RPSBLAST alignment for GI: peg_888 and conserved domain: COG0324

>gnl|CDD|30672 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]. Length = 308
 Score =  194 bits (495), Expect = 1e-50
 Identities = 87/217 (40%), Positives = 125/217 (57%), Gaps = 2/217 (0%)

Query: 1   MLSKKLQRYKKRF-LPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59
                +     R  LPI+VGGTGLY +AL   LS++PE    +R ++  +L + G+  LH
Sbjct: 80  DALAAIDDILARGKLPILVGGTGLYLKALLEGLSLLPEADPEVRRRLEAELAELGNDALH 139

Query: 60  DELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILP 119
            EL  +D   A +IHP+D QRI RALE+  ++G+ I E  K++     P +    I +  
Sbjct: 140 AELKKIDPEAAAKIHPNDPQRIIRALEVYYLTGKPISELQKRSRPILEPYD-ILIIALAA 198

Query: 120 ERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179
           +R  L ERI RR   MLE G I+E+++L    L LDLP M+AIG ++I+A L G I+ +E
Sbjct: 199 DREVLYERINRRVDAMLEQGLIEEVKALYARGLHLDLPAMQAIGYKEILAYLDGGISLEE 258

Query: 180 TLQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDL 216
            ++R   AT +YAKRQ TW  +Q    W+   S D L
Sbjct: 259 AIERIKTATRQYAKRQLTWFRNQLGVHWLDSESPDTL 295