BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.91_1 (46 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.91_1 Length = 46 Score = 94.0 bits (232), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 46/46 (100%), Positives = 46/46 (100%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL Sbjct: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKVIRTLFL 46 >gi|254780215|ref|YP_003064628.1| hypothetical protein CLIBASIA_00500 [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 79.7 bits (195), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 37/40 (92%), Positives = 39/40 (97%) Query: 1 MLINTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIKV 40 MLI+THCH LLPDFDEDRH+VIMRAHQANVLKMIAIAIKV Sbjct: 1 MLIDTHCHLLLPDFDEDRHDVIMRAHQANVLKMIAIAIKV 40 >gi|254781024|ref|YP_003065437.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 22.3 bits (46), Expect = 1.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 8 HFLLPDF-DEDRHNVIMRAHQANVLKMIAIAIKV 40 HF LPDF D H ++ LK A A+ V Sbjct: 103 HFCLPDFMDNKEHYIVSLGQVCRWLKNKAEALGV 136 >gi|254780573|ref|YP_003064986.1| cysteinyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.2 bits (43), Expect = 3.7, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%) Query: 4 NTHCHFLLPDFDEDRHNVIMRAHQANVLKMIAIAIK 39 +T H LLP F+ H + + + ++ K I+IAI+ Sbjct: 375 STKNHDLLPIFNASAHILGIEVCKEHLNKNISIAIE 410 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.338 0.145 0.442 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,961 Number of Sequences: 1233 Number of extensions: 589 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 46 length of database: 328,796 effective HSP length: 19 effective length of query: 27 effective length of database: 305,369 effective search space: 8244963 effective search space used: 8244963 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 31 (16.5 bits)