 ATRQLAKRQLTWLRHWEGALFYD 289


>gi|58582570|ref|YP_201586.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|58427164|gb|AAW76201.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 354

 Score =  151 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 76/211 (36%), Positives = 105/211 (49%), Gaps = 6/211 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           Q   +  LPI+ GGTGLYFRAL   LS +PE   A R  I  +  Q G   LH EL+ +D
Sbjct: 118 QIVARGKLPILAGGTGLYFRALLEGLSHLPEADRAARASIAAEAAQIGWAGLHSELARVD 177

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A +IH +D QRI RALE+  +SG+ I  +    P   +P+     ++   ER+ L  
Sbjct: 178 PVAAARIHATDPQRIQRALEVYRISGRPISYWQALPPGLRLPVRVLKVVLAPRERAVLHG 237

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSL------DLPIMKAIGVRDIIALLKGEINYDET 180
           RI RR   ML  G + E+  +  +          DLP ++A+G R     L G  +  E 
Sbjct: 238 RIERRLDAMLAQGFLAEVEQVRALPQMRAVAVPLDLPAVRAVGYRQAWEYLDGAGSLAEF 297

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
             + I AT + AKRQ TWL  +  A W    
Sbjct: 298 RDKAIQATRQLAKRQLTWLRGELDARWFDPE 328


>gi|77166049|ref|YP_344574.1| tRNA isopentenyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|254436334|ref|ZP_05049840.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           oceani AFC27]
 gi|123593520|sp|Q3J802|MIAA_NITOC RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|76884363|gb|ABA59044.1| tRNA isopentenyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|207088024|gb|EDZ65297.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           oceani AFC27]
          Length = 314

 Score =  151 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 69/210 (32%), Positives = 110/210 (52%), Gaps = 1/210 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             K+  +P++VGGT LYF ALT  +S +P     +R  I  +    G   LH  L+ LD 
Sbjct: 90  ISKRGRIPLLVGGTMLYFHALTYGISPLPPADPEVRAAIDREANMKGWKALHRRLAELDP 149

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A++IH  D QRI RALE+  ++G+ + E    +    +P      I+   ER  L  R
Sbjct: 150 MAAQRIHHHDPQRIQRALEVFQLTGRPLSELIANSRESELPYRVIKLILAPAERIVLHSR 209

Query: 128 IRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I RRF  ML++G ++E++   M+ +LSL    ++A+G R     L+ + ++    ++ I 
Sbjct: 210 IERRFRAMLKAGFLEEVKGLFMRPDLSLGHSSIRAVGYRQAWLYLQDQFSFPTMAEQAIS 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           AT + AKRQ TWL  +  A  +     D +
Sbjct: 270 ATRQMAKRQLTWLRRESNAIHVDPEEKDHV 299


>gi|218232488|ref|YP_002368517.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           B4264]
 gi|226704718|sp|B7HCI3|MIAA_BACC4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|218160445|gb|ACK60437.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           B4264]
          Length = 317

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 105/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI  ++G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHMTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|152149497|pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate
           Transferase (Bh2366) From Bacillus Halodurans, Northeast
           Structural Genomics Consortium Target Bhr41.
 gi|212375070|pdb|3EXA|A Chain A, Crystal Structure Of The Full-Length Trna
           Isopentenylpyrophosphate Transferase (Bh2366) From
           Bacillus Halodurans, Northeast Structural Genomics
           Consortium Target Bhr41.
 gi|212375071|pdb|3EXA|B Chain B, Crystal Structure Of The Full-Length Trna
           Isopentenylpyrophosphate Transferase (Bh2366) From
           Bacillus Halodurans, Northeast Structural Genomics
           Consortium Target Bhr41.
 gi|212375072|pdb|3EXA|C Chain C, Crystal Structure Of The Full-Length Trna
           Isopentenylpyrophosphate Transferase (Bh2366) From
           Bacillus Halodurans, Northeast Structural Genomics
           Consortium Target Bhr41.
 gi|212375073|pdb|3EXA|D Chain D, Crystal Structure Of The Full-Length Trna
           Isopentenylpyrophosphate Transferase (Bh2366) From
           Bacillus Halodurans, Northeast Structural Genomics
           Consortium Target Bhr41
          Length = 322

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 62/209 (29%), Positives = 103/209 (49%), Gaps = 3/209 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           + +++  LP +VGGTGLY  A+  Q ++         R ++   +  YG   LHD+LS +
Sbjct: 87  EIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKI 146

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A  IHP++ +R+ RALEI  ++G+++ E  +       P       +   ER  L 
Sbjct: 147 DPKAAAAIHPNNYRRVIRALEIIKLTGKTVTEQARHEEETPSPYNLVXIGLTX-ERDVLY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI RR  Q +E G IDE + L    +     + +AIG ++    L G +  +E +    
Sbjct: 206 DRINRRVDQXVEEGLIDEAKKLYDRGIRDCQSV-QAIGYKEXYDYLDGNVTLEEAIDTLK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSID 214
             + +YAKRQ TW  ++    W   + +D
Sbjct: 265 RNSRRYAKRQLTWFRNKANVTWFDXTDVD 293


>gi|15895110|ref|NP_348459.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           acetobutylicum ATCC 824]
 gi|21263779|sp|Q97I21|MIAA_CLOAB RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|15024810|gb|AAK79799.1|AE007692_7 TRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           acetobutylicum ATCC 824]
 gi|325509249|gb|ADZ20885.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           acetobutylicum EA 2018]
          Length = 309

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/214 (31%), Positives = 109/214 (50%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPE-IPTAIREKIREKLKQYGSHILHDELSSL 65
               ++  PIIVGGTGLY  +L             A RE ++   K  G   LH++L ++
Sbjct: 86  DITSRKKYPIIVGGTGLYINSLICNYDFTGAYKDEAYRESLQAIAKDKGKEYLHEKLKNI 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D    ++++P+D +R+ RALE+  ++G++I E         IP    + I+   +R  L 
Sbjct: 146 DIDSYKKLYPNDLKRVIRALEVYKITGKTISELNSNVDLYDIPYNIHYFIL-NMDRQKLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           ERI  R   ML +G +DE+  L  M  + ++  MK IG ++I++ L+G I  +E ++   
Sbjct: 205 ERINLRVDIMLRNGLVDEVIKLRDMGYNSNMQSMKGIGYKEILSYLEGCITLEEAVELIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
             +  YAKRQ TW     +A WI      + DD+
Sbjct: 265 KGSRHYAKRQLTWFRKDERAVWINKDIYKNDDDI 298


>gi|229071210|ref|ZP_04204434.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           F65185]
 gi|229080967|ref|ZP_04213480.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock4-2]
 gi|229151914|ref|ZP_04280110.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           m1550]
 gi|228631469|gb|EEK88102.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           m1550]
 gi|228702281|gb|EEL54754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock4-2]
 gi|228711831|gb|EEL63782.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           F65185]
          Length = 317

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + E  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRVSLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  +++ + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEK 297


>gi|228953990|ref|ZP_04116019.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228959923|ref|ZP_04121588.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229111184|ref|ZP_04240739.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock1-15]
 gi|228672263|gb|EEL27552.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           Rock1-15]
 gi|228799666|gb|EEM46618.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228805556|gb|EEM52146.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 317

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   SG+ + E  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTSGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRVSLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  +++ + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEK 297


>gi|53804021|ref|YP_114134.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylococcus
           capsulatus str. Bath]
 gi|61213992|sp|Q607R4|MIAA_METCA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|53757782|gb|AAU92073.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Methylococcus
           capsulatus str. Bath]
          Length = 312

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 69/204 (33%), Positives = 117/204 (57%), Gaps = 1/204 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  LP++ GGT LYF AL   L+ +P     +R +I  +  + G H LH EL+ +D
Sbjct: 91  DITARGRLPVLAGGTMLYFNALLRGLAELPSADPDLRREIETRAARDGWHALHAELARID 150

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A +IHP+D QR+ RALE+  ++G+++ +  + + +P +P      ++    R+ L E
Sbjct: 151 PPAAARIHPNDPQRLQRALEVFYLTGRTLSDLCEGSRSPELPFRPLRIVLAPSSRAVLAE 210

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGI 185
           RI  RF +MLE G ++E+ +L +     +  P ++A+G R     L+G+  +D  ++R I
Sbjct: 211 RIAERFRRMLEEGFLEEVEALYRRGDLNETLPSIRAVGYRQAWGYLQGDYGFDTFVERAI 270

Query: 186 IATNKYAKRQKTWLCHQFQADWIR 209
           IAT ++AKRQ TWL  + +A W+ 
Sbjct: 271 IATRQFAKRQCTWLRKETEATWLE 294


>gi|165919134|ref|ZP_02219220.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 334]
 gi|165917146|gb|EDR35750.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Coxiella
           burnetii RSA 334]
          Length = 290

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/205 (32%), Positives = 109/205 (53%), Gaps = 3/205 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELS 63
           K ++   +   P++VGGT LYF  L    S +P     +R+KI+E+  Q+G   +H+ L+
Sbjct: 88  KTIEI--RNRTPLLVGGTMLYFHILEQGFSDLPTADETVRKKIQEEAAQHGWAKIHERLN 145

Query: 64  SLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSA 123
           ++D   A +I+P+D QRI RA E+   +GQ +  +        +P +  + I+    RS 
Sbjct: 146 AIDPKSAARINPNDAQRIQRAFEVYETTGQPLSSYQSLKRFKALPYQFINLILAPENRSW 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI +RF QML++  ++E+R L          P ++ +G R +   L GE +Y+    
Sbjct: 206 LHQRIEKRFDQMLKNNFLEEVRQLYNRGDLNSDLPAIRTVGYRQVWKYLSGEYDYETMRH 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADW 207
           + I AT + AKRQ TWL     A W
Sbjct: 266 KAIAATRQLAKRQLTWLRRWPDAKW 290


>gi|329904232|ref|ZP_08273711.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548095|gb|EGF32820.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 320

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 67/211 (31%), Positives = 103/211 (48%), Gaps = 4/211 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +  LP++VGGT LYF+AL   L  +PE    +R  +       GS  +H  L+ +D
Sbjct: 90  EILARGKLPLLVGGTMLYFKALRDGLDTLPEADPDVRAALDADAALIGSPGMHARLALID 149

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            + A ++ P+D QRI RALEI  ++GQ +     QA    +P       +   +RSAL E
Sbjct: 150 PVTAARLKPNDAQRIQRALEIHQLTGQPMSSLLAQAAPVSLPFTLLPIGLEPSDRSALHE 209

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPI----MKAIGVRDIIALLKGEINYDETLQ 182
           RI +RF  ML +   + I  ++ +    DL      M+ +G R     L G+I+     +
Sbjct: 210 RIAKRFDAMLATDGPNLIDEVIALRQRGDLHPGLPSMRCVGYRQAWEYLDGQIDLPTLRE 269

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSI 213
           +G+ AT + AKRQ TWL    +   I     
Sbjct: 270 KGLAATRQLAKRQLTWLRAMPERHIIDCLDP 300


>gi|167765538|ref|ZP_02437602.1| hypothetical protein CLOSS21_00032 [Clostridium sp. SS2/1]
 gi|167712723|gb|EDS23302.1| hypothetical protein CLOSS21_00032 [Clostridium sp. SS2/1]
          Length = 320

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 58/214 (27%), Positives = 104/214 (48%), Gaps = 5/214 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           + Y K  +P+IVGGTG Y ++L   +    E      R+++ EK K+ G+  L++ L  +
Sbjct: 86  EIYAKGKIPLIVGGTGFYIQSLLYDIDFTKEDGDQEYRKQLEEKAKREGNDSLYEMLKQV 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D     +IH ++ +R+ RALE   ++G  I E  ++      P   A+ ++         
Sbjct: 146 DPKSTEKIHKNNVKRVIRALEFYKLNGYPISEHNEKEAAKTSPYNFAYFVLNHKRDILYY 205

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
             I RR   M E G IDE++ L +      +  M+ IG R +   L+  ++ ++T+++  
Sbjct: 206 R-INRRVDIMAEQGLIDEVKRLKEEGYEKTMVSMQGIGYRQVFEYLEANLSLEDTIEQIK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRIS---SIDDL 216
             T  +AKRQ TW   + +   +  S   S D++
Sbjct: 265 KDTRHFAKRQLTWFGREKEVCMVDKSQFGSEDEI 298


>gi|319404480|emb|CBI78087.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 284

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 73/192 (38%), Positives = 121/192 (63%)

Query: 16  IIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP 75
           I VGGTGLYFRAL   +S +P+IP   ++K R +L++ G   L+ +L  +D+ ++++I  
Sbjct: 88  IFVGGTGLYFRALLEGISEIPDIPDVCQQKWRRRLQEEGVENLYRQLLQVDAELSKRICA 147

Query: 76  SDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQM 135
            DGQRI RALE+  V+G+++  + KQ     I  + + KI+++P R  L E I +R  +M
Sbjct: 148 QDGQRIIRALEVYDVTGKALSWWQKQETTSLIAKDCSEKILLIPPRQQLYENINKRLDRM 207

Query: 136 LESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNKYAKRQ 195
           +E G ++E+  + ++ LS  LP+MKAIG+ + IA L G ++++  ++     T +YAKRQ
Sbjct: 208 VEQGVLEEVLIIKQLMLSPLLPVMKAIGLPEFIAYLDGHLSFENAIETAKTKTRRYAKRQ 267

Query: 196 KTWLCHQFQADW 207
            TW  +Q   +W
Sbjct: 268 MTWFRNQLNEEW 279


>gi|303241528|ref|ZP_07328029.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetivibrio
           cellulolyticus CD2]
 gi|302590946|gb|EFL60693.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acetivibrio
           cellulolyticus CD2]
          Length = 313

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 56/208 (26%), Positives = 101/208 (48%), Gaps = 2/208 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
                  +PI+ GGTGLY  +L   +     I    +RE ++ +  + G+  LH++L  +
Sbjct: 86  DILNSGKIPIVSGGTGLYIDSLIYNIEFGDTICDWELRENLKREALEKGNEYLHNKLKEI 145

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D   A++IH ++ +R+ RA+E+   + +  I   ++      P  +     +   R  L 
Sbjct: 146 DPEAAKKIHMNNVKRVIRAIEVYTYTQKP-ISLHQEESRKNPPKYNFITFGLTMNREKLY 204

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
           +RI +R   M+E G ++E+  L++M        M+ +G ++I++ L+GEI  DE +    
Sbjct: 205 DRINQRVDLMMEKGLVEEVTKLIEMGYDKSTIAMQGLGYKEILSYLRGEITLDEAVYVLK 264

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSI 213
             T  YAKRQ TW       +WI +   
Sbjct: 265 RDTRHYAKRQLTWFNRMKDVNWINMDQF 292


>gi|77918909|ref|YP_356724.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelobacter
           carbinolicus DSM 2380]
 gi|123574368|sp|Q3A503|MIAA1_PELCD RecName: Full=tRNA dimethylallyltransferase 1; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase 1; Short=DMAPP:tRNA
           dimethylallyltransferase 1; Short=DMATase 1; AltName:
           Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase
           1; Short=IPP transferase 1; Short=IPPT 1; Short=IPTase 1
 gi|77544992|gb|ABA88554.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 314

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 58/203 (28%), Positives = 100/203 (49%), Gaps = 1/203 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
               +  LPI+VGGTGLY +AL   L  +P+  + +R  +    + +G   L+  L  +D
Sbjct: 94  DILGRNRLPIVVGGTGLYIQALLHGLIDVPDGDSELRATLLRAEQLHGEGTLYQRLQIVD 153

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
            ++A+++ P+D  RI R LE+  +  + + +   +      P       + +  R AL E
Sbjct: 154 PVLAKRLPPNDLVRIVRGLEVYELCNRRLSDLQAEHAGQKSPYRVLTLGLTMS-REALYE 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R  +MLE G   E+  L+K   + +   M+ IG R+++  + G ++ DE ++    
Sbjct: 213 RINHRVWRMLEDGLAQEVEFLLKRGYAAECKAMQTIGYRELVQHVLGNLSMDEAVRLIQR 272

Query: 187 ATNKYAKRQKTWLCHQFQADWIR 209
            T +YAKRQ TW        W+ 
Sbjct: 273 DTRRYAKRQLTWFNKVNSIIWLD 295


>gi|90408488|ref|ZP_01216647.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Psychromonas sp. CNPT3]
 gi|90310420|gb|EAS38546.1| putative tRNA delta(2)-isopentenylpyrophosphate transferase
           [Psychromonas sp. CNPT3]
          Length = 307

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/208 (35%), Positives = 115/208 (55%), Gaps = 3/208 (1%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
              +   P++VGGT LY+++L   LS +P+     R +I  +  Q G  ++HD+L+ +D 
Sbjct: 90  ICARGKTPLLVGGTMLYYKSLIDGLSPLPQACADTRAQIESEAAQLGWQVMHDKLAQIDP 149

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A +IH +D QR++RALE+  +SG+S+ +   Q  +  IP       I   E++ L +R
Sbjct: 150 VAALRIHVNDPQRLSRALEVYRISGKSMTDL-TQIKSEPIPFNVRQFAIAPQEKTTLHQR 208

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDL-PIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  MLE+G  DE+R L          P M+ +G R +   L+GEI++DE   RGI+
Sbjct: 209 IEQRFINMLETGFEDEVRKLKARKDLHLDLPAMRCVGYRQMWQYLEGEIDHDEMQFRGIV 268

Query: 187 ATNKYAKRQKTWLCHQF-QADWIRISSI 213
           AT + AKRQ TWL     +  W+     
Sbjct: 269 ATRQLAKRQMTWLRGWKTELTWLESEDP 296


>gi|240112751|ref|ZP_04727241.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
 gi|254493610|ref|ZP_05106781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 1291]
 gi|268598818|ref|ZP_06132985.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
 gi|226512650|gb|EEH61995.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae 1291]
 gi|268582949|gb|EEZ47625.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae MS11]
          Length = 313

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/197 (34%), Positives = 101/197 (51%), Gaps = 2/197 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D
Sbjct: 88  EITARGKCPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALEI  ++G+ +       P   +P E     +I  +R+ L E
Sbjct: 148 PETACRLKPNDSQRIGRALEIYYLTGRPMSAHLNGQPEHTLPFELYTAALIPEDRARLHE 207

Query: 127 RIRRRFTQMLESGAIDEIR--SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I  RF  MLE G I E+         L+ D P ++ +G R     L G  +    +++G
Sbjct: 208 NIALRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKG 267

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL  
Sbjct: 268 IAATRQLAKRQLTWLRK 284


>gi|85708517|ref|ZP_01039583.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. NAP1]
 gi|85690051|gb|EAQ30054.1| Isopentenyl-diphosphate:tRNA isopentenyltransferase [Erythrobacter
           sp. NAP1]
          Length = 319

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 75/206 (36%), Positives = 122/206 (59%), Gaps = 4/206 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
           +    +PI+VGGTG+Y + L   ++ +PEI   +RE +R       +   +  L   D +
Sbjct: 105 HANDLVPILVGGTGMYLKVLLEGIAPIPEIEPEVREVVRAM----ETQTAYAALQIEDPV 160

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A ++ P D QRIARALE+K  +G ++ ++ +          +   I+++PER  + +R 
Sbjct: 161 RAAELEPGDSQRIARALEVKRSTGVTLGDWQQAKTGGIGDEVALTAIVMMPERQWVYDRC 220

Query: 129 RRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIAT 188
             RF  M+E GA++E+ +L+  +LS +LP+M+AIGV +I AL++GE   DE ++ G  +T
Sbjct: 221 DARFAAMVEGGAVEEVEALLARDLSPELPVMRAIGVPEIAALIRGEATKDEAIEAGAQST 280

Query: 189 NKYAKRQKTWLCHQFQADWIRISSID 214
            +YAKRQ TWL +Q   DW RI S +
Sbjct: 281 RQYAKRQFTWLRNQCPEDWKRIESQN 306


>gi|218291573|ref|ZP_03495428.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218238628|gb|EED05855.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 312

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/213 (33%), Positives = 107/213 (50%), Gaps = 6/213 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSI--MPEIPTAIREKIREKLKQYGSHILHDELSS 64
           +   +  LP++ GGTGLY RAL   L     PE    +R  +  +  + G   L++EL +
Sbjct: 68  EIVARGRLPVVCGGTGLYVRALLDDLDFSQTPE-DVHVRAALDRRADEEGVQALYEELRA 126

Query: 65  LDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSAL 124
            D   AR IHP D +RI RALE+ +V G  + E +   P        A  I I   R AL
Sbjct: 127 RDPERARMIHPHDRKRIVRALEVAMVRGTGMSEDYDWTPRQG--RYEALVIGITMPREAL 184

Query: 125 KERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            +RI RR   M   G +DE++ L+   + +D   M+AIG ++I+A L G ++ +E ++  
Sbjct: 185 YQRIDRRVEHMWRLGLVDEVKRLLDAGVPMDGTAMQAIGYKEIVAYLSGAVSEEEAIRII 244

Query: 185 IIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
              T ++AKRQ +W     +  W      D LF
Sbjct: 245 QQNTRRFAKRQWSWFRRDPRVHWF-AKGSDGLF 276


>gi|326387417|ref|ZP_08209026.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208073|gb|EGD58881.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 326

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 79/207 (38%), Positives = 111/207 (53%), Gaps = 4/207 (1%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            +    LPI+VGGTGLY R L   ++ +P I  AIR+ +R          L  E    D 
Sbjct: 111 AHAMGALPILVGGTGLYIRTLLDGIAPIPAIDPAIRDAVRAMPVAQAWEALQGE----DP 166

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A ++ P+D  RIARALE+   +G+ +  +  +             ++++PER+ L  R
Sbjct: 167 ERAARLAPADSTRIARALEVVRSTGRPLAAWQAEREGGIGDSVDLSSVVLMPERTWLYAR 226

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
             RRF  M   GAI+E+R+L+   L  DLP+M+AIGVR+I A L GE + +  +  G  A
Sbjct: 227 CDRRFAAMWSDGAIEEVRALLARRLEPDLPVMRAIGVREIAAFLAGETSAESAIASGQQA 286

Query: 188 TNKYAKRQKTWLCHQFQADWIRISSID 214
           T  YAKRQ TWL HQ    W R+S  D
Sbjct: 287 TRNYAKRQYTWLRHQMPESWPRLSHED 313


>gi|289434576|ref|YP_003464448.1| hypothetical protein lse_1211 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170820|emb|CBH27362.1| miaA [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 305

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/203 (27%), Positives = 94/203 (46%), Gaps = 6/203 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            + +  LPIIVGGTGLY +++             +    R +L Q  +  L   L+ LD 
Sbjct: 89  IHNRGKLPIIVGGTGLYIQSVFYDYDFGKSGEDKV---YRAELDQLDNDTLWQMLNQLDP 145

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A  IH ++ +R+ RALE+  ++G+   E+                + +   R  L ER
Sbjct: 146 KSATLIHENNKRRVIRALEVIHLTGKPFSEYQVHNEPN--NRYKPLFLGLDLTREVLYER 203

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I  R  QM E G ++E + L       D+P ++ IG +++ A  +G  + DE  +     
Sbjct: 204 INDRVNQMFEHGLVEEAKILYDQK-LTDVPAIQGIGYKELFAYFEGNSSLDEAKELIQKN 262

Query: 188 TNKYAKRQKTWLCHQFQADWIRI 210
           +  +AKRQ TW  ++   +WI+ 
Sbjct: 263 SRHFAKRQLTWFRNRMDINWIQA 285


>gi|59801335|ref|YP_208047.1| putative tRNA delta transferase [Neisseria gonorrhoeae FA 1090]
 gi|240117797|ref|ZP_04731859.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|268603496|ref|ZP_06137663.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|293399194|ref|ZP_06643359.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae F62]
 gi|75507369|sp|Q5F852|MIAA_NEIG1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|59718230|gb|AAW89635.1| putative tRNA delta transferase [Neisseria gonorrhoeae FA 1090]
 gi|268587627|gb|EEZ52303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID1]
 gi|291610608|gb|EFF39718.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae F62]
          Length = 313

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/197 (34%), Positives = 101/197 (51%), Gaps = 2/197 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D
Sbjct: 88  EITARGKCPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+ +       P   +P E     +I  +R+ L E
Sbjct: 148 PETACRLKPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFELYTAALIPEDRARLHE 207

Query: 127 RIRRRFTQMLESGAIDEIR--SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I  RF  MLE G I E+         L+ D P ++ +G R     L G  +    +++G
Sbjct: 208 NIALRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKG 267

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL  
Sbjct: 268 IAATRQLAKRQLTWLRK 284


>gi|322381941|ref|ZP_08055891.1| tRNA delta(2)-isopentenylpyrophosphate transferase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321154081|gb|EFX46409.1| tRNA delta(2)-isopentenylpyrophosphate transferase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 320

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 62/210 (29%), Positives = 102/210 (48%), Gaps = 3/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHILHDELSSL 65
           +   ++ LP IVGGTGLY  ++    +  P     A R        Q+G   L  +L  +
Sbjct: 96  EITARKKLPFIVGGTGLYVESVCYNFAFTPAPGDEAFRMAQETYADQHGEEALFAKLKEV 155

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D+  A ++HP+D +RI RALEI   +G  + +                 I +  +RS L 
Sbjct: 156 DAASAEKLHPNDRRRIIRALEIFHFTGIPLSKHLTDQKKES--PYELCIIGLTMDRSKLY 213

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R  QML+ G + E+  L++  +S D   M+ +G ++I+  L GEI  +E  Q   
Sbjct: 214 ARIEERVDQMLQYGLVQEVAGLLEKGISPDAVSMQGLGYKEIVRYLLGEITLEEAAQLLK 273

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             T ++AKRQ +W  H  + +W+ +   ++
Sbjct: 274 RNTRRFAKRQLSWFRHMKEIEWVDMIEEEN 303


>gi|41582281|gb|AAS07895.1| tRNA delta(2)-isopentenylpyrophosphate transferase [uncultured
           marine bacterium 463]
          Length = 348

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/206 (32%), Positives = 109/206 (52%), Gaps = 4/206 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P++VGGT LYF+A    ++ MP     +R  I  +  + G   +H  L+ +D
Sbjct: 86  EITARGKTPLLVGGTMLYFKAFLEPMANMPSANLNMRAAIEAEAARVGWSQIHARLAEVD 145

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK---IIILPERSA 123
              A +IHP+  QR+ RALE+   SG+++ E+ + +     P E        I    R+ 
Sbjct: 146 PESAERIHPNHSQRLVRALELYQSSGRTMTEWHRDSGVGLDPFERFDIRQLAICPQNRAV 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QM+++G + E+R L +    S DLP ++A+G R +   L  +   +E ++
Sbjct: 206 LHQRIALRFAQMMKAGFLTEVRDLHQRGDLSPDLPAIRAVGYRQLWQYLDTQCPLEEAVE 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWI 208
           +G+IAT + AKRQ TWL       WI
Sbjct: 266 KGVIATRQLAKRQLTWLRKWRDLGWI 291


>gi|49475827|ref|YP_033868.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           henselae str. Houston-1]
 gi|61214108|sp|Q6G2T3|MIAA_BARHE RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|49238635|emb|CAF27879.1| RNA delta (2)-isopentenylpyrophosphate transferase [Bartonella
           henselae str. Houston-1]
          Length = 290

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 82/206 (39%), Positives = 129/206 (62%), Gaps = 1/206 (0%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           +SK L  +  + L I VGGTGLYFRAL   +S +P+IP  +R+K R +L + G+  L+ +
Sbjct: 82  VSKLLMTFTSKSL-IFVGGTGLYFRALLEGISKIPDIPDVVRQKWRLRLDKEGAENLYRQ 140

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L  +D+++A +I   DGQRI RALE+   + + +  + K+   P I    + K++++P R
Sbjct: 141 LWQVDAVLAEKISSQDGQRIVRALEVYDATDKKLSWWQKKKTTPLIARNCSEKLLLIPPR 200

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L ERI +R   M+E GA++E+ ++ K+ LS  LP MKAIG+ + IA L G+ +++E L
Sbjct: 201 QLLYERIHKRLDSMIEKGALEEVIAMKKLALSPLLPAMKAIGIPEFIAYLDGKQSFEEAL 260

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADW 207
           +     T +YAKRQ TW  +QF  +W
Sbjct: 261 EMVKTQTRRYAKRQITWFRNQFDEEW 286


>gi|189502061|ref|YP_001957778.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus
           Amoebophilus asiaticus 5a2]
 gi|239977164|sp|B3ES47|MIAA_AMOA5 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|189497502|gb|ACE06049.1| hypothetical protein Aasi_0653 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 313

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/210 (27%), Positives = 99/210 (47%), Gaps = 3/210 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
             + K    ++ GG+GLY +A+   L  MPEI   IR     K K+ G   L  ELS  D
Sbjct: 93  DLFNKHQYLLLTGGSGLYIQAVCEGLDEMPEISLEIRGYFNNKYKKEGLSALVKELSIQD 152

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
               + +  ++ QR+ RALE+ + +G+   +F  Q     +      KI +  +R+ L +
Sbjct: 153 PDYYKIVDLNNPQRVIRALEVCMATGKPYSQFRLQKKEEHVRPFKMIKIGLNLDRNLLYQ 212

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI +R  QM+E G ++E+R+L           ++ +G +++   L      +E +     
Sbjct: 213 RIDQRVDQMMEQGLLEEVRALYPYRD---CNALQTVGYQELFGYLDKRYTLEEAISLIKR 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            T +YAKRQ TW   Q    W   + ++ +
Sbjct: 270 NTRRYAKRQLTWFTRQTDIKWFSPNELEAI 299


>gi|28198004|ref|NP_778318.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa Temecula1]
 gi|182680630|ref|YP_001828790.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M23]
 gi|32129726|sp|Q87F70|MIAA_XYLFT RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|238691050|sp|B2I692|MIAA_XYLF2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|28056064|gb|AAO27967.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa Temecula1]
 gi|182630740|gb|ACB91516.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M23]
          Length = 317

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 107/210 (50%), Gaps = 6/210 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+
Sbjct: 92  IVRRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWAALHTRLAEVDA 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           I A +IH +D QRI RALE+ LVSGQS+ ++  Q P   +PL     ++    R  L  R
Sbjct: 152 ITAARIHATDPQRIQRALEVYLVSGQSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFR 211

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPI------MKAIGVRDIIALLKGEINYDETL 181
           I +RF  ML++G + E+ +L        +        M+A+G R     L G    +   
Sbjct: 212 IAQRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLY 271

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           QR + AT + AKRQ TWL  +  A W    
Sbjct: 272 QRSVAATRQLAKRQLTWLRGELDALWFDPE 301


>gi|254480808|ref|ZP_05094054.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2148]
 gi|214038603|gb|EEB79264.1| tRNA delta(2)-isopentenylpyrophosphate transferase [marine gamma
           proteobacterium HTCC2148]
          Length = 348

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/206 (32%), Positives = 109/206 (52%), Gaps = 4/206 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P++VGGT LYF+A    ++ MP     +R  I  +  + G   +H  L+ +D
Sbjct: 86  EITARGKTPLLVGGTMLYFKAFLEPMANMPSANLNMRAAIEAEAARVGWSQIHARLAEVD 145

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHK---IIILPERSA 123
              A +IHP+  QR+ RALE+   SG+++ E+ + +     P E        I    R+ 
Sbjct: 146 PESAERIHPNHSQRLVRALELYQSSGRTMTEWHRDSGVGLDPFERFDIRQLAICPQNRAV 205

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKMNL-SLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
           L +RI  RF QM+++G + E+R L +    S DLP ++A+G R +   L  +   +E ++
Sbjct: 206 LHQRIALRFAQMMKAGFLTEVRDLHQRGDLSPDLPAIRAVGYRQLWQYLDTQCPLEEAVE 265

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWI 208
           +G+IAT + AKRQ TWL       WI
Sbjct: 266 KGVIATRQLAKRQLTWLRKWRDLGWI 291


>gi|167630630|ref|YP_001681129.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Heliobacterium
           modesticaldum Ice1]
 gi|239977378|sp|B0TB07|MIAA_HELMI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|167593370|gb|ABZ85118.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Heliobacterium
           modesticaldum Ice1]
          Length = 320

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/210 (30%), Positives = 106/210 (50%), Gaps = 2/210 (0%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDELSSL 65
           +   +  LPI+VGGTGLY +++        E     +R ++ ++    G   LH  L+ +
Sbjct: 82  EIVNRGRLPILVGGTGLYVQSIIDHYEFTEEATDLELRSQLEQEADASGLEALHRRLAEV 141

Query: 66  DSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALK 125
           D I A +IH +D +RI RALE+  ++G+   +F   A +   P      I +  +R  L 
Sbjct: 142 DPISAARIHVNDRKRIIRALEVYRLTGRRQSDFHY-ADSVRQPKYQLAPIALTMDRQELY 200

Query: 126 ERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGI 185
            RI  R   M+ESG ++E++ L+K   +  LP M+AIG ++I+  L+GE +    L    
Sbjct: 201 RRIDLRARNMIESGLVEEVKGLLKGGYAPTLPSMQAIGYKEIVGYLQGEYDLARALYLLQ 260

Query: 186 IATNKYAKRQKTWLCHQFQADWIRISSIDD 215
             T  +AKRQ TW     +  W    ++D 
Sbjct: 261 RDTRHFAKRQYTWFRRDTRLIWFAADAMDR 290


>gi|38234024|ref|NP_939791.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Corynebacterium
           diphtheriae NCTC 13129]
 gi|61214144|sp|Q6NGR5|MIAA_CORDI RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|38200286|emb|CAE49971.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Corynebacterium
           diphtheriae]
          Length = 302

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 58/205 (28%), Positives = 90/205 (43%), Gaps = 3/205 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
              ++   PI+VGG+ LY ++L       P    ++R K   KL + G   LH  L+  D
Sbjct: 89  DIQRRGKTPILVGGSMLYVQSLVDDWQF-PPTDPSVRAKWESKLNEVGVEALHALLAQKD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  I   D +R  RALE+  ++G+       Q P    P  +   I +      L  
Sbjct: 148 PQAASIIELKDPRRTVRALEVIELTGKPFNA--SQPPKNAPPRWNTQIIGLGTNTEWLNP 205

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   M E G + E+ +L+   L  D     AIG   ++    GE++ DE ++   I
Sbjct: 206 RIDLRTELMFEKGFVHEVENLVGKGLIADSTAGHAIGYAQVLQHFAGELSVDEMIEHTKI 265

Query: 187 ATNKYAKRQKTWLCHQFQADWIRIS 211
            T +Y +RQ++W     +  WI  S
Sbjct: 266 GTRRYVRRQRSWFKRDPRIHWIDAS 290


>gi|182679765|ref|YP_001833911.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|239977174|sp|B2IKE2|MIAA_BEII9 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|182635648|gb|ACB96422.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 302

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 80/208 (38%), Positives = 116/208 (55%), Gaps = 1/208 (0%)

Query: 11  KRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVA 70
           +  +PI VGGTGLYF+ALT  LS +P +P +IR  +R   +   +  LH EL++ D  +A
Sbjct: 88  QGRMPIFVGGTGLYFKALTQGLSDIPSVPDSIRADLRRHAEGCSTPELHRELAARDPEMA 147

Query: 71  RQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIRR 130
            ++ P+D QRI RALE+ + +GQS+  F      P + +     + + P+R+ L  RI R
Sbjct: 148 ARLKPNDSQRILRALEVFVATGQSLAAFQNARSAPLLTMSEVLAVFLAPDRADLNRRIDR 207

Query: 131 RFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIATNK 190
           RF  MLE GA+ E+  L    L   LP+M+A GV  ++  L+GEI+  E   RG + T  
Sbjct: 208 RFDTMLEQGALQEVERLGARGLDPSLPVMRAHGVPHLLRALRGEISLAEAADRGKLDTRH 267

Query: 191 YAKRQKTWLCHQ-FQADWIRISSIDDLF 217
           YAKRQ T+  HQ     W      +  F
Sbjct: 268 YAKRQFTFARHQLPDFAWRTPEEAETFF 295


>gi|206968692|ref|ZP_03229647.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1134]
 gi|229179990|ref|ZP_04307334.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           172560W]
 gi|206735733|gb|EDZ52891.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           AH1134]
 gi|228603199|gb|EEK60676.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           172560W]
          Length = 317

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 106/216 (49%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFRTTGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +  ++ ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRVSLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  +++ + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTNGEK 297


>gi|220929117|ref|YP_002506026.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           cellulolyticum H10]
 gi|219999445|gb|ACL76046.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium
           cellulolyticum H10]
          Length = 308

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/226 (25%), Positives = 111/226 (49%), Gaps = 10/226 (4%)

Query: 1   MLSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMP-EIPTAIREKIREKLKQYGSHIL 58
           +  K + +  +K   PI+ GGTGLY  +L   ++    E    +RE +++++ + G   L
Sbjct: 79  LAEKYIVKILEKNKQPIVAGGTGLYISSLINNINFSESESDWELREALKKEVDELGPEHL 138

Query: 59  HDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIIL 118
           H +L  +D   A  IHP++ +R+ RALE+   + +  I +  +      P      + + 
Sbjct: 139 HKKLQEVDPDSALNIHPNNIKRVIRALEVYYQTHKP-ISYHNEISRKTPPKYEFILVGLS 197

Query: 119 PERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYD 178
            +R  L ERI RR   M+E+G +DE++ L+ +  +  +  M+ IG ++I+  L+     +
Sbjct: 198 MDRQVLYERINRRVDIMVENGLVDEVKKLVNLGYADSIISMQGIGYKEILEYLRNTYTLE 257

Query: 179 ETLQRGIIATNKYAKRQKTWLCHQFQADWIRISS-------IDDLF 217
           + ++     T +YAKRQ TW        W  + +        ++++
Sbjct: 258 QAIENIKQGTRRYAKRQITWFKRINGIKWFNLDNSGNNINVFNEIY 303


>gi|113461227|ref|YP_719296.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 129PT]
 gi|123327355|sp|Q0I462|MIAA_HAES1 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|112823270|gb|ABI25359.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Haemophilus
           somnus 129PT]
          Length = 311

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/214 (34%), Positives = 122/214 (57%), Gaps = 4/214 (1%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
           L +  +  ++  +P++VGGT LY++AL   LS +P     +R +I +K +++G   LH+E
Sbjct: 84  LQEMQKITQQGKIPLLVGGTMLYYKALLEGLSPLPSADEKVRLEIEQKAEKFGWATLHNE 143

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           L+ +D I A++I+P+D QRI RALE+  ++GQS+ E   Q            +  I P+R
Sbjct: 144 LAKIDPISAQRINPNDSQRINRALEVFYLTGQSLTELTAQKGKEI--PYHIIQFAIAPDR 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           + L +RI +RF +M+E G   E+     + +L  +LP ++ +G R +   L+G  + DE 
Sbjct: 202 AVLHQRIEQRFHKMIEQGFQQEVEKLYQRSDLHPNLPSIRCVGYRQMWEYLQGNYDKDEM 261

Query: 181 LQRGIIATNKYAKRQKTWLCHQF-QADWIRISSI 213
           + RGI AT + AKRQ TWL       +W+   + 
Sbjct: 262 IFRGICATRQLAKRQLTWLRGWKSPIEWLDSLNP 295


>gi|30021809|ref|NP_833440.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 14579]
 gi|46576975|sp|Q812Y4|MIAA_BACCR RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|29897365|gb|AAP10641.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus cereus
           ATCC 14579]
          Length = 317

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/216 (24%), Positives = 104/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE+  +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQREKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
           ++L  +D   A +IH ++ +R+ RALEI   +G+ + E  ++       L     I +  
Sbjct: 145 EKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSEQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|154686146|ref|YP_001421307.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           amyloliquefaciens FZB42]
 gi|166201469|sp|A7Z500|MIAA_BACA2 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|154351997|gb|ABS74076.1| MiaA [Bacillus amyloliquefaciens FZB42]
          Length = 314

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/214 (29%), Positives = 111/214 (51%), Gaps = 4/214 (1%)

Query: 4   KKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILHDEL 62
           K  +   +  LP+IVGGTGLY +++    +          RE++ +   + G+  LH +L
Sbjct: 87  KITEIADRGKLPMIVGGTGLYIQSVLYDYTFTENSGDPVFRERMEKLAAEEGAEALHAKL 146

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
           ++ D   A  IH ++ +R+ RALEI  VSG+++ E  K        L +A  I +  +R 
Sbjct: 147 AAADPEAAAAIHQNNTRRVIRALEILHVSGKTMSEHLKTQKREL--LYNAVLIGLTMDRE 204

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L  RI  R   MLE+G +DE++ L  MN+      ++AIG +++   L G++   + ++
Sbjct: 205 VLYGRINERVDLMLETGLLDEVKRLYDMNIRDSQS-IQAIGYKELYEYLDGKVPLPQAVE 263

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
           +    + +YAKRQ TW  ++    W  ++   D+
Sbjct: 264 QLKQNSRRYAKRQLTWFRNKMPVSWTDMTPPVDI 297


>gi|313633440|gb|EFS00268.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           seeligeri FSL N1-067]
 gi|313638126|gb|EFS03387.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           seeligeri FSL S4-171]
          Length = 305

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/203 (27%), Positives = 94/203 (46%), Gaps = 6/203 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
            + +  LPIIVGGTGLY +++             +    R +L Q  +  L   L+ LD 
Sbjct: 89  IHNRGKLPIIVGGTGLYIQSVFYDYDFGKSGEDKV---YRAELDQLDNDTLWQMLNQLDP 145

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
             A  IH ++ +R+ RALE+  ++G+   E+                + +   R  L ER
Sbjct: 146 KSATLIHENNKRRVIRALEVIHLTGKPFSEYQVHHEPN--NRYKPLFLGLDLTREVLYER 203

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGIIA 187
           I  R  QM E G ++E + L       D+P ++ IG +++ A  +G  + +E  +     
Sbjct: 204 INDRVNQMFEHGLVEEAKILYDQK-LTDVPAIQGIGYKELFAYFEGNSSLEEAKELIQKN 262

Query: 188 TNKYAKRQKTWLCHQFQADWIRI 210
           +  +AKRQ TW  ++   +WI+ 
Sbjct: 263 SRHFAKRQLTWFRNRMDINWIQA 285


>gi|253701876|ref|YP_003023065.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter sp.
           M21]
 gi|251776726|gb|ACT19307.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacter sp.
           M21]
          Length = 306

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 62/208 (29%), Positives = 97/208 (46%), Gaps = 5/208 (2%)

Query: 2   LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDE 61
            +       +    I+VGGTGLY RAL   L   P     +R     +        L   
Sbjct: 87  AAAIADIQSRGKRAIVVGGTGLYIRALLHGLVDSPTGDPELR----RQFADVPGEELLRR 142

Query: 62  LSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPER 121
           LS +D   A +++P+D  R+ RALE+   +G+ I  F  +     +  ++    I   ER
Sbjct: 143 LSLVDPETAARLYPNDRVRLIRALEVYAQTGRPISAFRSEHTFSEVHYQALKMAIR-VER 201

Query: 122 SALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETL 181
             L  RI  R  +ML+ G ++E+RSL+      +L  M++IG +++ A L GE+  DE +
Sbjct: 202 QELYRRIDLRVEKMLDDGLVEEVRSLLAAGYGRELKTMRSIGYKEVTAYLAGEMTLDEAV 261

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIR 209
                 T +YAKRQ TW   +    W+ 
Sbjct: 262 TLIKRDTRRYAKRQMTWFGKENDIYWLE 289


>gi|71275935|ref|ZP_00652218.1| tRNA isopentenyltransferase [Xylella fastidiosa Dixon]
 gi|71900021|ref|ZP_00682166.1| tRNA isopentenyltransferase [Xylella fastidiosa Ann-1]
 gi|170729310|ref|YP_001774743.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa M12]
 gi|238687896|sp|B0U1E8|MIAA_XYLFM RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|71163312|gb|EAO13031.1| tRNA isopentenyltransferase [Xylella fastidiosa Dixon]
 gi|71730231|gb|EAO32317.1| tRNA isopentenyltransferase [Xylella fastidiosa Ann-1]
 gi|167964103|gb|ACA11113.1| tRNA isopentenyltransferase [Xylella fastidiosa M12]
          Length = 317

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 76/210 (36%), Positives = 107/210 (50%), Gaps = 6/210 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+
Sbjct: 92  IVRRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWATLHTRLAEVDA 151

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           I A +IH +D QRI RALE+ LVSG+S+ ++  Q P   +PL     ++    R  L  R
Sbjct: 152 ITAARIHATDPQRIQRALEVYLVSGRSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFR 211

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPI------MKAIGVRDIIALLKGEINYDETL 181
           I +RF  ML++G + E+ +L        +        M+A+G R     L G    +   
Sbjct: 212 IAQRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLY 271

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           QR + AT + AKRQ TWL  +  A W    
Sbjct: 272 QRSVAATRQLAKRQLTWLRGELDALWFDPE 301


>gi|228909536|ref|ZP_04073359.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis IBL 200]
 gi|228940788|ref|ZP_04103348.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228973708|ref|ZP_04134286.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980265|ref|ZP_04140576.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis Bt407]
 gi|228779370|gb|EEM27626.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis Bt407]
 gi|228785954|gb|EEM33955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818802|gb|EEM64867.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228849825|gb|EEM94656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis IBL 200]
 gi|326941423|gb|AEA17319.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 317

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 103/216 (47%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +     ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRAPLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|240115502|ref|ZP_04729564.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
 gi|268601176|ref|ZP_06135343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
 gi|268585307|gb|EEZ49983.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           gonorrhoeae PID18]
          Length = 313

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/197 (33%), Positives = 100/197 (50%), Gaps = 2/197 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D
Sbjct: 88  EITARGKCPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQKVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+ +       P   +P +     +I   R+ L E
Sbjct: 148 PETACRLKPNDSQRIGRALEVYYLTGRPMSAHLNGQPEHTLPFQLYTAALIPENRARLHE 207

Query: 127 RIRRRFTQMLESGAIDEIR--SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I  RF  MLE G I E+         L+ D P ++ +G R     L G  +    +++G
Sbjct: 208 NIALRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEHLDGATDRQTFIEKG 267

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL  
Sbjct: 268 IAATRQLAKRQLTWLRK 284


>gi|304387764|ref|ZP_07369944.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis ATCC 13091]
 gi|254671347|emb|CBA08773.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis alpha153]
 gi|304338240|gb|EFM04370.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neisseria
           meningitidis ATCC 13091]
          Length = 313

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/197 (33%), Positives = 103/197 (52%), Gaps = 2/197 (1%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           +   +   P+IVGGT +YFRALT  L+ +PE    +R  + E+ + YG   L+  L  +D
Sbjct: 88  EITARGKYPLIVGGTMMYFRALTQGLNDLPEADACLRADLDEQKQMYGLDFLYRTLQQVD 147

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++ P+D QRI RALE+  ++G+ + E   +     +P +     +I   R+ L E
Sbjct: 148 PETACRLKPNDSQRIGRALEVYYLTGKPMSEHLGRQSPHTLPFDLHTAALIPENRARLHE 207

Query: 127 RIRRRFTQMLESGAIDEIR--SLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRG 184
            I  RF  MLE G I E+         L+ D P ++ +G R     L G+ ++   +++G
Sbjct: 208 NIALRFHLMLEQGFIGEVENLRRRYPGLTADSPAIRCVGYRQAWEYLDGKTDFPAFVEKG 267

Query: 185 IIATNKYAKRQKTWLCH 201
           I AT + AKRQ TWL  
Sbjct: 268 IAATRQLAKRQLTWLRK 284


>gi|228966635|ref|ZP_04127681.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228793011|gb|EEM40567.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus
           thuringiensis serovar sotto str. T04001]
          Length = 317

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/216 (24%), Positives = 104/216 (48%), Gaps = 5/216 (2%)

Query: 2   LSKKL-QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEI-PTAIREKIREKLKQYGSHILH 59
           + K + +  ++  LPIIVGGTGLY +++        +      RE++ +   + G   +H
Sbjct: 85  VRKHIQEITERGNLPIIVGGTGLYIQSVLFDYQFTDDAGDVIYREQMEKLALERGVEYVH 144

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            +L  +D   A +IH ++ +R+ RALEI   +G+ + +  ++       L     I +  
Sbjct: 145 KKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQIEKQEKEL--LYDVSLIGLTM 202

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L +RI  R   M+E G ++E+  L    +      ++AIG ++I    +   + ++
Sbjct: 203 DREMLYDRINLRVDLMMEQGLLEEVEGLYNRGIRDCQS-IQAIGYKEIYDYFENRASLED 261

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDD 215
            + +    + +YAKRQ TW  ++    W  ++  + 
Sbjct: 262 AVSQLKTNSRRYAKRQLTWFRNKMDVTWFDVTDGEK 297


>gi|170744236|ref|YP_001772891.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium sp. 4-46]
 gi|239977414|sp|B0UPN1|MIAA_METS4 RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|168198510|gb|ACA20457.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Methylobacterium sp. 4-46]
          Length = 306

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 74/201 (36%), Positives = 110/201 (54%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +    LPI+VGGTGLYF+AL   LS +P +P A+R  +R + +   +  LH +L+  D
Sbjct: 92  EVWAAGGLPIVVGGTGLYFKALLEGLSEIPPVPEAVRTALRAEAEGRETAALHADLARRD 151

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A ++   D  R+ RALE+   +G+ +  F        +      K+ ++P+R+ L+ 
Sbjct: 152 PEGAARLGAHDRLRVLRALEVLAATGRPLSAFQGSRRPGPLAGMPCDKLFLVPDRALLRA 211

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  RF  M+E GA+DE+  L    L   LP+M+A GV  +IA L G +  +E + RG  
Sbjct: 212 RIDARFLAMMEEGALDEVARLRARRLDPMLPVMRAHGVPGLIAFLDGALTREEAVARGQA 271

Query: 187 ATNKYAKRQKTWLCHQFQADW 207
            T  YAKRQ TW  HQ  A W
Sbjct: 272 DTRAYAKRQVTWFRHQAGAGW 292


>gi|295395413|ref|ZP_06805612.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294971735|gb|EFG47611.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 300

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/207 (28%), Positives = 98/207 (47%), Gaps = 5/207 (2%)

Query: 7   QRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLD 66
           + +++   PIIVGG+GLY RA T  ++  P    A+R ++    +    H ++  L  LD
Sbjct: 85  EIHQRGRTPIIVGGSGLYVRAATDVMNF-PGTDPAMRARLEGIAEAGALHDMYAMLEELD 143

Query: 67  SIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKE 126
              A  I P+D +RI RALE+  ++G +      +    +       ++ +  +R  L +
Sbjct: 144 PKAASTIKPTDARRIVRALEVIALTGDTFSSELPE----YTYYTPTIQVGLAQDRETLHQ 199

Query: 127 RIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           RI  R   M ++G +DE+R+L+   L        AIG   II  L G +  D  +   + 
Sbjct: 200 RIADRVHLMWDAGWVDEVRTLLDQGLRDGKTARHAIGYAQIIDYLDGNMTADLAIDSTVT 259

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSI 213
            T ++AKRQ+TW     +  W   +  
Sbjct: 260 RTRQFAKRQETWFRRDPRIHWFDAADP 286


>gi|307579089|gb|ADN63058.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 305

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 77/210 (36%), Positives = 107/210 (50%), Gaps = 6/210 (2%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             ++  LPI+ GGTGLYFRAL   LS MP     IR  I  + K+     LH  L+ +D+
Sbjct: 80  IVRRGALPILTGGTGLYFRALLAGLSDMPPAHPEIRAMIAAEAKRDSWAALHTRLAEVDA 139

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           I A +IH +D QRI RALE+ LVSGQS+ ++  Q P   +PL     ++    R  L  R
Sbjct: 140 ITAARIHATDPQRIQRALEVYLVSGQSMSDWQNQPPKQRLPLRVLKLVLAPTHRKVLHFR 199

Query: 128 IRRRFTQMLESGAIDEIRSLMKMNLSLDLPI------MKAIGVRDIIALLKGEINYDETL 181
           I +RF  ML++G + E+ +L        +        M+A+G R     L G    +   
Sbjct: 200 IAQRFKAMLDNGLLAEVNALRTHPSIHAMARPLDLPAMRAVGYRQCWEHLDGMYTAEMLY 259

Query: 182 QRGIIATNKYAKRQKTWLCHQFQADWIRIS 211
           QR + AT + AKRQ TWL  +  A W    
Sbjct: 260 QRSVAATRQLAKRQLTWLRGELDALWFDPE 289


>gi|292493697|ref|YP_003529136.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           halophilus Nc4]
 gi|291582292|gb|ADE16749.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Nitrosococcus
           halophilus Nc4]
          Length = 311

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 67/208 (32%), Positives = 109/208 (52%), Gaps = 1/208 (0%)

Query: 8   RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDS 67
             ++  +P++VGGT LYF AL   +S +P     +R  I  +    G   LH  L+ LD 
Sbjct: 90  INQRGRIPLLVGGTMLYFHALRHGISPLPPANPEVRAAIDREAMAMGWEALHRRLAELDP 149

Query: 68  IVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKER 127
           + A++IH  D QRI RALE+  ++G+ + E          P      I+   ER++L  R
Sbjct: 150 VAAQRIHRHDPQRIQRALEVFQLTGRPLSELIADTQEAEFPYRVIKLILAPRERASLHTR 209

Query: 128 IRRRFTQMLESGAIDEIRS-LMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQRGII 186
           I +RF  MLE+G ++E+     + +LS++L  ++A+G R     L+G  ++   +++ I 
Sbjct: 210 IEQRFYAMLEAGFLEEVNDLFKRPDLSVELSSIRAVGYRQAWLYLQGRFSFPAMVEQAIT 269

Query: 187 ATNKYAKRQKTWLCHQFQADWIRISSID 214
           AT + AKRQ TWL  +  A  +     D
Sbjct: 270 ATRQMAKRQLTWLRREEDAIHVDPDEKD 297


>gi|290894148|ref|ZP_06557119.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           monocytogenes FSL J2-071]
 gi|290556278|gb|EFD89821.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria
           monocytogenes FSL J2-071]
          Length = 305

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/208 (28%), Positives = 101/208 (48%), Gaps = 7/208 (3%)

Query: 4   KKLQ-RYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDEL 62
           K ++  ++   LPIIVGGTGLY +++            +  +  R KL+Q    IL   L
Sbjct: 84  KAIETIHQAGKLPIIVGGTGLYIQSVFYDYDFG---NASEDKAYRAKLEQLDKAILWQML 140

Query: 63  SSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERS 122
              D   ARQIH ++ +R+ RALE+  ++G+   E+                + +  +R 
Sbjct: 141 EQQDPESARQIHENNKRRVIRALEVMHLTGKPFSEYQVHN--VLNDTYKPLFLGLDLDRE 198

Query: 123 ALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDETLQ 182
            L ERI +R   M E G I E + L +    +D+P ++ IG +++    +G+ + +E  +
Sbjct: 199 LLYERINQRVNLMFEQGLITEAKKLYEQ-HLVDVPAVRGIGYKELFPYFEGKSSLEEAKE 257

Query: 183 RGIIATNKYAKRQKTWLCHQFQADWIRI 210
                +  +AKRQ TW  ++   DWI+ 
Sbjct: 258 LIQKNSRHFAKRQLTWFRNRMDIDWIQA 285


>gi|83312605|ref|YP_422869.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magneticum AMB-1]
 gi|123541025|sp|Q2W1G5|MIAA_MAGSA RecName: Full=tRNA dimethylallyltransferase; AltName:
           Full=Dimethylallyl diphosphate:tRNA
           dimethylallyltransferase; Short=DMAPP:tRNA
           dimethylallyltransferase; Short=DMATase; AltName:
           Full=Isopentenyl-diphosphate:tRNA
           isopentenyltransferase; Short=IPP transferase;
           Short=IPPT; Short=IPTase
 gi|82947446|dbj|BAE52310.1| tRNA delta(2)-isopentenylpyrophosphate transferase
           [Magnetospirillum magneticum AMB-1]
          Length = 315

 Score =  149 bits (377), Ex