BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.913_1 (102 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.913_1 Length = 102 Score = 196 bits (498), Expect = 7e-53, Method: Compositional matrix adjust. Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 VYFLLFWENVFFITIFSFLALFGSSVSFFSCSENCFLGFSCDSITFFSCSESSFFSFSAD 60 VYFLLFWENVFFITIFSFLALFGSSVSFFSCSENCFLGFSCDSITFFSCSESSFFSFSAD Sbjct: 1 VYFLLFWENVFFITIFSFLALFGSSVSFFSCSENCFLGFSCDSITFFSCSESSFFSFSAD 60 Query: 61 SDSKAMWGRGELFKLSSSMPHGFIALLTNNIVKIVKYFFIPS 102 SDSKAMWGRGELFKLSSSMPHGFIALLTNNIVKIVKYFFIPS Sbjct: 61 SDSKAMWGRGELFKLSSSMPHGFIALLTNNIVKIVKYFFIPS 102 >537021.9.peg.916_1 Length = 46 Score = 25.4 bits (54), Expect = 0.22, Method: Compositional matrix adjust. Identities = 11/17 (64%), Positives = 16/17 (94%) Query: 44 ITFFSCSESSFFSFSAD 60 +TFFSCS+++FFSFS + Sbjct: 3 VTFFSCSKNAFFSFSDN 19 Score = 21.9 bits (45), Expect = 2.4, Method: Compositional matrix adjust. Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 26 VSFFSCSENCFLGFS 40 V+FFSCS+N F FS Sbjct: 3 VTFFSCSKNAFFSFS 17 >gi|254780974|ref|YP_003065387.1| adenylosuccinate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 435 Score = 23.9 bits (50), Expect = 0.74, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Query: 74 KLSSSMPHGFIALLTNNIV---KIVKYFFIPS 102 K SSSMPH +LT N+ ++++ IP+ Sbjct: 263 KGSSSMPHKRNPILTENLTGLSRLIRSHVIPA 294 >gi|254780918|ref|YP_003065331.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 21.2 bits (43), Expect = 3.8, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 63 SKAMWGRGELFKLSSSMPHGFIALLTNNI 91 ++ + R +L+K S + HG + + NNI Sbjct: 443 ARLWYRRKKLWKRSKRLQHGGVIMGINNI 471 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 15/34 (44%) Query: 29 FSCSENCFLGFSCDSITFFSCSESSFFSFSADSD 62 F C + C FS + +S E++F + D Sbjct: 580 FKCVDTCAGEFSSPTSYMYSTYETNFINKPVSED 613 >gi|254781159|ref|YP_003065572.1| hypothetical protein CLIBASIA_05330 [Candidatus Liberibacter asiaticus str. psy62] Length = 67 Score = 20.0 bits (40), Expect = 9.8, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 6 FWENVFFITIFSFLAL 21 W VF IT+FS + L Sbjct: 1 MWRRVFAITLFSSIPL 16 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.141 0.454 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,034 Number of Sequences: 1233 Number of extensions: 2041 Number of successful extensions: 15 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 102 length of database: 328,796 effective HSP length: 62 effective length of query: 40 effective length of database: 252,350 effective search space: 10094000 effective search space used: 10094000 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 32 (16.9 bits)