RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.888_1 (217 letters) >d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Score = 27.8 bits (60), Expect = 0.74 Identities = 10/46 (21%), Positives = 15/46 (32%) Query: 99 WKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEI 144 I + +L E S L++ I +L S I E Sbjct: 175 NLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEF 220 >d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 163 Score = 27.7 bits (60), Expect = 0.75 Identities = 6/19 (31%), Positives = 12/19 (63%) Query: 38 IPTAIREKIREKLKQYGSH 56 +P + +++K +Q GSH Sbjct: 145 VPPEVELALQQKFRQGGSH 163 >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Score = 27.6 bits (60), Expect = 0.86 Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Query: 2 LSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59 L+++L+ +L +G A G L++M P E++R L Y ++H Sbjct: 99 LAERLREKGVTYLD--APVSGGTSGAEAGTLTVMLGGPEEAVERVRPFLA-YAKKVVH 153 >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Score = 27.5 bits (60), Expect = 1.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 27 ALTGQLSIMPEIPTAIREKIREKLKQYGSHILH 59 A+ G LS+M AI +K + +K ++H Sbjct: 127 AIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVH 159 >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Score = 27.1 bits (59), Expect = 1.2 Identities = 14/61 (22%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Query: 1 MLSKKLQRYKKRFL--PIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHIL 58 + + L P+ G G A G L+ M EK R + G +I Sbjct: 104 KIHAAARERGLAMLDAPVSGGTAG----AAAGTLTFMVGGDAEALEKARPLFEAMGRNIF 159 Query: 59 H 59 H Sbjct: 160 H 160 >d1zl0a1 c.8.10.1 (A:170-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 138 Score = 26.8 bits (59), Expect = 1.4 Identities = 12/74 (16%), Positives = 24/74 (32%) Query: 105 PFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGV 164 A I++L + R+ R Q+LES ++ ++ + + A + Sbjct: 34 LGGLHAPAGSILVLEDVGEPYYRLERSLWQLLESIDARQLGAICLGSFTDCPRKEVAHSL 93 Query: 165 RDIIALLKGEINYD 178 I I Sbjct: 94 ERIFGEYAAAIEVP 107 >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Score = 26.4 bits (56), Expect = 2.1 Identities = 8/19 (42%), Positives = 9/19 (47%) Query: 64 SLDSIVARQIHPSDGQRIA 82 S+ S A P DG IA Sbjct: 1 SIPSKFAEDFSPLDGDLIA 19 >d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Score = 26.0 bits (57), Expect = 2.6 Identities = 5/19 (26%), Positives = 9/19 (47%) Query: 71 RQIHPSDGQRIARALEIKL 89 + P+ G R+A + L Sbjct: 454 YKEDPNYGTRVAEVAKGDL 472 >d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Score = 25.2 bits (55), Expect = 3.9 Identities = 5/18 (27%), Positives = 13/18 (72%) Query: 71 RQIHPSDGQRIARALEIK 88 +++P G R+A+A++ + Sbjct: 457 TRVNPEYGARVAQAIKQQ 474 >d1aopa2 d.58.36.1 (A:346-425) Sulfite reductase, domains 1 and 3 {Escherichia coli [TaxId: 562]} Length = 80 Score = 25.4 bits (56), Expect = 4.4 Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 22 GLYFRALTGQLSIMPEIPTAIREKIREKLKQYG 54 FR Q I+ +P + + KI + K+ G Sbjct: 42 KGDFRITANQNLIIAGVPESEKAKIEKIAKESG 74 >d1y0ya2 c.56.5.4 (A:164-351,A:6-72) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 255 Score = 25.3 bits (55), Expect = 4.5 Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 41 AIREKIREKLKQYGSHILHDELSSL 65 IR+ + E++K Y + D+L ++ Sbjct: 211 GIRDVVIEEIKDYVDEVKVDKLGNV 235 >d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Score = 25.0 bits (53), Expect = 4.9 Identities = 6/46 (13%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Query: 99 WKQAPNPFIPLESAHKIIILPERSALKERIRRRFTQMLESGAIDEI 144 F I + + S K+ + + E+G ++++ Sbjct: 235 LVTTGELFFRSGFG---IGMRKDSPWKQNVSLSILKSHENGFMEDL 277 >d1e85a_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]} Length = 125 Score = 24.9 bits (54), Expect = 5.1 Identities = 7/40 (17%), Positives = 15/40 (37%), Gaps = 9/40 (22%) Query: 140 AIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDE 179 A+ +S + + S + ++KG+ YD Sbjct: 8 AVKYRQSALTLMASH----FGRMT-----PVVKGQAPYDA 38 >d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Score = 24.8 bits (52), Expect = 5.5 Identities = 6/29 (20%), Positives = 13/29 (44%) Query: 116 IILPERSALKERIRRRFTQMLESGAIDEI 144 + P S +++I Q+ E G + + Sbjct: 212 VGTPIGSPYRDKITIAILQLQEEGKLHMM 240 >d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Score = 24.9 bits (54), Expect = 5.7 Identities = 6/19 (31%), Positives = 10/19 (52%) Query: 71 RQIHPSDGQRIARALEIKL 89 I + Q +A+ L I+L Sbjct: 522 AHIDLTLAQAVAKNLGIEL 540 >d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Score = 24.6 bits (52), Expect = 6.0 Identities = 8/29 (27%), Positives = 14/29 (48%) Query: 116 IILPERSALKERIRRRFTQMLESGAIDEI 144 I L + S K +I Q + G ++E+ Sbjct: 239 IALQKGSPWKRQIDLALLQFVGDGEMEEL 267 >d1xp8a2 d.48.1.1 (A:283-341) RecA protein, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Length = 59 Score = 24.5 bits (54), Expect = 7.6 Identities = 4/16 (25%), Positives = 10/16 (62%) Query: 36 PEIPTAIREKIREKLK 51 PE+ IR+++ ++ Sbjct: 44 PEMEQEIRDRVMAAIR 59 >d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Score = 24.2 bits (51), Expect = 8.0 Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 108 PLESAHKIIILPERSALKERIRRRFTQMLESGAIDEI 144 L+S I P+ S+L + ++ E G +D++ Sbjct: 212 NLDSKGYGIATPKGSSLGNAVNLAVLKLNEQGLLDKL 248 >d2a8ea1 d.296.1.1 (A:2-211) Hypothetical protein YktB {Bacillus subtilis [TaxId: 1423]} Length = 210 Score = 24.4 bits (53), Expect = 8.8 Identities = 9/25 (36%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 41 AIREKIREKLKQYGSHILHDELSSL 65 ++E +R KL G H LS+L Sbjct: 24 VLKETVRPKLTALGEHFA-PTLSAL 47 >d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Score = 24.1 bits (52), Expect = 9.1 Identities = 4/16 (25%), Positives = 9/16 (56%) Query: 71 RQIHPSDGQRIARALE 86 ++ P + + +ALE Sbjct: 469 KKADPKYAEGVKKALE 484 >d1q50a_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Leishmania mexicana [TaxId: 5665]} Length = 561 Score = 24.1 bits (51), Expect = 9.8 Identities = 11/95 (11%), Positives = 25/95 (26%), Gaps = 3/95 (3%) Query: 113 HKIIILPERSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLK 172 H + + ++E D + + ++ L +M +IG + + L Sbjct: 251 HFVALSTNTEKVREFGIDTVNMF---AFWDWVGGRYSVWSAIGLSVMLSIGYDNFVEFLT 307 Query: 173 GEINYDETLQRGIIATNKYAKRQKTWLCHQFQADW 207 G D N + + Sbjct: 308 GAHVMDNHFASTPTEQNLPMMLALVGIWYNNFFGS 342 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.139 0.399 Gapped Lambda K H 0.267 0.0470 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 858,395 Number of extensions: 41427 Number of successful extensions: 158 Number of sequences better than 10.0: 1 Number of HSP's gapped: 158 Number of HSP's successfully gapped: 34 Length of query: 217 Length of database: 2,407,596 Length adjustment: 82 Effective length of query: 135 Effective length of database: 1,281,736 Effective search space: 173034360 Effective search space used: 173034360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (24.1 bits)