BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 537021.9.peg.888_1
         (217 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>537021.9.peg.888_1 
          Length = 217

 Score =  439 bits (1130), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/217 (100%), Positives = 217/217 (100%)

Query: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60
           MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD
Sbjct: 1   MLSKKLQRYKKRFLPIIVGGTGLYFRALTGQLSIMPEIPTAIREKIREKLKQYGSHILHD 60

Query: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120
           ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE
Sbjct: 61  ELSSLDSIVARQIHPSDGQRIARALEIKLVSGQSIIEFWKQAPNPFIPLESAHKIIILPE 120

Query: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180
           RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET
Sbjct: 121 RSALKERIRRRFTQMLESGAIDEIRSLMKMNLSLDLPIMKAIGVRDIIALLKGEINYDET 180

Query: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217
           LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF
Sbjct: 181 LQRGIIATNKYAKRQKTWLCHQFQADWIRISSIDDLF 217


>gi|254781045|ref|YP_003065458.1| outer membrane lipoprotein omp19 [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 162

 Score = 24.3 bits (51), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 84  ALEIKLVSGQSIIEFWKQAPNPF 106
           + E+K  SGQ+II F+K A   F
Sbjct: 125 SFELKNKSGQTIIVFYKTAEQSF 147


>gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 360

 Score = 24.3 bits (51), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 37/97 (38%), Gaps = 20/97 (20%)

Query: 20  GTGLYFRAL-TGQLSIMPEIPTAIREKIREKLKQYGSHILHDELSSLDSIVARQIHP--S 76
           G  +YF  L  G  + MP            K++    HI+H E+  +D+  A+ ++   S
Sbjct: 212 GIKVYFVTLHVGAGTFMPV-----------KVEDTDDHIMHSEIGFIDAPTAQALNSVKS 260

Query: 77  DGQRIARALEIKL------VSGQSIIEFWKQAPNPFI 107
            G RI       L       +   II  W    N FI
Sbjct: 261 RGGRIVSVGTTSLRLLETATTEDGIINPWSGFTNIFI 297


>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 675

 Score = 22.3 bits (46), Expect = 6.3,   Method: Composition-based stats.
 Identities = 7/21 (33%), Positives = 16/21 (76%)

Query: 179 ETLQRGIIATNKYAKRQKTWL 199
           E+L  G++++++  ++ KTWL
Sbjct: 223 ESLTYGLVSSSRCLEKLKTWL 243


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.323    0.139    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 134,593
Number of Sequences: 1233
Number of extensions: 5230
Number of successful extensions: 12
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 8
length of query: 217
length of database: 328,796
effective HSP length: 70
effective length of query: 147
effective length of database: 242,486
effective search space: 35645442
effective search space used: 35645442
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 36 (18.5 bits)