RPSBLAST alignment of GI: peg_888 and protein with PDBid: 3a8t

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Length = 339
 Score = 80.6 bits (198), Expect = 3e-16
 Identities = 36/222 (16%), Positives = 57/222 (25%), Gaps = 79/222 (35%)

Query: 10  KKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIV 69
            +R LP++VGG+  +  AL                             L D   S    V
Sbjct: 128 GRRKLPVLVGGSNSFIHAL-----------------------------LVDRFDSSGPGV 158

Query: 70  ARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPERSALKERIR 129
             +   S      R     L                           +      L + + 
Sbjct: 159 FEEGSHSVVSSELRYDCCFLW--------------------------VDVSVKVLTDYLA 192

Query: 130 RRFTQMLESGAIDEIRSLMKM-------NLSLDLPIMKAIGVRDIIALLKG--------- 173
           +R   MLE G  DE+             + +    + KAIGV +     +          
Sbjct: 193 KRVDDMLELGMFDELAEFYSPEDEDHDEDSATRTGLRKAIGVPEFDRYFEKFRPGDVEGE 252

Query: 174 --------EINYDETLQRGIIATNKYAKRQKTWLCHQFQADW 207
                      ++E ++     T   AKRQ   +     A W
Sbjct: 253 DPGRDRVRRGAFEEAVRAIKENTCHLAKRQIGKILRLKGAGW 294