BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.912_1 (47 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.912_1 Length = 47 Score = 100 bits (248), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 1 MNRESFRTRLPHHKDPNTALYREKSHWTGLVSATRRNLDLHFNKIVQ 47 MNRESFRTRLPHHKDPNTALYREKSHWTGLVSATRRNLDLHFNKIVQ Sbjct: 1 MNRESFRTRLPHHKDPNTALYREKSHWTGLVSATRRNLDLHFNKIVQ 47 >gi|254780134|ref|YP_003064547.1| phage-related integrase/recombinase [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 25.4 bits (54), Expect = 0.16, Method: Compositional matrix adjust. Identities = 8/27 (29%), Positives = 18/27 (66%) Query: 21 YREKSHWTGLVSATRRNLDLHFNKIVQ 47 YR+ +HW L +R + + +F++I++ Sbjct: 78 YRKSAHWGSLAVNSRISFESYFDQIIR 104 >gi|254780361|ref|YP_003064774.1| ribosomal protein L32 [Candidatus Liberibacter asiaticus str. psy62] Length = 61 Score = 23.5 bits (49), Expect = 0.76, Method: Compositional matrix adjust. Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 2 NRESFRTRLPHHKDPNTALYR 22 +++S R PHH D T LYR Sbjct: 30 DKKSGELRRPHHVDMKTGLYR 50 >gi|254780190|ref|YP_003064603.1| fumarate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 463 Score = 21.2 bits (43), Expect = 3.2, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Query: 12 HHKDPNTALYREKSHWTGLVSATRRNLDLHFNKIV 46 HH N+ +E++ +GL+SAT +L + K++ Sbjct: 429 HH---NSTTLKEEAIASGLISATEYDLIVKPEKMI 460 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.132 0.412 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,716 Number of Sequences: 1233 Number of extensions: 710 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 47 length of database: 328,796 effective HSP length: 20 effective length of query: 27 effective length of database: 304,136 effective search space: 8211672 effective search space used: 8211672 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)