Query 537021.9.peg.913_1 Match_columns 102 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 04:08:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_913.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01263 4HPPD 4-hydroxypheny 27.5 20 0.00052 17.4 0.4 15 83-97 256-270 (379) 2 TIGR00303 TIGR00303 conserved 20.1 34 0.00088 16.2 0.3 16 71-86 172-187 (350) 3 PRK13256 thiopurine S-methyltr 18.2 53 0.0014 15.1 1.0 57 32-91 93-153 (226) 4 TIGR00928 purB adenylosuccinat 17.5 44 0.0011 15.6 0.4 18 74-91 293-310 (469) 5 KOG3254 consensus 17.0 27 0.00069 16.7 -0.7 18 82-99 100-117 (211) 6 pfam02267 Rib_hydrolayse ADP-r 15.7 98 0.0025 13.7 1.8 45 4-53 68-112 (243) 7 COG3131 MdoG Periplasmic gluca 15.3 96 0.0024 13.8 1.7 37 25-73 271-308 (534) 8 TIGR00505 ribA GTP cyclohydrol 13.2 53 0.0013 15.2 -0.1 15 82-96 166-180 (227) 9 cd04759 Rib_hydrolase ADP-ribo 11.9 1.3E+02 0.0033 13.1 1.6 46 4-54 68-113 (242) 10 TIGR03391 FeS_syn_CsdE cystein 11.4 1.1E+02 0.0029 13.4 1.1 28 41-68 56-85 (138) No 1 >TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase; InterPro: IPR005956 4-hydroxyphenylpyruvate dioxygenase (1.13.11.27 from EC) oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic . In some bacterial species, this enzyme has been studied as a hemolysin.; GO: 0003868 4-hydroxyphenylpyruvate dioxygenase activity, 0009072 aromatic amino acid family metabolic process. Probab=27.51 E-value=20 Score=17.43 Aligned_cols=15 Identities=47% Similarity=0.614 Sum_probs=12.5 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 143565428877642 Q 537021.9.peg.9 83 FIALLTNNIVKIVKY 97 (102) Q Consensus 83 fialltnnivkivky 97 (102) .|||+||+|++-|+- T Consensus 256 HiAl~t~DI~~tV~~ 270 (379) T TIGR01263 256 HIALNTDDIVRTVRA 270 (379) T ss_pred EEEECCHHHHHHHHH T ss_conf 998150579999999 No 2 >TIGR00303 TIGR00303 conserved hypothetical protein TIGR00303; InterPro: IPR002805 Nicotinate mononucleotide (NaMN):5,6-dimethylbenzimidazole (DMB) phosphoribosyltransferase (CobT) plays a central role in the synthesis of alpha-ribazole-5'-phosphate, an intermediate for the lower ligand of cobalamin . It is one of the enzymes of the anaerobic pathway of cobalamin biosynthesis, and one of the four proteins (CobU, CobT, CobC, and CobS) involved in the synthesis of the lower ligand and the assembly of the nucleotide loop , . Vitamin B_12 (cobalamin) is used as a cofactor in a number of enzyme-catalysed reactions in bacteria, archaea and eukaryotes . The biosynthetic pathway to adenosylcobalamin from its five-carbon precursor, 5-aminolaevulinic acid, can be divided into three sections: (1) the biosynthesis of uroporphyrinogen III from 5-aminolaevulinic acid; (2) the conversion of uroporphyrinogen III into the ring-contracted, deacylated intermediate precorrin 6 or cobalt-precorrin 6; and (3) the transformation of this intermediate to form adenosylcobalamin . Cobalamin is synthesised by bacteria and archaea via two alternative routes that differ primarily in the steps of section 2 that lead to the contraction of the macrocycle and excision of the extruded carbon molecule (and its attached methyl group) . One pathway (exemplified by Pseudomonas denitrificans) incorporates molecular oxygen into the macrocycle as a prerequisite to ring contraction, and has consequently been termed the aerobic pathway. The alternative, anaerobic, route (exemplified by Salmonella typhimurium) takes advantage of a chelated cobalt ion, in the absence of oxygen, to set the stage for ring contraction . This entry represents a group of proteins predicted to have nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase activity.. Probab=20.08 E-value=34 Score=16.18 Aligned_cols=16 Identities=50% Similarity=0.416 Sum_probs=11.2 Q ss_pred EEEEECCCCCHHHHHH Q ss_conf 1465313586021435 Q 537021.9.peg.9 71 ELFKLSSSMPHGFIAL 86 (102) Q Consensus 71 elfklsssmphgfial 86 (102) --||.||||||.=..| T Consensus 172 A~g~VsSS~p~nph~l 187 (350) T TIGR00303 172 AEGKVSSSMPHNPHEL 187 (350) T ss_pred CCCCCCCCCCCCCHHH T ss_conf 5850437888872889 No 3 >PRK13256 thiopurine S-methyltransferase; Reviewed Probab=18.17 E-value=53 Score=15.14 Aligned_cols=57 Identities=12% Similarity=0.310 Sum_probs=43.0 Q ss_pred CCCEEEEEECCCEEEEEECCCCEEEEEC--C--CCCCEEECCCEEEEECCCCCHHHHHHHHHHH Q ss_conf 4761655520515888725651256413--7--6531011553146531358602143565428 Q 537021.9.peg.9 32 SENCFLGFSCDSITFFSCSESSFFSFSA--D--SDSKAMWGRGELFKLSSSMPHGFIALLTNNI 91 (102) Q Consensus 32 sencflgfscdsitffscsessffsfsa--d--sdskamwgrgelfklsssmphgfialltnni 91 (102) ..+-+.-|+.+.|+.+.| .||.++. + ..-.|.|.|+-|..|..+|-.-+...|..-+ T Consensus 93 ~~~~~~~y~~~~I~i~~G---D~F~L~~~~~~lg~~daiYDRAALVALP~~mR~~Ya~~L~~ll 153 (226) T PRK13256 93 HGNDYKLYKGDDIEIYVA---DIFNLPKIANNLPVFDIWYDRGAYIALPNDLRTNYAKMMLEVC 153 (226) T ss_pred CCCCCEEEECCCEEEEEC---CCCCCCCHHCCCCCCCEEEEEHHHHCCCHHHHHHHHHHHHHHC T ss_conf 378812885188769963---6215862011576403697402253199899999999999865 No 4 >TIGR00928 purB adenylosuccinate lyase; InterPro: IPR004769 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown , to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes. Adenylosuccinate lyase is involved in purine ribonucleotide biosynthesis.; GO: 0004018 adenylosuccinate lyase activity, 0009152 purine ribonucleotide biosynthetic process. Probab=17.46 E-value=44 Score=15.62 Aligned_cols=18 Identities=28% Similarity=0.281 Sum_probs=10.1 Q ss_pred EECCCCCHHHHHHHHHHH Q ss_conf 531358602143565428 Q 537021.9.peg.9 74 KLSSSMPHGFIALLTNNI 91 (102) Q Consensus 74 klsssmphgfialltnni 91 (102) +=||.|||--=..-.-|+ T Consensus 293 ~GSSaMPHKrNPI~~E~~ 310 (469) T TIGR00928 293 VGSSAMPHKRNPIDSERV 310 (469) T ss_pred CCCCCCCCCCCCCHHHHH T ss_conf 777788899988416556 No 5 >KOG3254 consensus Probab=17.03 E-value=27 Score=16.74 Aligned_cols=18 Identities=39% Similarity=0.539 Sum_probs=11.5 Q ss_pred HHHHHHHHHHHHHHHHHC Q ss_conf 214356542887764222 Q 537021.9.peg.9 82 GFIALLTNNIVKIVKYFF 99 (102) Q Consensus 82 gfialltnnivkivkyff 99 (102) -|-+|+.||++-..++|. T Consensus 100 t~R~l~~N~v~GVt~g~~ 117 (211) T KOG3254 100 TFRALLANNVKGVTMGFL 117 (211) T ss_pred HHHHHHHCCCHHHHHHHH T ss_conf 899987523000215453 No 6 >pfam02267 Rib_hydrolayse ADP-ribosyl cyclase. ADP-ribosyl cyclase EC:3.2.2.5 (also know as cyclic ADP-ribose hydrolase or CD38) synthesizes cyclic-ADP ribose, a second messenger for glucose-induced insulin secretion. Probab=15.72 E-value=98 Score=13.69 Aligned_cols=45 Identities=22% Similarity=0.430 Sum_probs=28.5 Q ss_pred EEEECCCHHHHHHHHHHHHCCCCEEEEECCCEEEEEECCCEEEEEECCCC Q ss_conf 88850009999999999853841257624761655520515888725651 Q 537021.9.peg.9 4 LLFWENVFFITIFSFLALFGSSVSFFSCSENCFLGFSCDSITFFSCSESS 53 (102) Q Consensus 4 llfwenvffitifsflalfgssvsffscsencflgfscdsitffscsess 53 (102) -|||+++.-+ ..-+.....-|---|+-|+|+--|.+++-...+++ T Consensus 68 slFWS~t~~l-----vh~y~~~~~~~~tLEdTl~Gyl~d~L~WCG~~~~~ 112 (243) T pfam02267 68 TLFWSKVKDL-----VHDYAEVQRDFITLEDTLLGYMADDLSWCGQRNAS 112 (243) T ss_pred CEEECCHHHH-----HHHHHHHCCCEEEHHHCCHHHHHCCCEECCCCCCC T ss_conf 3575152799-----99999745748866541102331565566899999 No 7 >COG3131 MdoG Periplasmic glucans biosynthesis protein [Inorganic ion transport and metabolism] Probab=15.30 E-value=96 Score=13.75 Aligned_cols=37 Identities=35% Similarity=0.445 Sum_probs=23.5 Q ss_pred CCEEEEECCCEEEEEECCCEEEEEECCCCEEEEECCCCCCEEE-CCCEEE Q ss_conf 4125762476165552051588872565125641376531011-553146 Q 537021.9.peg.9 25 SVSFFSCSENCFLGFSCDSITFFSCSESSFFSFSADSDSKAMW-GRGELF 73 (102) Q Consensus 25 svsffscsencflgfscdsitffscsessffsfsadsdskamw-grgelf 73 (102) -.|.|.|+||-- -.|| .+-.--.|||.-+|| |+||-. T Consensus 271 ~TSMf~~g~N~r--~~~~----------d~RPeiHDSdGL~m~~GnGEwI 308 (534) T COG3131 271 LTSMFLFGENQR--RMTD----------DWRPEIHDSDGLSMWRGNGEWI 308 (534) T ss_pred CCEEEEECCCCC--CCCC----------CCCCCCCCCCCEEEEECCCCEE T ss_conf 200045558988--6556----------6686301687646870686078 No 8 >TIGR00505 ribA GTP cyclohydrolase II; InterPro: IPR000926 GTP cyclohydrolase II catalyses the first committed step in the biosynthesis of riboflavin. The enzyme converts GTP and water to formate, 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)- pyrimidine and pyrophosphate, and requires magnesium as a cofactor. It is sometimes found as a bifunctional enzyme with 3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP_synthase) IPR000422 from INTERPRO. ; GO: 0003935 GTP cyclohydrolase II activity, 0009231 riboflavin biosynthetic process. Probab=13.23 E-value=53 Score=15.18 Aligned_cols=15 Identities=47% Similarity=0.410 Sum_probs=11.1 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 214356542887764 Q 537021.9.peg.9 82 GFIALLTNNIVKIVK 96 (102) Q Consensus 82 gfialltnnivkivk 96 (102) +-+-|||||--||-. T Consensus 166 ~~vRLLTNNP~Ki~~ 180 (227) T TIGR00505 166 KKVRLLTNNPKKIEE 180 (227) T ss_pred CEEEECCCCHHHHHH T ss_conf 727741689689999 No 9 >cd04759 Rib_hydrolase ADP-ribosyl cyclase (also known as cyclic ADP-ribose hydrolase or CD38) synthesizes the second messenger cyclic-ADP ribose (cADPR), which in turn releases calcium from internal stores. Mammals possess two membrane proteins, CD38 and BST-1/CD157, which exhibit ADP-ribosyl cyclase function, as well as intracellular soluble ADP-ribose cyclases. CD38 is involved in differentiation, adhesion, and cell proliferation, as well as diseases such as AIDS, diabetes, and B-cell chronic lymphocytic leukemia. The extramembrane domain of CD38 acts as a multifunctional enzyme and can synthesize cADPR from NAD+, hydrolyze NAD+, and cADPR to ADPR, as well as catalyze the exchange of the nicotinamide group of NADP+ with nicotinic acid under acidic conditions to yield NAADP+ (nicotinic acid-adenine dinucleotide phosphate), a metabolite involved in Ca2+ mobilization from acidic stores. Probab=11.92 E-value=1.3e+02 Score=13.07 Aligned_cols=46 Identities=26% Similarity=0.408 Sum_probs=30.0 Q ss_pred EEEECCCHHHHHHHHHHHHCCCCEEEEECCCEEEEEECCCEEEEEECCCCE Q ss_conf 888500099999999998538412576247616555205158887256512 Q 537021.9.peg.9 4 LLFWENVFFITIFSFLALFGSSVSFFSCSENCFLGFSCDSITFFSCSESSF 54 (102) Q Consensus 4 llfwenvffitifsflalfgssvsffscsencflgfscdsitffscsessf 54 (102) -|||+++.-+ ..-+.....-|---|+-|+|+--|.+++-..+.++= T Consensus 68 slFWS~~~~l-----vh~y~~~~~~~~tLEdTl~Gyl~d~L~WCG~~~~sg 113 (242) T cd04759 68 TLFWSKVNDL-----AHQYAKVQRDFFTLEDTLLGYMADELSWCGQSDSSG 113 (242) T ss_pred CEEECCHHHH-----HHHHHHHCCCEEEHHHCCHHHHHCCCEECCCCCCCC T ss_conf 2575261799-----999998447487565511134423666568989999 No 10 >TIGR03391 FeS_syn_CsdE cysteine desulfurase, sulfur acceptor subunit CsdE. Members of this protein family are CsdE, formerly called YgdK. This protein, found as a paralog to SufE in Escherichia coli, Yersinia pestis, Photorhabdus luminescens, and related species, works together and physically interacts with CsdA (a paralog of SufS). CsdA has cysteine desulfurase activity that is enhanced by this protein (CsdE), in which Cys-61 (numbered as in E. coli) is a sulfur acceptor site. This gene pair, although involved in FeS cluster biosynthesis, is not found next to other such genes as are its paralogs from the Suf or Isc systems. Probab=11.37 E-value=1.1e+02 Score=13.35 Aligned_cols=28 Identities=18% Similarity=0.497 Sum_probs=0.0 Q ss_pred CCCEEEEEEC--CCCEEEEECCCCCCEEEC Q ss_conf 0515888725--651256413765310115 Q 537021.9.peg.9 41 CDSITFFSCS--ESSFFSFSADSDSKAMWG 68 (102) Q Consensus 41 cdsitffscs--essffsfsadsdskamwg 68 (102) |.|-.+..+. +..-+.|.+|||+.-+-| T Consensus 56 C~S~vWl~~~~~~dg~~~f~~DSDA~IvkG 85 (138) T TIGR03391 56 CENRVWLGHQVLPDGTLHFYGDSEGRIVRG 85 (138) T ss_pred CCCCEEEEEEECCCCEEEEEECCCHHHHHH T ss_conf 633346766665898799984460799999 Done!