BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.930_1 (51 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.930_1 Length = 51 Score = 102 bits (255), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MAFFFNNYNLDERGRFFCYFLSLLIVDTLRSFSLFQHLWLKRLSSILVQND 51 MAFFFNNYNLDERGRFFCYFLSLLIVDTLRSFSLFQHLWLKRLSSILVQND Sbjct: 1 MAFFFNNYNLDERGRFFCYFLSLLIVDTLRSFSLFQHLWLKRLSSILVQND 51 >gi|254781113|ref|YP_003065526.1| amino acid ABC transporter (permease) [Candidatus Liberibacter asiaticus str. psy62] Length = 226 Score = 21.6 bits (44), Expect = 2.4, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 16 FFCYFLSLLIVDTLRSFSLFQHLWLKRLSSILVQ 49 FF + + DT+ S + ++W+ R + +LVQ Sbjct: 40 FFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQ 73 >gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus str. psy62] Length = 290 Score = 21.2 bits (43), Expect = 3.8, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 11 DERGRFFCYFLSLLIVDTLRSFSL 34 +E F C ++ ++IV RS+ + Sbjct: 120 NELTTFICDYMRMIIVGNARSYEI 143 >gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Score = 20.4 bits (41), Expect = 5.4, Method: Compositional matrix adjust. Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 14 GRFFCYFLSLLIVDTLRSFSLFQHLW 39 GR+F ++ ++++ F+L LW Sbjct: 156 GRYFIASIAPIVINVFPIFALTYALW 181 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.338 0.148 0.471 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,314 Number of Sequences: 1233 Number of extensions: 949 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 51 length of database: 328,796 effective HSP length: 24 effective length of query: 27 effective length of database: 299,204 effective search space: 8078508 effective search space used: 8078508 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 31 (16.5 bits)