BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.912_1 (47 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|315122001|ref|YP_004062490.1| phage-related integrase/recombinase [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495403|gb|ADR52002.1| phage-related integrase/recombinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Query: 11 PHHKDPNT-----ALYREKSHWTGLVSATRRNLDLHFNKIVQ 47 P K+P T + YR+ +HW L +R+ LDL+F++I++ Sbjct: 45 PQKKEPQTLRWFISQYRKSAHWASLTLNSRKRLDLYFDQIIK 86 Searching..................................................done Results from round 2 CONVERGED! >gi|315122001|ref|YP_004062490.1| phage-related integrase/recombinase [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495403|gb|ADR52002.1| phage-related integrase/recombinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Score = 38.1 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Query: 11 PHHKDPNT-----ALYREKSHWTGLVSATRRNLDLHFNKIVQ 47 P K+P T + YR+ +HW L +R+ LDL+F++I++ Sbjct: 45 PQKKEPQTLRWFISQYRKSAHWASLTLNSRKRLDLYFDQIIK 86 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.321 0.132 0.412 Lambda K H 0.267 0.0405 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 821,982,389 Number of Sequences: 13984884 Number of extensions: 19232589 Number of successful extensions: 40120 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 40120 Number of HSP's gapped (non-prelim): 2 length of query: 47 length of database: 4,792,584,752 effective HSP length: 21 effective length of query: 26 effective length of database: 4,498,902,188 effective search space: 116971456888 effective search space used: 116971456888 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 75 (33.5 bits)