Query 537021.9.peg.942_1 Match_columns 50 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 06:25:01 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_942.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02927 SucB_Actino 2-oxoglu 36.5 15 0.00039 18.6 1.0 33 9-41 405-437 (607) 2 KOG3188 consensus 29.0 26 0.00067 17.4 1.2 17 29-45 137-153 (246) 3 KOG3132 consensus 21.5 8.2 0.00021 20.0 -2.6 13 37-49 163-175 (325) 4 pfam05863 consensus 19.5 66 0.0017 15.3 1.7 16 29-44 138-153 (238) 5 cd00836 FERM_C The FERM_C doma 18.0 57 0.0014 15.7 1.1 14 14-27 76-89 (92) 6 pfam11243 DUF3045 Protein of u 17.2 98 0.0025 14.4 2.1 27 3-31 26-52 (90) 7 pfam09385 HisK_N Histidine kin 14.4 73 0.0019 15.1 0.9 41 7-47 66-115 (133) 8 pfam09380 FERM_C FERM C-termin 9.7 1.4E+02 0.0035 13.7 1.0 14 15-28 66-79 (85) 9 KOG1832 consensus 9.2 34 0.00085 16.9 -2.2 39 2-40 1192-1230(1516) 10 cd07695 Ig3_CD4_like Third imm 8.8 1.1E+02 0.0028 14.2 0.3 20 21-40 1-20 (109) No 1 >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (IPR001078 from INTERPRO), one or two biotin domains (IPR000089 from INTERPRO) and an E3-component binding domain (IPR004167 from INTERPRO).. Probab=36.47 E-value=15 Score=18.62 Aligned_cols=33 Identities=36% Similarity=0.477 Sum_probs=28.6 Q ss_pred HHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH Q ss_conf 998877899999962121020122152247899 Q 537021.9.peg.9 9 RKVACERKRVYKSCVEQNEVLLTLLPFPLTAQM 41 (50) Q Consensus 9 rkvacerkrvykscveqnevlltllpfpltaqm 41 (50) -||+--|+|--..-.|.|-|-||.|||-..|-. T Consensus 405 TrvaaLRaraK~~F~ek~Gv~LTfLPFfv~Av~ 437 (607) T TIGR02927 405 TRVAALRARAKAEFLEKEGVNLTFLPFFVKAVV 437 (607) T ss_pred HHHHHHHHHCCHHHHHHCCCCCCHHHHHHHHHH T ss_conf 348888640155778716873001578999999 No 2 >KOG3188 consensus Probab=28.96 E-value=26 Score=17.39 Aligned_cols=17 Identities=41% Similarity=0.759 Sum_probs=12.9 Q ss_pred EEEEECCHHHHHHHHHH Q ss_conf 01221522478999999 Q 537021.9.peg.9 29 LLTLLPFPLTAQMLSII 45 (50) Q Consensus 29 lltllpfpltaqmlsii 45 (50) .+|-+|||||...-|+. T Consensus 137 v~~kvPFPLTlrFK~Ml 153 (246) T KOG3188 137 VTTKVPFPLTLRFKSML 153 (246) T ss_pred HHHCCCCHHHHHHHHHH T ss_conf 88458860389899999 No 3 >KOG3132 consensus Probab=21.51 E-value=8.2 Score=20.05 Aligned_cols=13 Identities=46% Similarity=0.864 Sum_probs=9.6 Q ss_pred HHHHHHHHHHHHH Q ss_conf 4789999998762 Q 537021.9.peg.9 37 LTAQMLSIIDCIY 49 (50) Q Consensus 37 ltaqmlsiidciy 49 (50) -+|+-.+|.|||| T Consensus 163 ~~a~~ytILDCIy 175 (325) T KOG3132 163 GPANSYTILDCIY 175 (325) T ss_pred CCCCCCEEEEEEE T ss_conf 8766615644332 No 4 >pfam05863 consensus Probab=19.45 E-value=66 Score=15.34 Aligned_cols=16 Identities=44% Similarity=0.827 Sum_probs=10.8 Q ss_pred EEEEECCHHHHHHHHH Q ss_conf 0122152247899999 Q 537021.9.peg.9 29 LLTLLPFPLTAQMLSI 44 (50) Q Consensus 29 lltllpfpltaqmlsi 44 (50) +++-+|||||...-|. T Consensus 138 Vv~K~PFPLT~rFK~M 153 (238) T pfam05863 138 VVAKLPFPLTIRFKSM 153 (238) T ss_pred EEEECCCCCHHHHHHH T ss_conf 2463487550888999 No 5 >cd00836 FERM_C The FERM_C domain is the third structural domain within the FERM domain. The FERM domain is found in the cytoskeletal-associated proteins such as ezrin, moesin, radixin, 4.1R, and merlin. These proteins provide a link between the membrane and cytoskeleton and are involved in signal transduction pathways. The FERM_C domain is also found in protein tyrosine phosphatases (PTPs) , the tryosine kinases FAKand JAK, in addition to other proteins involved in signaling. This domain is structuraly similar to the PH and PTB domains and consequently is capable of binding to both peptides and phospholipids at different sites. Probab=18.03 E-value=57 Score=15.67 Aligned_cols=14 Identities=43% Similarity=0.681 Sum_probs=10.6 Q ss_pred HHHHHHHHHHCCCC Q ss_conf 78999999621210 Q 537021.9.peg.9 14 ERKRVYKSCVEQNE 27 (50) Q Consensus 14 erkrvykscveqne 27 (50) .-|.++++|+||.. T Consensus 76 ~ak~lwk~cve~H~ 89 (92) T cd00836 76 ACKYLWKLCVEQHA 89 (92) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999987551 No 6 >pfam11243 DUF3045 Protein of unknown function (DUF3045). Members in this family of proteins are annotated as gene protein 30.1. Currently no function is known. Probab=17.23 E-value=98 Score=14.43 Aligned_cols=27 Identities=30% Similarity=0.559 Sum_probs=17.9 Q ss_pred CHHHHHHHHHHHHHHHHHHHHCCCCEEEE Q ss_conf 23678999887789999996212102012 Q 537021.9.peg.9 3 ARNSMFRKVACERKRVYKSCVEQNEVLLT 31 (50) Q Consensus 3 arnsmfrkvacerkrvykscveqnevllt 31 (50) .-|..||.+. ..+.+|.||||.-...+ T Consensus 26 R~nP~fr~~K--D~~IFk~CVeqGFiYvs 52 (90) T pfam11243 26 RCNPEFRAQK--DAEIFKECVEQGFIYIS 52 (90) T ss_pred HCCHHHHHHC--HHHHHHHHHHCCEEEEE T ss_conf 1488988623--18999999970538865 No 7 >pfam09385 HisK_N Histidine kinase N terminal. This domain is found at the N terminal of sensor histidine kinase proteins. Probab=14.42 E-value=73 Score=15.10 Aligned_cols=41 Identities=29% Similarity=0.375 Sum_probs=29.3 Q ss_pred HHHHHHHHHHH--------HHHHHHCCCCEEEEEECCHHHHHHHH-HHHH Q ss_conf 89998877899--------99996212102012215224789999-9987 Q 537021.9.peg.9 7 MFRKVACERKR--------VYKSCVEQNEVLLTLLPFPLTAQMLS-IIDC 47 (50) Q Consensus 7 mfrkvacerkr--------vykscveqnevlltllpfpltaqmls-iidc 47 (50) .-.|+|-||-. ||..++..+|++-.+.-.|++.+-|. +||- T Consensus 66 la~KiA~ER~eA~~NIgeFVYN~N~GR~ei~~~l~~~~~~~~eL~~iI~k 115 (133) T pfam09385 66 LAEKIAKERAEADVNIGEFVYNVNLGRSEIIKHLNLLDVDWDELQPIIDK 115 (133) T ss_pred HHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHHCCCCCHHHHHHHHHH T ss_conf 99999999865125799999872230999999998289999999999999 No 8 >pfam09380 FERM_C FERM C-terminal PH-like domain. Probab=9.71 E-value=1.4e+02 Score=13.70 Aligned_cols=14 Identities=43% Similarity=0.683 Sum_probs=11.3 Q ss_pred HHHHHHHHHCCCCE Q ss_conf 89999996212102 Q 537021.9.peg.9 15 RKRVYKSCVEQNEV 28 (50) Q Consensus 15 rkrvykscveqnev 28 (50) -|.+++.|+||..- T Consensus 66 ~K~lwk~cv~~H~F 79 (85) T pfam09380 66 CKYLWKLCVEQHAF 79 (85) T ss_pred HHHHHHHHHHHHHH T ss_conf 99999999986586 No 9 >KOG1832 consensus Probab=9.23 E-value=34 Score=16.85 Aligned_cols=39 Identities=23% Similarity=0.235 Sum_probs=25.6 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH Q ss_conf 523678999887789999996212102012215224789 Q 537021.9.peg.9 2 FARNSMFRKVACERKRVYKSCVEQNEVLLTLLPFPLTAQ 40 (50) Q Consensus 2 farnsmfrkvacerkrvykscveqnevlltllpfpltaq 40 (50) |+..+|||-+.|+++.+----++.+.+|+|+|.--++.| T Consensus 1192 Fsn~~q~r~~gt~~d~a~~YDvqT~~~l~tylt~~~~~~ 1230 (1516) T KOG1832 1192 FSNSLQFRALGTEADDALLYDVQTCSPLQTYLTDTVTSS 1230 (1516) T ss_pred HHHHHHHHHHCCCCCCEEEEECCCCCHHHHHCCCCHHHH T ss_conf 112677877513555238884345768887518412334 No 10 >cd07695 Ig3_CD4_like Third immunoglobulin (Ig) domain of CD4. Ig3_CD4; third immunoglobulin (Ig) domain of CD4. CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell. CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules. CD4 contains four immunoglobulin domains, with the first three included in this hierarchy. The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy. Probab=8.84 E-value=1.1e+02 Score=14.17 Aligned_cols=20 Identities=50% Similarity=0.688 Sum_probs=0.0 Q ss_pred HHHCCCCEEEEEECCHHHHH Q ss_conf 96212102012215224789 Q 537021.9.peg.9 21 SCVEQNEVLLTLLPFPLTAQ 40 (50) Q Consensus 21 scveqnevlltllpfpltaq 40 (50) |||-..|--+...-|||+++ T Consensus 1 s~vY~~eg~~v~fsfPL~~~ 20 (109) T cd07695 1 SCVYAVIGVLVLFSFPLMAQ 20 (109) T ss_pred CCEEEEEEEEEEEECCCCHH T ss_conf 92576530688885143133 Done!