RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= 537021.9.peg.931_1
         (45 letters)



>gnl|CDD|183254 PRK11644, PRK11644, sensory histidine kinase UhpB; Provisional.
          Length = 495

 Score = 27.6 bits (62), Expect = 0.74
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 3   IKNQAVLTKKVDDKNQANARCADLIESFALVI 34
           I+ QA + K++   N +  + A LIE  +L +
Sbjct: 320 IRTQAGIIKRLAADNASVKQSAQLIEQLSLGV 351


>gnl|CDD|162514 TIGR01742, SA_tandem_lipo, Staphylococcus tandem lipoproteins.
           Members of this family are predicted lipoproteins
           (mostly), found in Staphylococcus aureus in several
           different tandem clusters in pathogenicity islands.
           Members are also found, clustered, in Staphylococcus
           epidermidis.
          Length = 255

 Score = 25.6 bits (56), Expect = 3.4
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 5/43 (11%)

Query: 3   IKNQAVLTKKVDDKNQANARCADLIESFALVILWSIFKKLKNH 45
           + N+ VLTK V D N         IE+F   I +   K L N+
Sbjct: 133 VNNKIVLTKDVKDPNLKKE-----IENFKFFIQYGNLKSLLNY 170


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.324    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0625    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 636,320
Number of extensions: 21182
Number of successful extensions: 52
Number of sequences better than 10.0: 1
Number of HSP's gapped: 52
Number of HSP's successfully gapped: 3
Length of query: 45
Length of database: 5,994,473
Length adjustment: 18
Effective length of query: 27
Effective length of database: 5,605,529
Effective search space: 151349283
Effective search space used: 151349283
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.3 bits)