Query 537021.9.peg.931_1 Match_columns 45 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 04:08:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_931.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR01742 SA_tandem_lipo Staph 37.4 6.1 0.00016 20.9 -1.0 37 3-44 145-181 (267) 2 pfam05346 DUF747 Eukaryotic me 33.0 42 0.0011 16.4 2.7 29 10-38 141-169 (320) 3 KOG1467 consensus 20.9 72 0.0018 15.1 2.1 19 17-35 250-268 (556) 4 TIGR00525 folB dihydroneopteri 17.7 84 0.0021 14.8 1.9 22 22-43 67-88 (118) 5 KOG2052 consensus 15.6 1.1E+02 0.0028 14.1 2.8 32 8-41 391-422 (513) 6 COG5346 Predicted membrane pro 15.4 1.1E+02 0.0028 14.1 3.9 38 4-42 64-109 (136) 7 KOG4120 consensus 13.6 83 0.0021 14.8 1.0 34 11-44 273-313 (426) 8 TIGR01561 gde_arch glycogen de 11.3 1.5E+02 0.0038 13.4 1.7 15 23-37 254-268 (575) 9 pfam08583 Cmc1 Cytochrome c ox 11.0 1.5E+02 0.0039 13.4 1.7 17 17-33 7-23 (69) 10 KOG1692 consensus 10.1 1E+02 0.0026 14.3 0.5 11 32-42 168-178 (201) No 1 >TIGR01742 SA_tandem_lipo Staphylococcus tandem lipoproteins; InterPro: IPR007595 This family contains several uncharacterised staphylococcal proteins.. Probab=37.37 E-value=6.1 Score=20.89 Aligned_cols=37 Identities=46% Similarity=0.652 Sum_probs=30.2 Q ss_pred CCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 340236666411100101059999999999999999998524 Q 537021.9.peg.9 3 IKNQAVLTKKVDDKNQANARCADLIESFALVILWSIFKKLKN 44 (45) Q Consensus 3 iknqavltkkvddknqanarcadliesfalvilwsifkklkn 44 (45) .-|.-|+||.|.|++--+ -||+|.+.+-..=|+.|.| T Consensus 145 vnNkIv~~k~vkD~~LK~-----~IEnf~ff~QyG~l~~l~~ 181 (267) T TIGR01742 145 VNNKIVLTKDVKDKNLKK-----EIENFKFFIQYGNLKELKN 181 (267) T ss_pred ECCEEEEECCCCCHHHHH-----HHHHHHHHHEECCCHHHHH T ss_conf 636388623732656644-----5421000010013022422 No 2 >pfam05346 DUF747 Eukaryotic membrane protein family. This family is a family of eukaryotic membrane proteins. It was previously annotated as including a putative receptor for human cytomegalovirus gH but this has has since been disputed. Analysis of the mouse Tapt1 protein (transmembrane anterior posterior transformation 1) has shown it to be involved in patterning of the vertebrate axial skeleton. Probab=33.00 E-value=42 Score=16.40 Aligned_cols=29 Identities=34% Similarity=0.618 Sum_probs=23.7 Q ss_pred HHHHCCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66411100101059999999999999999 Q 537021.9.peg.9 10 TKKVDDKNQANARCADLIESFALVILWSI 38 (45) Q Consensus 10 tkkvddknqanarcadliesfalvilwsi 38 (45) -||.|..|--.--|+|.+|-|.+.+.-.| T Consensus 141 FKkf~kenLfqi~~sDi~ERF~l~~~l~i 169 (320) T pfam05346 141 FKKFDKESLFQITCADVVERFQLLLMLLI 169 (320) T ss_pred HHHCCCCCEEHHHHHHHHHHHHHHHHHHH T ss_conf 63146355211016789999999999999 No 3 >KOG1467 consensus Probab=20.94 E-value=72 Score=15.12 Aligned_cols=19 Identities=37% Similarity=0.702 Sum_probs=15.7 Q ss_pred HHHHHHHHHHHHHHHHHHH Q ss_conf 0101059999999999999 Q 537021.9.peg.9 17 NQANARCADLIESFALVIL 35 (45) Q Consensus 17 nqanarcadliesfalvil 35 (45) -..|+||-++++.|--||- T Consensus 250 ~GsnaRCIa~L~afqevi~ 268 (556) T KOG1467 250 SGSNARCIAMLQAFQEVIK 268 (556) T ss_pred CCCCHHHHHHHHHHHHHHH T ss_conf 8940899999999999998 No 4 >TIGR00525 folB dihydroneopterin aldolase; InterPro: IPR006156 Dihydroneopterin aldolase catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin in the biosynthetic pathway of tetrahydrofolate. The enzyme form a homo-octamers. Aldolase can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin, but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin at appreciable velocity . ; GO: 0004150 dihydroneopterin aldolase activity, 0006760 folic acid and derivative metabolic process. Probab=17.74 E-value=84 Score=14.77 Aligned_cols=22 Identities=23% Similarity=0.243 Sum_probs=17.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 5999999999999999999852 Q 537021.9.peg.9 22 RCADLIESFALVILWSIFKKLK 43 (45) Q Consensus 22 rcadliesfalvilwsifkklk 43 (45) +-.+|||.+|..|+=.+|+... T Consensus 67 ~~~~LIEtlA~~~a~~~~~~~~ 88 (118) T TIGR00525 67 KPRKLIETLAERIADRLLADFP 88 (118) T ss_pred CCCCHHHHHHHHHHHHHHHHCC T ss_conf 9730124578999999886178 No 5 >KOG2052 consensus Probab=15.65 E-value=1.1e+02 Score=14.14 Aligned_cols=32 Identities=38% Similarity=0.645 Sum_probs=19.9 Q ss_pred HHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 6666411100101059999999999999999998 Q 537021.9.peg.9 8 VLTKKVDDKNQANARCADLIESFALVILWSIFKK 41 (45) Q Consensus 8 vltkkvddknqanarcadliesfalvilwsifkk 41 (45) ||....+.+.-..-+||| |-||.|| +|.|-.. T Consensus 391 vLdetin~~~Fesyk~AD-IYafgLV-~WEiarR 422 (513) T KOG2052 391 VLDETINMKHFESYKRAD-IYAFGLV-LWEIARR 422 (513) T ss_pred HHHHHCCHHHHHHHHHHH-HHHHHHH-HHHHHHH T ss_conf 753114756765675788-8887999-9999988 No 6 >COG5346 Predicted membrane protein [Function unknown] Probab=15.37 E-value=1.1e+02 Score=14.10 Aligned_cols=38 Identities=34% Similarity=0.378 Sum_probs=22.2 Q ss_pred CCHHHHHHHHCCHHHH-HHH-------HHHHHHHHHHHHHHHHHHHH Q ss_conf 4023666641110010-105-------99999999999999999985 Q 537021.9.peg.9 4 KNQAVLTKKVDDKNQA-NAR-------CADLIESFALVILWSIFKKL 42 (45) Q Consensus 4 knqavltkkvddknqa-nar-------cadliesfalvilwsifkkl 42 (45) |.||+- .+.|.||+. +.| -+-|+--|+.-..||||.+. T Consensus 64 kEQahr-H~~~~k~~~~q~r~~~~~~~tril~liFgi~LVvsi~~~t 109 (136) T COG5346 64 KEQAHR-HAIDLKNLKIQRRGQLYAKLTRILLLIFGIFLVVSIFPKT 109 (136) T ss_pred HHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999-9999865778898899999999999999999999999999 No 7 >KOG4120 consensus Probab=13.58 E-value=83 Score=14.79 Aligned_cols=34 Identities=29% Similarity=0.497 Sum_probs=25.6 Q ss_pred HHHCCHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 64111001-------01059999999999999999998524 Q 537021.9.peg.9 11 KKVDDKNQ-------ANARCADLIESFALVILWSIFKKLKN 44 (45) Q Consensus 11 kkvddknq-------anarcadliesfalvilwsifkklkn 44 (45) .|++|.|. ..||||.+-..-.-|-+|..||++.+ T Consensus 273 ~k~~dt~tfv~VmpsSSaRcAq~pra~dKv~~y~~lk~~rd 313 (426) T KOG4120 273 EKFGDTNTFVGVMPSSSARCAQYPRAEDKVNLYNLLKEERD 313 (426) T ss_pred CCCCCCCEEEEECCCCCHHHHCCCHHHHHHHHHHHHHHHHH T ss_conf 55798641799714751443148725433059999999999 No 8 >TIGR01561 gde_arch glycogen debranching enzyme, archaeal type, putative; InterPro: IPR006451 These sequences are largely uncharacterised archaeal proteins which include those from Methanosarcina acetivorans and Sulfolobus solfataricus. The group also contains sequences from the Gram-positive bacterium Clostridium perfringens and the Cyanobacterium Nostoc sp. All the sequences display weak relatedness to the characterised eukaryotic glycogen debranching enzyme of S. cerevisiae. . Probab=11.27 E-value=1.5e+02 Score=13.42 Aligned_cols=15 Identities=53% Similarity=0.671 Sum_probs=11.4 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999999999999999 Q 537021.9.peg.9 23 CADLIESFALVILWS 37 (45) Q Consensus 23 cadliesfalvilws 37 (45) -..|||||||-+|-. T Consensus 254 dskliesfalkllra 268 (575) T TIGR01561 254 DSKLIESFALKLLRA 268 (575) T ss_pred HHHHHHHHHHHHHHH T ss_conf 256788899888740 No 9 >pfam08583 Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like. Cmc1 is a metallo-chaperone like protein which is known to localize to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase. Probab=10.95 E-value=1.5e+02 Score=13.36 Aligned_cols=17 Identities=35% Similarity=0.702 Sum_probs=12.5 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 01010599999999999 Q 537021.9.peg.9 17 NQANARCADLIESFALV 33 (45) Q Consensus 17 nqanarcadliesfalv 33 (45) .++...|+++|..|+-- T Consensus 7 ~~~~~~C~~~i~a~~eC 23 (69) T pfam08583 7 KKARKKCAELIKALAEC 23 (69) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 88898779999999999 No 10 >KOG1692 consensus Probab=10.07 E-value=1e+02 Score=14.34 Aligned_cols=11 Identities=64% Similarity=1.226 Sum_probs=7.5 Q ss_pred HHHHHHHHHHH Q ss_conf 99999999985 Q 537021.9.peg.9 32 LVILWSIFKKL 42 (45) Q Consensus 32 lvilwsifkkl 42 (45) -|++||||.-+ T Consensus 168 RVv~wsife~~ 178 (201) T KOG1692 168 RVVLWSIFEAL 178 (201) T ss_pred EEEHHHHHHHH T ss_conf 04468888889 Done!