RPSBLAST alignment of GI: peg_888 and MMDB domain: 3a8t_A_184-294

>3a8t_A (A:184-294) Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}Length = 111
 Score = 78.6 bits (193), Expect = 7e-16
 Identities = 21/108 (19%), Positives = 35/108 (32%), Gaps = 24/108 (22%)

Query: 124 LKERIRRRFTQMLESGAIDEIRSLMKM-------NLSLDLPIMKAIGVRDIIALLKGEIN 176
           L + + +R   MLE G  DE+             + +    + KAIGV +     +    
Sbjct: 4   LTDYLAKRVDDMLELGMFDELAEFYSPEDEDHDEDSATRTGLRKAIGVPEFDRYFEKFRP 63

Query: 177 -----------------YDETLQRGIIATNKYAKRQKTWLCHQFQADW 207
                            ++E ++     T   AKRQ   +     A W
Sbjct: 64  GDVEGEDPGRDRVRRGAFEEAVRAIKENTCHLAKRQIGKILRLKGAGW 111