RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.905_1 (56 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 30.9 bits (69), Expect = 0.064 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Query: 14 VEYVKHIESIMASLRKEEYEKMKEVRK--SYNSFLKHKASLG 53 +++V ++ A LRKE E EVRK S + L+HK G Sbjct: 731 LQFVPELKEFTAKLRKELVE-TSEVRKAVSIETALEHKVVNG 771 >3cry_A Gamma-glutamyl cyclotransferase; enzyme, oxoproline; 1.70A {Homo sapiens} PDB: 2pn7_A 2rbh_A 2i5t_A* 2q53_A Length = 188 Score = 28.6 bits (63), Expect = 0.33 Identities = 7/31 (22%), Positives = 16/31 (51%) Query: 2 IIIDGLGVHGVDVEYVKHIESIMASLRKEEY 32 II G +G+ +EY + +++I + + Sbjct: 142 IICMGAKENGLPLEYQEKLKAIEPNDYTGKV 172 >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 2hrq_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 1k4y_A* Length = 542 Score = 26.2 bits (56), Expect = 1.7 Identities = 10/41 (24%), Positives = 18/41 (43%) Query: 8 GVHGVDVEYVKHIESIMASLRKEEYEKMKEVRKSYNSFLKH 48 G HG ++ V + +EE K V K + +F ++ Sbjct: 447 GDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARN 487 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.136 0.365 Gapped Lambda K H 0.267 0.0471 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 479,857 Number of extensions: 15938 Number of successful extensions: 115 Number of sequences better than 10.0: 1 Number of HSP's gapped: 115 Number of HSP's successfully gapped: 11 Length of query: 56 Length of database: 5,693,230 Length adjustment: 28 Effective length of query: 28 Effective length of database: 5,014,398 Effective search space: 140403144 Effective search space used: 140403144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.7 bits)