BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 537021.9.peg.937_1
         (48 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>537021.9.peg.937_1 
          Length = 48

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/48 (100%), Positives = 48/48 (100%)

Query: 1  VSKSILDGFFSNKSRMSTLHLFILIKVILFHSMTGYYIDNPLFCSEKR 48
          VSKSILDGFFSNKSRMSTLHLFILIKVILFHSMTGYYIDNPLFCSEKR
Sbjct: 1  VSKSILDGFFSNKSRMSTLHLFILIKVILFHSMTGYYIDNPLFCSEKR 48


>gi|254781196|ref|YP_003065609.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 119

 Score = 26.6 bits (57), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 24 LIKVILFHSMTGYYIDNPLFCS 45
          L+K+ L H    Y +DNPLF  
Sbjct: 66 LVKIALHHQKWYYRLDNPLFTD 87


>gi|254780131|ref|YP_003064544.1| DNA ligase, NAD-dependent [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 119

 Score = 25.0 bits (53), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 24 LIKVILFHSMTGYYIDNPLFCS 45
          L+K+ L H    Y +D+PLF  
Sbjct: 66 LVKIALHHQKWYYRLDDPLFTD 87


>gi|254780425|ref|YP_003064838.1| apolipoprotein N-acyltransferase [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 518

 Score = 19.6 bits (39), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 5  ILDGFFSNKSRMSTL 19
          +LDG  SN  RMS +
Sbjct: 50 LLDGISSNLGRMSAI 64


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.331    0.143    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 30,831
Number of Sequences: 1233
Number of extensions: 809
Number of successful extensions: 6
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of query: 48
length of database: 328,796
effective HSP length: 21
effective length of query: 27
effective length of database: 302,903
effective search space:  8178381
effective search space used:  8178381
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 31 (16.5 bits)