Query 537021.9.peg.911_1 Match_columns 47 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 06:25:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_911.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG4882 Predicted aminopeptida 21.9 52 0.0013 15.9 1.6 16 8-23 156-171 (486) 2 TIGR01121 D_amino_aminoT D-ami 18.4 74 0.0019 15.2 1.8 40 5-44 45-86 (278) 3 pfam08593 MUG2_C Meiotically u 15.5 30 0.00077 17.0 -0.8 32 2-42 45-78 (94) 4 pfam03614 Flag1_repress Repres 15.4 79 0.002 15.1 1.3 14 10-23 61-74 (165) 5 pfam04772 Flu_B_M2 Influenza B 13.0 1.2E+02 0.0031 14.2 1.7 14 23-36 8-21 (109) 6 pfam08655 DASH_Ask1 DASH compl 11.7 49 0.0013 16.0 -0.6 31 2-32 29-59 (66) 7 TIGR00583 mre11 DNA repair pro 11.2 1E+02 0.0026 14.6 0.8 10 16-25 375-384 (424) 8 pfam06123 CreD Inner membrane 10.6 1.2E+02 0.003 14.3 1.0 13 21-33 298-310 (430) 9 pfam04988 AKAP95 A-kinase anch 10.2 1.6E+02 0.0041 13.6 1.6 17 25-41 108-124 (165) 10 PRK11715 hypothetical protein; 10.1 1.2E+02 0.0031 14.2 1.0 11 21-31 295-305 (427) No 1 >COG4882 Predicted aminopeptidase, Iap family [General function prediction only] Probab=21.93 E-value=52 Score=15.92 Aligned_cols=16 Identities=50% Similarity=0.688 Sum_probs=13.2 Q ss_pred HHHHCCCCEEEEEEEH Q ss_conf 9851466458898504 Q 537021.9.peg.9 8 ERYAKGANRIRLKVKY 23 (47) Q Consensus 8 eryakganrirlkvky 23 (47) -+|++|+.|+||++.- T Consensus 156 ~~y~~~~~rvrl~vD~ 171 (486) T COG4882 156 SRYAEEAGRVRLWVDA 171 (486) T ss_pred CHHHCCCEEEEEEEEC T ss_conf 1122446069999851 No 2 >TIGR01121 D_amino_aminoT D-amino acid aminotransferase; InterPro: IPR005784 D-amino acid aminotransferase (2.6.1.21 from EC) catalyzes transamination between various D-amino acids and alpha-keto acids. This enzyme is a homodimer. The pyridoxal phosphate attachment site is a Lys in the motif Cys-Asp-Ile-Lys-Ser-Leu-Asn. Specificity is broad for various D-amino acids, and differs among members of the family .; GO: 0008483 transaminase activity, 0008152 metabolic process. Probab=18.43 E-value=74 Score=15.20 Aligned_cols=40 Identities=33% Similarity=0.463 Sum_probs=33.7 Q ss_pred HHHHHHHCCCCEEEEEEEHHHHHH--HHHHHHHCCCCCCCCE Q ss_conf 989985146645889850479899--9997633010000101 Q 537021.9.peg.9 5 SQVERYAKGANRIRLKVKYSILFL--ILSALHLKNKVRYGAV 44 (47) Q Consensus 5 sqveryakganrirlkvkysilfl--ilsalhlknkvrygav 44 (47) -..+|.-+.|..|+|..-||.--| .|..|--+|.++-|.| T Consensus 45 EHi~Rly~SA~~I~l~lpys~~~L~~~L~~Lv~~N~~~~G~v 86 (278) T TIGR01121 45 EHIDRLYASAAEIRLDLPYSKEELHELLHELVEENNINTGGV 86 (278) T ss_pred HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCE T ss_conf 789999851877413447677899999999998628657957 No 3 >pfam08593 MUG2_C Meiotically up-regulated C-terminal. This is the C-terminal part of some meiotically up-regulated gene products from fungi. The actual function is not yet known. The proteins are likely to be cell-surface glycoproteins and may bes situated close to telomeres, hence their being expressed during meiosis. Probab=15.46 E-value=30 Score=17.01 Aligned_cols=32 Identities=31% Similarity=0.395 Sum_probs=20.9 Q ss_pred HHHH--HHHHHHCCCCEEEEEEEHHHHHHHHHHHHHCCCCCCC Q ss_conf 0799--8998514664588985047989999976330100001 Q 537021.9.peg.9 2 EIVS--QVERYAKGANRIRLKVKYSILFLILSALHLKNKVRYG 42 (47) Q Consensus 2 eivs--qveryakganrirlkvkysilflilsalhlknkvryg 42 (47) ++.| |+-||-.|-+ |-|---+.+++|++.||. T Consensus 45 d~Ls~~qc~~yL~Gy~---------v~~~~neti~lK~rL~da 78 (94) T pfam08593 45 DILSKEQCSRYLPGYG---------VEFHPNETLFLKLRLLDA 78 (94) T ss_pred HHCCHHHHHHHHCCCC---------CCCCCHHHHHHHHHHHHH T ss_conf 4338999998841368---------644833779999999987 No 4 >pfam03614 Flag1_repress Repressor of phase-1 flagellin. Probab=15.37 E-value=79 Score=15.08 Aligned_cols=14 Identities=43% Similarity=0.560 Sum_probs=11.2 Q ss_pred HHCCCCEEEEEEEH Q ss_conf 51466458898504 Q 537021.9.peg.9 10 YAKGANRIRLKVKY 23 (47) Q Consensus 10 yakganrirlkvky 23 (47) -+||.|||++|... T Consensus 61 ~~kg~nRievkLE~ 74 (165) T pfam03614 61 PFKGENRIEVKLER 74 (165) T ss_pred CCCCCCEEEEEHHH T ss_conf 87777557875466 No 5 >pfam04772 Flu_B_M2 Influenza B matrix protein 2 (BM2). M2 is synthesized in the late phase of infection and incorporated into the virion. It may be phosphorylated in vivo. The function of BM2 is unknown. Probab=12.96 E-value=1.2e+02 Score=14.20 Aligned_cols=14 Identities=57% Similarity=0.645 Sum_probs=9.9 Q ss_pred HHHHHHHHHHHHHC Q ss_conf 47989999976330 Q 537021.9.peg.9 23 YSILFLILSALHLK 36 (47) Q Consensus 23 ysilflilsalhlk 36 (47) .||.-.||||||.- T Consensus 8 lsicsfilsalhfm 21 (109) T pfam04772 8 LSICSFILSALHFM 21 (109) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999999999 No 6 >pfam08655 DASH_Ask1 DASH complex subunit Ask1. The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules. Probab=11.71 E-value=49 Score=16.03 Aligned_cols=31 Identities=32% Similarity=0.431 Sum_probs=24.1 Q ss_pred HHHHHHHHHHCCCCEEEEEEEHHHHHHHHHH Q ss_conf 0799899851466458898504798999997 Q 537021.9.peg.9 2 EIVSQVERYAKGANRIRLKVKYSILFLILSA 32 (47) Q Consensus 2 eivsqveryakganrirlkvkysilflilsa 32 (47) .|...|++|+.....++-..++.--|.--|| T Consensus 29 ~IlP~v~~Y~~~s~~v~~s~~fwk~ffe~sa 59 (66) T pfam08655 29 KILPAVERYAEVSEKVWDSAKFWKQFFEQSA 59 (66) T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 3145899998861989876799999998643 No 7 >TIGR00583 mre11 DNA repair protein (mre11); InterPro: IPR003701 Mre11 and Rad50 are two proteins required for DNA repair and meiosis-specific double-strand break formation in Saccharomyces cerevisiae. Mre11 by itself has 3' to 5' exonuclease activity that is increased when Mre11 is in a complex with Rad50 . These eukaryotic proteins contain one metallo-phosphoesterase domain followed by an Mre11 DNA-binding domain. S. cerevisiae Mre11 is required for DNA repair and meiosis-specific double-strand break (DSB) formation and has both 3' to 5' exonuclease activity (which increases when in complex with Rad50) and endonuclease activity. The N-terminal phosphoesterase domain is required for DSB repair, and the carboxyl-terminal dsDNA-binding domain is essential during meiosis for chromatin modification and DSB formation . Schizosaccharomyces pombe rad32 is required for repair of double strand breaks and recombination . For additional information please see . ; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process. Probab=11.21 E-value=1e+02 Score=14.56 Aligned_cols=10 Identities=60% Similarity=0.747 Sum_probs=7.2 Q ss_pred EEEEEEEHHH Q ss_conf 5889850479 Q 537021.9.peg.9 16 RIRLKVKYSI 25 (47) Q Consensus 16 rirlkvkysi 25 (47) -|||||-|+- T Consensus 375 LiRLkVdY~g 384 (424) T TIGR00583 375 LIRLKVDYTG 384 (424) T ss_pred EEEEEEEECC T ss_conf 1456887458 No 8 >pfam06123 CreD Inner membrane protein CreD. This family consists of several bacterial CreD or Cet inner membrane proteins. Dominant mutations of the cet gene of Escherichia coli result in tolerance to colicin E2 and increased amounts of an inner membrane protein with an Mr of 42,000. The cet gene is shown to be in the same operon as the phoM gene, which is required in a phoR background for expression of the structural gene for alkaline phosphatase, phoA. Although the Cet protein is not required for phoA expression, it has been suggested that the Cet protein has an enhancing effect on the transcription of phoA. Probab=10.64 E-value=1.2e+02 Score=14.30 Aligned_cols=13 Identities=54% Similarity=0.991 Sum_probs=10.2 Q ss_pred EEHHHHHHHHHHH Q ss_conf 5047989999976 Q 537021.9.peg.9 21 VKYSILFLILSAL 33 (47) Q Consensus 21 vkysilflilsal 33 (47) +||.|||..|+-+ T Consensus 298 ~KYgiLFI~LTF~ 310 (430) T pfam06123 298 IKYGILFIALTFL 310 (430) T ss_pred HHHHHHHHHHHHH T ss_conf 8688999999999 No 9 >pfam04988 AKAP95 A-kinase anchoring protein 95 (AKAP95). A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA. Probab=10.17 E-value=1.6e+02 Score=13.62 Aligned_cols=17 Identities=24% Similarity=0.102 Sum_probs=7.2 Q ss_pred HHHHHHHHHHHCCCCCC Q ss_conf 98999997633010000 Q 537021.9.peg.9 25 ILFLILSALHLKNKVRY 41 (47) Q Consensus 25 ilflilsalhlknkvry 41 (47) |..-+-|..|.+|+.+| T Consensus 108 iq~Hl~S~~H~~nrr~~ 124 (165) T pfam04988 108 LQKHLKSPDHNKNRRAM 124 (165) T ss_pred HHHHHCCHHHHHHHHHH T ss_conf 99996576267779999 No 10 >PRK11715 hypothetical protein; Provisional Probab=10.12 E-value=1.2e+02 Score=14.17 Aligned_cols=11 Identities=55% Similarity=1.047 Sum_probs=0.0 Q ss_pred EEHHHHHHHHH Q ss_conf 50479899999 Q 537021.9.peg.9 21 VKYSILFLILS 31 (47) Q Consensus 21 vkysilflils 31 (47) +||.|||..|+ T Consensus 295 ~KYgiLFI~LT 305 (427) T PRK11715 295 TKYAILFIALT 305 (427) T ss_pred HHHHHHHHHHH T ss_conf 86888999999 Done!