RPSBLAST alignment of GI: peg_888 and MMDB domain: 3crm_A_1-212_297-323

>3crm_A (A:1-212,A:297-323) TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_ALength = 239
 Score = 64.5 bits (156), Expect = 1e-11
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 2/124 (1%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
             +  +P++VGGT LY++AL   L+ MP     +R  I  + +  G   LH +L+ +D  
Sbjct: 91  TARGRIPLLVGGTMLYYKALLEGLADMPGADPEVRAAIEAEAQAEGWEALHRQLAEVDPE 150

Query: 69  VARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERI 128
            A +IHP+D QR+ RALE+  + G S+ +  ++        +           +  +  I
Sbjct: 151 SAARIHPNDPQRLMRALEVYRLGGVSMSDLRRRQSAE--KADFDASGRNQLPYTVAQLAI 208

Query: 129 RRRF 132
               
Sbjct: 209 APEQ 212