Query         537021.9.peg.931_1
Match_columns 45
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed May 25 03:30:58 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_931.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1ohea1 c.45.1.1 (A:42-198) Pr   6.9      81  0.0059   12.4   1.4   21   13-35     83-103 (157)
  2 d1vf5c3 f.23.23.1 (C:250-286)    5.2   1E+02  0.0075   11.8   3.5   27   18-44      1-27  (37)
  3 d2fswa1 a.4.5.69 (A:3-104) Hyp   4.4   1E+02  0.0073   11.9   0.5   29   12-40      2-31  (102)
  4 d2r7ca2 d.216.1.1 (A:2-143) Ro   4.2      89  0.0064   12.2   0.0   13    7-19     28-40  (142)
  5 d2e74h1 f.23.27.1 (H:3-29) Pet   3.6 1.4E+02    0.01   11.2   1.7   12   29-40      8-19  (27)
  6 d1nkta3 c.37.1.19 (A:-15-225,A   3.1 1.5E+02   0.011   10.9   2.3   12   23-34     76-87  (288)
  7 d2a7wa1 a.204.1.4 (A:4-94) Pho   2.9 1.6E+02   0.012   10.8   3.2   27    9-37     47-73  (91)
  8 d1q90a3 f.23.23.1 (A:248-292)    2.9 1.6E+02   0.012   10.8   3.5   23   21-43      3-25  (45)
  9 d2dnva1 b.34.13.2 (A:7-58) Chr   2.7 1.7E+02   0.013   10.6   0.5   11   20-30     41-51  (52)
 10 d1m55a_ d.89.1.3 (A:) Replicat   2.4 1.9E+02   0.014   10.4   3.4   27   15-41     44-72  (193)

No 1  
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=6.87  E-value=81  Score=12.41  Aligned_cols=21  Identities=38%  Similarity=0.577  Sum_probs=14.8

Q ss_pred             HCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11100101059999999999999
Q 537021.9.peg.9   13 VDDKNQANARCADLIESFALVIL   35 (45)
Q Consensus        13 vddknqanarcadliesfalvil   35 (45)
                      .|.+.++||  |=||-+|+..+|
T Consensus        83 ~d~~kraNA--a~Lig~Y~Vi~l  103 (157)
T d1ohea1          83 SDQRKQANA--AFLVGCYMVIYL  103 (157)
T ss_dssp             SCHHHHHHH--HHHHHHHHHHHS
T ss_pred             CCHHHHHHH--HHHHHHHHHHHH
T ss_conf             987888899--999999999981


No 2  
>d1vf5c3 f.23.23.1 (C:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
Probab=5.16  E-value=1e+02  Score=11.85  Aligned_cols=27  Identities=30%  Similarity=0.304  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             101059999999999999999998524
Q 537021.9.peg.9   18 QANARCADLIESFALVILWSIFKKLKN   44 (45)
Q Consensus        18 qanarcadliesfalvilwsifkklkn   44 (45)
                      |...|--.+|--|+.|++--||--||.
T Consensus         1 Q~p~Rv~gl~~F~~~v~laQi~lVlKK   27 (37)
T d1vf5c3           1 QDPNRVKWMIAFICLVMLAQLMLILKK   27 (37)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             985899999999999999999999889


No 3  
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]}
Probab=4.44  E-value=1e+02  Score=11.90  Aligned_cols=29  Identities=17%  Similarity=0.458  Sum_probs=14.1

Q ss_pred             HHCCHHHHHHHHHHHHH-HHHHHHHHHHHH
Q ss_conf             41110010105999999-999999999999
Q 537021.9.peg.9   12 KVDDKNQANARCADLIE-SFALVILWSIFK   40 (45)
Q Consensus        12 kvddknqanarcadlie-sfalvilwsifk   40 (45)
                      +.+|.+-.-++..++|. ...+.|+|.++.
T Consensus         2 ~~~~~~Cpv~~~l~ilg~kW~l~Il~~L~~   31 (102)
T d2fswa1           2 KISDEECPVRKSMQIFAGKWTLLIIFQINR   31 (102)
T ss_dssp             CCCSTTCHHHHHHHHHTSSSHHHHHHHHTT
T ss_pred             CCCCCCCCHHHHHHHHCCCCHHHHHHHHCC
T ss_conf             988799989999999949889999999836


No 4  
>d2r7ca2 d.216.1.1 (A:2-143) Rotavirus NSP2 fragment, N-terminal domain {Simian 11 rotavirus [TaxId: 10923]}
Probab=4.18  E-value=89  Score=12.19  Aligned_cols=13  Identities=54%  Similarity=0.667  Sum_probs=7.3

Q ss_pred             HHHHHHHCCHHHH
Q ss_conf             3666641110010
Q 537021.9.peg.9    7 AVLTKKVDDKNQA   19 (45)
Q Consensus         7 avltkkvddknqa   19 (45)
                      ..|+-|||.+++.
T Consensus        28 cML~AKvdK~~~~   40 (142)
T d2r7ca2          28 AMLTAKVDKKDMD   40 (142)
T ss_dssp             HHHTCCCCTTSSS
T ss_pred             HHHHHHHCHHHHC
T ss_conf             8988552553302


No 5  
>d2e74h1 f.23.27.1 (H:3-29) PetN subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
Probab=3.59  E-value=1.4e+02  Score=11.16  Aligned_cols=12  Identities=33%  Similarity=0.653  Sum_probs=7.1

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q 537021.9.peg.9   29 SFALVILWSIFK   40 (45)
Q Consensus        29 sfalvilwsifk   40 (45)
                      |.-.|.-|||--
T Consensus         8 ~llvvftwsiam   19 (27)
T d2e74h1           8 ALLVVFTWSIAM   19 (27)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHEEEE
T ss_conf             888876322346


No 6  
>d1nkta3 c.37.1.19 (A:-15-225,A:350-396) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=3.09  E-value=1.5e+02  Score=10.88  Aligned_cols=12  Identities=33%  Similarity=0.210  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q 537021.9.peg.9   23 CADLIESFALVI   34 (45)
Q Consensus        23 cadliesfalvi   34 (45)
                      -..|.|.||+|-
T Consensus        76 DdiLpEAFAlVR   87 (288)
T d1nkta3          76 DDLLPEAFAVAR   87 (288)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999999


No 7  
>d2a7wa1 a.204.1.4 (A:4-94) Phosphoribosyl-ATP pyrophosphatase HisE {Chromobacterium violaceum [TaxId: 536]}
Probab=2.94  E-value=1.6e+02  Score=10.78  Aligned_cols=27  Identities=30%  Similarity=0.378  Sum_probs=17.5

Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66641110010105999999999999999
Q 537021.9.peg.9    9 LTKKVDDKNQANARCADLIESFALVILWS   37 (45)
Q Consensus         9 ltkkvddknqanarcadliesfalvilws   37 (45)
                      ..-+-+|+...-.-.|||+  |-+.++|.
T Consensus        47 ~A~~~~~~~~vi~EaADLl--yHllVlL~   73 (91)
T d2a7wa1          47 MASKDKDKLHLVREVADLW--FHTMVLLT   73 (91)
T ss_dssp             HHHHTTCHHHHHHHHHHHH--HHHHHHHH
T ss_pred             HHHHHCCHHHHHHHHHHHH--HHHHHHHH
T ss_conf             9998178888998999999--99999999


No 8  
>d1q90a3 f.23.23.1 (A:248-292) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
Probab=2.91  E-value=1.6e+02  Score=10.76  Aligned_cols=23  Identities=35%  Similarity=0.486  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             05999999999999999999852
Q 537021.9.peg.9   21 ARCADLIESFALVILWSIFKKLK   43 (45)
Q Consensus        21 arcadliesfalvilwsifkklk   43 (45)
                      .|--.++--|+.|++-.||--||
T Consensus         3 ~Rv~gll~F~~~v~laQi~LVLK   25 (45)
T d1q90a3           3 ARIQGLLVFFSFVLLTQVLLVLK   25 (45)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89998999999999999999988


No 9  
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=2.70  E-value=1.7e+02  Score=10.63  Aligned_cols=11  Identities=36%  Similarity=0.443  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHH
Q ss_conf             10599999999
Q 537021.9.peg.9   20 NARCADLIESF   30 (45)
Q Consensus        20 narcadliesf   30 (45)
                      |-.|.+||+.|
T Consensus        41 nl~~~~li~~f   51 (52)
T d2dnva1          41 NILDARLLAAF   51 (52)
T ss_dssp             TCCCHHHHHHH
T ss_pred             HCCCHHHHHHC
T ss_conf             99996999842


No 10 
>d1m55a_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
Probab=2.40  E-value=1.9e+02  Score=10.41  Aligned_cols=27  Identities=19%  Similarity=0.356  Sum_probs=0.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHH--HHHHHH
Q ss_conf             100101059999999999999--999998
Q 537021.9.peg.9   15 DKNQANARCADLIESFALVIL--WSIFKK   41 (45)
Q Consensus        15 dknqanarcadliesfalvil--wsifkk   41 (45)
                      |-|..++.-.+++|+++-+++  |..|.+
T Consensus        44 ~~~~~~~~~~t~~ek~~~~~l~~w~~~~~   72 (193)
T d1m55a_          44 NLTLVEQPQLTVADRIRRVFLYEWNKFSK   72 (193)
T ss_dssp             CGGGSCHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             61013311489999999999999987315


Done!