RPSBLAST alignment of GI: peg_888 and protein with PDBid: 2ze6

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis, plasmid; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Length = 253
 Score = 66.1 bits (161), Expect = 6e-12
 Identities = 18/165 (10%), Positives = 38/165 (23%), Gaps = 30/165 (18%)

Query: 9   YKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSI 68
            K     I+ GG+      +             ++         +        L+     
Sbjct: 87  RKSEEGLILEGGSISLLNCMAKSPFWRSGFQWHVKRLRLGDSDAF--------LTRAKQR 138

Query: 69  VARQIHPSDGQRIARALEIKLVSG--------------QSIIEFWKQAPNPFIPLESAHK 114
           VA      + +  +   E+  +                +  I F ++       L +   
Sbjct: 139 VAEMFAIREDRP-SLLEELAELWNYPAARPILEDIDGYRCAIRFARKHDLAISQLPNIDA 197

Query: 115 ------IIILPERSALKERI-RRRFTQMLESGAIDEIRSLMKMNL 152
                 I  +            R F Q  E GA   +  +    +
Sbjct: 198 GRHVELIEAIANEYLEHALSQERDFPQWPEDGAGQPVCPVTLTRI 242