RPSBLAST alignment of GI: peg_888 and MMDB domain: 3eph_A_112-184

>3eph_A (A:112-184) TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*Length = 73
 Score = 70.5 bits (173), Expect = 2e-13
 Identities = 15/69 (21%), Positives = 31/69 (44%)

Query: 35  MPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHPSDGQRIARALEIKLVSGQS 94
                  +  K  + L+     ++++ L   D  +A + HP+D +R+ R LEI   +G+ 
Sbjct: 3   TKSSERKLTRKQLDILESTDPDVIYNTLVKCDPDIATKYHPNDYRRVQRMLEIYYKTGKK 62

Query: 95  IIEFWKQAP 103
             E + +  
Sbjct: 63  PSETFNEQK 71