BLASTP 2.2.22 [Sep-27-2009]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,
Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.
Query= 537021.9.peg.912_1
(47 letters)
Database: nr
13,984,884 sequences; 4,792,584,752 total letters
Searching..................................................done
Results from round 1
>gi|315122001|ref|YP_004062490.1| phage-related integrase/recombinase [Candidatus Liberibacter
solanacearum CLso-ZC1]
gi|313495403|gb|ADR52002.1| phage-related integrase/recombinase [Candidatus Liberibacter
solanacearum CLso-ZC1]
Length = 102
Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 5/42 (11%)
Query: 11 PHHKDPNT-----ALYREKSHWTGLVSATRRNLDLHFNKIVQ 47
P K+P T + YR+ +HW L +R+ LDL+F++I++
Sbjct: 45 PQKKEPQTLRWFISQYRKSAHWASLTLNSRKRLDLYFDQIIK 86
Searching..................................................done
Results from round 2
CONVERGED!
>gi|315122001|ref|YP_004062490.1| phage-related integrase/recombinase [Candidatus Liberibacter
solanacearum CLso-ZC1]
gi|313495403|gb|ADR52002.1| phage-related integrase/recombinase [Candidatus Liberibacter
solanacearum CLso-ZC1]
Length = 102
Score = 38.1 bits (87), Expect = 0.40, Method: Composition-based stats.
Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 5/42 (11%)
Query: 11 PHHKDPNT-----ALYREKSHWTGLVSATRRNLDLHFNKIVQ 47
P K+P T + YR+ +HW L +R+ LDL+F++I++
Sbjct: 45 PQKKEPQTLRWFISQYRKSAHWASLTLNSRKRLDLYFDQIIK 86
Database: nr
Posted date: May 13, 2011 4:10 AM
Number of letters in database: 999,999,932
Number of sequences in database: 2,987,209
Database: /data/usr2/db/fasta/nr.01
Posted date: May 13, 2011 4:17 AM
Number of letters in database: 999,998,956
Number of sequences in database: 2,896,973
Database: /data/usr2/db/fasta/nr.02
Posted date: May 13, 2011 4:23 AM
Number of letters in database: 999,999,979
Number of sequences in database: 2,907,862
Database: /data/usr2/db/fasta/nr.03
Posted date: May 13, 2011 4:29 AM
Number of letters in database: 999,999,513
Number of sequences in database: 2,932,190
Database: /data/usr2/db/fasta/nr.04
Posted date: May 13, 2011 4:33 AM
Number of letters in database: 792,586,372
Number of sequences in database: 2,260,650
Lambda K H
0.321 0.132 0.412
Lambda K H
0.267 0.0405 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 821,982,389
Number of Sequences: 13984884
Number of extensions: 19232589
Number of successful extensions: 40120
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 40120
Number of HSP's gapped (non-prelim): 2
length of query: 47
length of database: 4,792,584,752
effective HSP length: 21
effective length of query: 26
effective length of database: 4,498,902,188
effective search space: 116971456888
effective search space used: 116971456888
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 75 (33.5 bits)